HHsearch results for GI: 254780409 and protein with PDBid: 3dez_A

>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans}
Probab=99.09  E-value=1.9e-09  Score=81.63  Aligned_cols=117  Identities=21%  Similarity=0.305  Sum_probs=87.8

Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCEEECCCCC-CCCCEEEEECHHHCCHH
Q ss_conf             37777876530585551885166563578999999709979998326767632100002454-55742899521320336
Q gi|254780409|r  145 LPILERDIKERNDISNLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGK-VEGKDCILIDDIVDTGG  223 (310)
Q Consensus       145 ~~~l~~~l~~~~~~~~~vVVaPD~G~~~ra~~~a~~L~~~~~~~~K~R~~~~~v~~~~~~gd-V~gr~vIIVDDii~TGg  223 (310)
                      ...+++.+++. ..+..+|++|..||+..+..++.+++.|+.++.|++...+...  .+.|. .+|..|+||||++.|||
T Consensus        87 ~~~~~~~i~~~-~~~~d~i~G~a~~gIp~a~~ia~~~~~p~~~vRke~K~~G~~~--~ieg~~~~g~rVlIVEDViTTGg  163 (243)
T 3dez_A           87 ENGFVETIKEA-FPEVEVIAGTATAGIPHGAIIADKMNLPLAYIRSKPKDHGAGN--QIEGRVTKGQKMVIIEDLISTGG  163 (243)
T ss_dssp             HHHHHHHHHHH-CTTCCEEEEETTTTHHHHHHHHHHTTCCEEEECSSCC-----C--CEESCCCTTCEEEEEEEEESSSH
T ss_pred             HHHHHHHHHHH-CCCCCEEECCCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCE--EEECCCCCCCEEEEEEEEECCCC
T ss_conf             99999999862-2456634233112189999999861798414676404776304--67303599998999851145674


Q ss_pred             HHHHHHHHHHHCCCCCEEEE--EECCCCCHHHHHHHHHCCCCEEE
Q ss_conf             68889898752687521787--20555571689888636998999
Q gi|254780409|r  224 TLCGAADALYEQGALSVTAY--ITHGVLSSSSIERIEKSKMKELV  266 (310)
Q Consensus       224 Ti~~aa~~Lk~~GA~~V~~~--~THgifs~~a~e~l~~s~i~~iv  266 (310)
                      |+.++++.|++.|+.-+.++  +...  -.++.+++.+.++.-.-
T Consensus       164 Sileai~~l~~~G~~V~~v~vivDR~--~~g~~~~l~~~Gv~~~s  206 (243)
T 3dez_A          164 SVLDAVAAAQREGADVLGVVAIFTYE--LPKATANFEKASVKLVT  206 (243)
T ss_dssp             HHHHHHHHHHHTTCEEEEEEEEEECC--CHHHHHHHHHHTCCEEE
T ss_pred             CHHHHHHHHHHCCCEEEEEEEEEECC--CCHHHHHHHHCCCCEEE
T ss_conf             45899999998799799999999888--62179999966997999