HHsearch alignment for GI: 254780409 and conserved domain: PRK06827

>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional.
Probab=96.63  E-value=0.07  Score=32.86  Aligned_cols=132  Identities=17%  Similarity=0.220  Sum_probs=68.8

Q ss_pred             CCCCHHHHHHHHHHHCCCEEEEEEEE-C---CCCEEE---EE-ECCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             68999999999999589104448998-6---997078---88-5678689708998597888046799999999999861
Q gi|254780409|r    6 GNSNRNLAQEICDYLHTSLGKASVTY-F---SDREVF---VE-IGENVRGEDVFIVQSTSCPANDYLMELLIMIDAVRRS   77 (310)
Q Consensus         6 g~~~~~La~~ia~~lg~~l~~~~~~~-F---~dGE~~---v~-i~~~vrg~dV~ivqs~~~~~nd~lmeLl~~~~a~k~~   77 (310)
T Consensus       216 D~Ggv~RA~~~A~~L~~~laii~KrR~~s~v~~~~n~i~~~~~lggdV~GK~~IIvDDmIdTg-gT---l~~aA~~Lk~~  291 (381)
T PRK06827        216 DTGAMDRAKYYSSVLKVPLGLFYKRRDYSTVVNGKNPIVVHELLGRDVEGKDVFIVDDMIASG-GS---VLDAAKELKSR  291 (381)
T ss_pred             CCCCHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCEEEEEEECCCCCCCEEEEECCCCCCC-HH---HHHHHHHHHHC
T ss_conf             997389999999971989899997646764456678436752413556798899972431452-68---99999999987


Q ss_pred             CCCHHHHHCCCCCHHHCCCCCCCCCCHHHHHHHHHHEECCCCEEEEECC--CCHHHHHHCCCC-CEECCHHHHHHHHHHH
Q ss_conf             7200113102330110343112565214777652000026772699515--835776525886-2000103777787653
Q gi|254780409|r   78 SARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADRVIMLDL--HAGQVQGFFDIP-TDNLYALPILERDIKE  154 (310)
Q Consensus        78 ~A~~it~ViPY~~YaRqDr~~~~~e~isak~~a~ll~~~G~d~vit~Dl--H~~~~~~~F~ip-~~nl~~~~~l~~~l~~  154 (310)
T Consensus       292 GA~~V~a~aTHgvf-------S-~---a~e~~~~~~e~~~i~~vvvTNti~~~~~l---~~~~ki~vlsva~llAeaI~r  357 (381)
T PRK06827        292 GAKKIICAVSFPFF-------T-E---GLEKFDKAYEEGYIYRIIGTNLVYHPEEL---KSKPWYTEADVSELFARIIFR  357 (381)
T ss_pred             CCCEEEEEEECHHC-------C-C---HHHHHHHHHHCCCCCEEEECCCCCCCHHH---HCCCCEEEEEHHHHHHHHHHH
T ss_conf             99889999973660-------4-7---69999764542886489977999899678---158983998869999999999


Q ss_pred             H
Q ss_conf             0
Q gi|254780409|r  155 R  155 (310)
Q Consensus       155 ~  155 (310)
T Consensus       358 I  358 (381)
T PRK06827        358 L  358 (381)
T ss_pred             H
T ss_conf             8