HHsearch results for GI: 254780409 and protein with PDBid: 1bd3_D

>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D*
Probab=98.18  E-value=1.1e-05  Score=56.72  Aligned_cols=113  Identities=18%  Similarity=0.237  Sum_probs=83.3

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHC-CCCEEEEECCCCCCC-CCE--EECCCCCCCCCEEEEECHHHCCHHHHHHHHHHHHH
Q ss_conf             55188516656357899999970-997999832676763-210--00024545574289952132033668889898752
Q gi|254780409|r  159 SNLMVVSPDVGGVVRARALAKRL-GCLLAIVDKRREHPG-KIE--VMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYE  234 (310)
Q Consensus       159 ~~~vVVaPD~G~~~ra~~~a~~L-~~~~~~~~K~R~~~~-~v~--~~~~~gdV~gr~vIIVDDii~TGgTi~~aa~~Lk~  234 (310)
                      +++++|+.=-.|......+.+.+ ++..+.+.-+|+... +.+  -..+..+++++.|+|+|-|+.||||++.|.+.|++
T Consensus       102 ~~v~~V~ILRAGl~m~~g~~~~~P~a~vg~i~i~Rde~t~ep~~yy~klP~~i~~~~Vll~DPMLATG~S~~~ai~~L~~  181 (243)
T 1bd3_D          102 SKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDETTAEPKLIYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLR  181 (243)
T ss_dssp             CCEEEEEEETTTHHHHHHHHHHSTTCCEEEEEEEECSSSCCEEEEEEECCTTGGGSEEEEECSEESSCHHHHHHHHHHHH
T ss_pred             CCEEEEEEECCCCHHHHHHHHHCCCHHHCEEEECCCCCCCCCEEEHHHCCCCCCCCEEEEECCHHHCCHHHHHHHHHHHH
T ss_conf             85278875406630788899868751221576302677788143142284211014589868055057229999999997


Q ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHCC-CCEEEECCCCC
Q ss_conf             687521787205555716898886369-98999817887
Q gi|254780409|r  235 QGALSVTAYITHGVLSSSSIERIEKSK-MKELVITDSIQ  272 (310)
Q Consensus       235 ~GA~~V~~~~THgifs~~a~e~l~~s~-i~~iv~TnTi~  272 (310)
                      +|++.-...+.+-+-+..+++++.+.. =-+||+ -.|.
T Consensus       182 ~Gv~~~~I~~vsvias~~Gi~~l~~~~P~v~I~t-a~iD  219 (243)
T 1bd3_D          182 LGVKEERIIFVNILAAPQGIERVFKEYPKVRMVT-AAVD  219 (243)
T ss_dssp             HTCCGGGEEEEEEEECHHHHHHHHHHCTTSEEEE-EEEC
T ss_pred             CCCCCCEEEEEEEEECHHHHHHHHHHCCCCEEEE-EEEC
T ss_conf             1998540799999865899999998797988999-9865