RPSBLAST alignment for GI: 254780409 and conserved domain: KOG1503

>gnl|CDD|36716 KOG1503, KOG1503, KOG1503, Phosphoribosylpyrophosphate synthetase-associated protein [Amino acid transport and metabolism, Nucleotide transport and metabolism]. Length = 354
 Score =  207 bits (527), Expect = 4e-54
 Identities = 123/341 (36%), Positives = 192/341 (56%), Gaps = 34/341 (9%)

Query: 1   MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPA 60
           M +F+GNS+  LA+ + + L   LGKA+V   ++RE  VEI E+VRG+DVFI+Q+ S   
Sbjct: 9   MVLFSGNSHPELAKMVAERLGIELGKATVYQKTNRETRVEIKESVRGKDVFIIQTGSKDV 68

Query: 61  NDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADR 120
           N+ +MELLIM  A + S A+ I GVIPY  Y +Q +    R  I +KL+A+++ +AG   
Sbjct: 69  NNDVMELLIMAYACKTSCAKSIIGVIPYLPYSKQCKM-RKRGSIVSKLLASMMCKAGLTH 127

Query: 121 VIMLDLHAGQVQGFFDIPTDNLYALPILERDIKER-NDISNLMVVSPDVGGVVRARALAK 179
           +I +DLH  ++QGFF IP DNL A P L + I+E   D  N ++V+   G   +A++ A+
Sbjct: 128 LITMDLHQKEIQGFFSIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPGVAKKAQSYAE 187

Query: 180 RLGCLLAI------------VDKRREHPGKIEV------------------MNIIGKVEG 209
           RL   LA+            VD R   P  +                    + ++G V G
Sbjct: 188 RLRLGLAVIHGEQKDTESDLVDGRHSPPPVVTATTHPSLELPAQISKEKPPLTVVGDVGG 247

Query: 210 KDCILIDDIVDTGGTLCGAADALYEQGALSVTAYITHGVLSSSSIERIEKSKMKELVITD 269
           +  I++DDI+D   +   AA+ L E+GA  +    THG+LSS +   +E+S + E+V+T+
Sbjct: 248 RIAIMVDDIIDDVQSFVAAAEVLKERGAYKIYVMATHGLLSSDAPRLLEESPIDEVVVTN 307

Query: 270 SIQPTDLVK-SSAKIRILTIAQLMGEAINRTFEERSISSLF 309
           ++ P ++ K    KI+ + I+ ++ EAI R     S+S LF
Sbjct: 308 TV-PHEVQKLQCHKIKTVDISLIISEAIRRIHNGESMSYLF 347