HHsearch alignment for GI: 254780409 and conserved domain: PRK02039

>PRK02039 consensus.
Probab=100.00  E-value=0  Score=754.25  Aligned_cols=309  Identities=57%  Similarity=0.880  Sum_probs=302.7

Q ss_pred             CEEEECCCCHHHHHHHHHHHCCCEEEEEEEECCCCEEEEEECCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             98997689999999999995891044489986997078885678689708998597888046799999999999861720
Q gi|254780409|r    1 MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPANDYLMELLIMIDAVRRSSAR   80 (310)
Q Consensus         1 m~i~~g~~~~~La~~ia~~lg~~l~~~~~~~F~dGE~~v~i~~~vrg~dV~ivqs~~~~~nd~lmeLl~~~~a~k~~~A~   80 (310)
T Consensus         6 ~~ifsgss~~~LA~~Ia~~Lg~~l~~~~~~~F~DGE~~v~i~esvrg~dV~ivqs~~~p~nd~lmELll~idA~r~a~A~   85 (316)
T PRK02039          6 LMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQVEIQENVRGKDVFVLQSTCAPTNDNLMELMIMVDALKRASAG   85 (316)
T ss_pred             EEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCCCCEEEEECCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             79997999889999999996997312189988999889863787689988999289998207899999999999873887


Q ss_pred             HHHHHCCCCCHHHCCCCCCCCC-CHHHHHHHHHHEECCCCEEEEECCCCHHHHHHCCCCCEECCHHHHHHHHHHHHCCCC
Q ss_conf             0113102330110343112565-214777652000026772699515835776525886200010377778765305855
Q gi|254780409|r   81 RITGVIPYFGYCRQDRKPSPRT-PISAKLVANLITQAGADRVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDIS  159 (310)
Q Consensus        81 ~it~ViPY~~YaRqDr~~~~~e-~isak~~a~ll~~~G~d~vit~DlH~~~~~~~F~ip~~nl~~~~~l~~~l~~~~~~~  159 (310)
T Consensus        86 ~It~ViPY~~YaRQDr~~~~gr~pisak~vA~ll~~aG~d~vitvDlH~~qi~gfF~iPv~~l~a~~~~~~~~~~~-~~~  164 (316)
T PRK02039         86 RITAAIPYFGYARQDRRPRSARVAISAKVVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPILLGDLRKQ-NYS  164 (316)
T ss_pred             EEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHCCCCCCCCEECCHHHHHHHHHH-CCC
T ss_conf             4899842545334776556887653099999876232777048852783888306799700021408888999861-778


Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCEEECCCCCCCCCEEEEECHHHCCHHHHHHHHHHHHHCCCCC
Q ss_conf             51885166563578999999709979998326767632100002454557428995213203366888989875268752
Q gi|254780409|r  160 NLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALS  239 (310)
Q Consensus       160 ~~vVVaPD~G~~~ra~~~a~~L~~~~~~~~K~R~~~~~v~~~~~~gdV~gr~vIIVDDii~TGgTi~~aa~~Lk~~GA~~  239 (310)
T Consensus       165 ~~vvVsPD~G~~~ra~~~a~~L~~~~~~~~K~R~~~~~~e~~~~igdV~Gk~~IIVDDiIdTGgTl~~aa~~Lk~~GA~~  244 (316)
T PRK02039        165 DLLVVSPDVGGVVRARALAKQLNCDLAIIDKRRPKANVAEVMNIIGEVEGRTCVIMDDMVDTAGTLCKAAQVLKERGAKQ  244 (316)
T ss_pred             CCEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCEEEECCCCCCCCCEEEEECCHHHCHHHHHHHHHHHHHCCCCE
T ss_conf             73898469408899999999829997999841588870363024665389726711725545688999999999769985


Q ss_pred             EEEEEECCCCCHHHHHHHHHCCCCEEEECCCCCCCHHHHCCCCEEEEECHHHHHHHHHHHHCCCCCCHHCC
Q ss_conf             17872055557168988863699899981788784347407985998117999999998718887313009
Q gi|254780409|r  240 VTAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTFEERSISSLFD  310 (310)
Q Consensus       240 V~~~~THgifs~~a~e~l~~s~i~~iv~TnTi~~~~~~~~~~ki~visva~llA~aI~~i~~~~Svs~l~~  310 (310)
T Consensus       245 V~~~~THgvfs~~A~~rl~~s~i~~vvvTnTip~~~~~~~~~ki~vlsva~llAeaI~rih~~~Svs~Lf~  315 (316)
T PRK02039        245 VFAYATHPVLSGGAAERIAASALDELVVTDTIPLSAESLACPKIRQLSSAGLLAETFSRIRRGDSVMSLFA  315 (316)
T ss_pred             EEEEEECCCCCCHHHHHHHCCCCCEEEEECCCCCCHHHCCCCCEEEEEHHHHHHHHHHHHHCCCCHHHHHC
T ss_conf             79999784257349999860899789993898886344458980999879999999999867997789618