HHsearch results for GI: 254780409 and protein with PDBid: 3mjd_A

>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis}
Probab=98.92  E-value=9.5e-09  Score=76.96  Aligned_cols=94  Identities=19%  Similarity=0.252  Sum_probs=72.8

Q ss_pred             HHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHC------CCCEEEEECCCCCCCCCEEECCCCC-CCCCEEEEECHHHC
Q ss_conf             7787653058555188516656357899999970------9979998326767632100002454-55742899521320
Q gi|254780409|r  148 LERDIKERNDISNLMVVSPDVGGVVRARALAKRL------GCLLAIVDKRREHPGKIEVMNIIGK-VEGKDCILIDDIVD  220 (310)
Q Consensus       148 l~~~l~~~~~~~~~vVVaPD~G~~~ra~~~a~~L------~~~~~~~~K~R~~~~~v~~~~~~gd-V~gr~vIIVDDii~  220 (310)
                      +++.+.+. +.+..+|++|-.||++.+..+|..|      +.|+.+..|+....++-  ..+.|. .+|+.|+||||++.
T Consensus        71 ~a~~i~~~-~~~~D~i~G~a~gGIpla~~vA~~l~~~~~~~~p~~~~RKe~K~hG~~--~~ieG~~~~g~~VlIVDDViT  147 (232)
T 3mjd_A           71 YAQLIIKS-DVKYDILFGPAYKGIPLVAAISTVLALKYNIDMPYAFDRKEAKDHGEG--GVFVGADMTNKKVLLIDDVMT  147 (232)
T ss_dssp             HHHHHHHC-CCCCSEEEECTTTHHHHHHHHHHHHHHHHCCCCBEEEECCC---------CCEEESCCTTCEEEEECSCCS
T ss_pred             HHHHHHHH-CCCCCEEECCHHCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCC--CCCCCCCCCCCCEEEEEEEEC
T ss_conf             99999862-777576723020220578999999998517788716884113556766--643576566551589831035


Q ss_pred             CHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             336688898987526875217872
Q gi|254780409|r  221 TGGTLCGAADALYEQGALSVTAYI  244 (310)
Q Consensus       221 TGgTi~~aa~~Lk~~GA~~V~~~~  244 (310)
                      ||+|+.++++.|++.|+.-+-++|
T Consensus       148 TG~S~~~ai~~l~~~G~~V~~v~v  171 (232)
T 3mjd_A          148 AGTAFYESYNKLKIINAKIAGVVL  171 (232)
T ss_dssp             SSHHHHHHHHHHHTTTCEEEEEEE
T ss_pred             CCCCHHHHHHHHHHCCCEEEEEEE
T ss_conf             685789999999986997999999