RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780411|ref|YP_003064824.1| prolipoprotein diacylglyceryl transferase [Candidatus Liberibacter asiaticus str. psy62] (288 letters) >d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Score = 28.3 bits (62), Expect = 0.80 Identities = 13/86 (15%), Positives = 25/86 (29%), Gaps = 1/86 (1%) Query: 175 VPWAMVFPDG-GSLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGLTAGAFAICYSV 233 V W + P+G G + Y+ + + L+ I + L Sbjct: 75 VAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLALEERGGWRSRET 134 Query: 234 VRFFMEFFREPDYQLGYLLGGWMTMG 259 F E+ L + + T+ Sbjct: 135 AFAFAEYAEAVARALADRVPFFATLN 160 >d1jb0a_ f.29.1.1 (A:) Apoprotein a1, PsaA {Synechococcus elongatus [TaxId: 32046]} Length = 743 Score = 25.9 bits (57), Expect = 4.0 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 106 LHIFFLWEGGMSFHGGLIGAF 126 L + F+W GM FHG + Sbjct: 68 LAVVFIWLSGMYFHGAKFSNY 88 >d1jb0b_ f.29.1.1 (B:) Apoprotein a2, PsaB {Synechococcus elongatus [TaxId: 32046]} Length = 739 Score = 26.0 bits (57), Expect = 4.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Query: 106 LHIFFLWEGGMSFHGGLIGAF 126 L I FLW G FH G F Sbjct: 53 LAIIFLWVSGSLFHVAWQGNF 73 >d1aopa4 d.134.1.1 (A:426-570) Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 {Escherichia coli [TaxId: 562]} Length = 145 Score = 25.3 bits (55), Expect = 6.4 Identities = 12/67 (17%), Positives = 26/67 (38%) Query: 177 WAMVFPDGGSLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGLTAGAFAICYSVVRF 236 + + R P E ITE ++ + +L+ + G G F + ++R Sbjct: 76 YNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKEREAGEGFGDFTVRAGIIRP 135 Query: 237 FMEFFRE 243 ++ R+ Sbjct: 136 VLDPARD 142 >d1q2oa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 416 Score = 25.1 bits (55), Expect = 6.9 Identities = 7/22 (31%), Positives = 12/22 (54%) Query: 27 AIRWYGLAYLVGMLFGIWYIQY 48 +RWY L + ML I +++ Sbjct: 263 GLRWYALPAVSNMLLEIGGLEF 284 >d3e7ma1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 421 Score = 24.7 bits (54), Expect = 9.0 Identities = 5/21 (23%), Positives = 12/21 (57%) Query: 28 IRWYGLAYLVGMLFGIWYIQY 48 ++WY L + ML + +++ Sbjct: 262 LKWYALPAVANMLLEVGGLEF 282 >d1om4a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 418 Score = 24.7 bits (54), Expect = 9.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Query: 28 IRWYGLAYLVGMLFGIWYIQY 48 ++WYGL + ML I +++ Sbjct: 261 LKWYGLPAVSNMLLEIGGLEF 281 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.330 0.146 0.491 Gapped Lambda K H 0.267 0.0593 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,162,071 Number of extensions: 55268 Number of successful extensions: 192 Number of sequences better than 10.0: 1 Number of HSP's gapped: 190 Number of HSP's successfully gapped: 38 Length of query: 288 Length of database: 2,407,596 Length adjustment: 84 Effective length of query: 204 Effective length of database: 1,254,276 Effective search space: 255872304 Effective search space used: 255872304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 52 (24.1 bits)