HHsearch alignment for GI: 254780409 and conserved domain: PRK02269

>PRK02269 ribose-phosphate pyrophosphokinase; Provisional.
Probab=98.29  E-value=2.5e-05  Score=55.66  Aligned_cols=141  Identities=18%  Similarity=0.166  Sum_probs=92.8

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCEEECCCCCCCCCEEEEECHHHCC-HHH---HHHHHHHHH
Q ss_conf             5551885166563578999999709979998326767632100002454557428995213203-366---888989875
Q gi|254780409|r  158 ISNLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDT-GGT---LCGAADALY  233 (310)
Q Consensus       158 ~~~~vVVaPD~G~~~ra~~~a~~L~~~~~~~~K~R~~~~~v~~~~~~gdV~gr~vIIVDDii~T-GgT---i~~aa~~Lk  233 (310)
T Consensus         3 ~~~~~lf~g-ss~~~La~~IA~~Lg~~l~~~~~~~F~DGE~~v-~i~e~vrg~dV~ivqs~~~pvnd~lmELll~idAlr   80 (321)
T PRK02269          3 YSDLKLFAL-SSNKELAEKVASAIGIQLGKSTVRQFSDGEIQV-NIEESIRGHHVFILQSTSSPVNDNLMEILIMVDALK   80 (321)
T ss_pred             CCCEEEEEC-CCCHHHHHHHHHHHCCCCEEEEEEECCCCCEEE-EECCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             777599989-999899999999869982422889889998898-757877898089990799995379999999999998


Q ss_pred             HCCCCCEEEEEECCCCC-------------HH-HHHHHHHCCCCEEEECCCCCCCHHHHCCCCEEEEECHHHHHHHHHHH
Q ss_conf             26875217872055557-------------16-89888636998999817887843474079859981179999999987
Q gi|254780409|r  234 EQGALSVTAYITHGVLS-------------SS-SIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRT  299 (310)
Q Consensus       234 ~~GA~~V~~~~THgifs-------------~~-a~e~l~~s~i~~iv~TnTi~~~~~~~~~~ki~visva~llA~aI~~i  299 (310)
T Consensus        81 ~a~A~~It~ViPY~~YaRQDr~~~~ge~isak~vA~lL~~~g~d~vitvDlH~~~i~gfF~ipv~~l~~~~~~~~~i~~~  160 (321)
T PRK02269         81 RASAESISVVMPYYGYARQDRKARSREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDRH  160 (321)
T ss_pred             HCCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCCCHHHHHCCCCCCCCEEECHHHHHHHHHH
T ss_conf             74897399981355313045445789972699999988744877799962674777632699841113038999999984


Q ss_pred             H
Q ss_conf             1
Q gi|254780409|r  300 F  300 (310)
Q Consensus       300 ~  300 (310)
T Consensus       161 ~  161 (321)
T PRK02269        161 G  161 (321)
T ss_pred             C
T ss_conf             7