HHsearch results for GI: 254780412 and protein with PDBid: 2pnv_A

>2pnv_A Small conductance calcium-activated potassium channel protein 2; leucine zipper, SKCA channel, membrane protein; 2.10A {Rattus norvegicus}
Probab=91.86  E-value=0.33  Score=27.34  Aligned_cols=35  Identities=26%  Similarity=0.232  Sum_probs=29.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999650
Q gi|254780412|r   55 NVKRTTSHLREEITAIGKRLEKIEQQLADLELFIN   89 (94)
Q Consensus        55 v~~~~l~k~R~~~e~Le~rl~~LE~kl~~le~~~~   89 (94)
                      +.-+++.-..++.+.||+||..||.||..+-+.+.
T Consensus         6 vMYdlvSeL~~rsEdlEkri~~LEtkLd~l~~slq   40 (43)
T 2pnv_A            6 IMYDMISDLNERSEDFEKRIVTLETKLETLIGSIH   40 (43)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999998768999999999989999998874