RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780412|ref|YP_003064825.1| hypothetical protein CLIBASIA_01485 [Candidatus Liberibacter asiaticus str. psy62] (94 letters) >gnl|CDD|32780 COG2960, COG2960, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 103 Score = 35.4 bits (81), Expect = 0.004 Identities = 23/83 (27%), Positives = 46/83 (55%) Query: 1 MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTT 60 N+F A++L+ A+ A +++ E E + ++QR LN + +V EE + ++ Sbjct: 9 TMIGPNRFEDIAAQLSEDAAGAAQEVRAEVEKAFRAQLQRQLNKLDLVSREEFDVQRQVL 68 Query: 61 SHLREEITAIGKRLEKIEQQLAD 83 RE++ A+ R+E++E +LA Sbjct: 69 LRTREKLAALEARIEELEARLAS 91 >gnl|CDD|146821 pfam04380, DUF526, Protein of unknown function (DUF526). Length = 70 Score = 30.9 bits (71), Expect = 0.072 Identities = 15/69 (21%), Positives = 35/69 (50%) Query: 11 QASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHLREEITAI 70 ++L + A + + +EAE+ + +Q L+ + +V EE + + + RE++ A+ Sbjct: 2 DLAKLITDALGGAQGLREEAETNVRAVLQSALSKLDLVTREEFDVQRAVLARTREKLEAL 61 Query: 71 GKRLEKIEQ 79 R+ +E Sbjct: 62 EARVAALEA 70 >gnl|CDD|33325 COG3522, COG3522, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 446 Score = 27.1 bits (60), Expect = 0.94 Identities = 9/56 (16%), Positives = 18/56 (32%) Query: 1 MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENV 56 M R F QQ L + + F+++ + + + G + V Sbjct: 13 MFLRPQHFQQQDRYLEYLLHRRAQALQPYFWGFSELTLDQEALAQGKLAITSASGV 68 >gnl|CDD|37602 KOG2391, KOG2391, KOG2391, Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones, Intracellular trafficking, secretion, and vesicular transport]. Length = 365 Score = 27.3 bits (60), Expect = 1.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Query: 52 EIENVKRTTSHLREEITAIGKRLEKIEQQLADLE 85 E E++KRT L + E +EQQL L+ Sbjct: 233 EQESLKRTEEELNIGKQKLVAMKETLEQQLQSLQ 266 >gnl|CDD|37230 KOG2019, KOG2019, KOG2019, Metalloendoprotease HMP1 (insulinase superfamily) [General function prediction only, Posttranslational modification, protein turnover, chaperones]. Length = 998 Score = 26.1 bits (57), Expect = 2.5 Identities = 14/66 (21%), Positives = 26/66 (39%), Gaps = 7/66 (10%) Query: 25 DISKEAESFAQIKIQRTLNSM------GVVRA-EEIENVKRTTSHLREEITAIGKRLEKI 77 IS++ +Q++ L +V EI T+ + ITA K+L + Sbjct: 721 WISEQLGGLSQLEFLHRLEEKVDNDWEPIVSKLTEIRKSLLNTNGMIVNITADPKQLTNV 780 Query: 78 EQQLAD 83 E+ + Sbjct: 781 EKAVEK 786 >gnl|CDD|144852 pfam01411, tRNA-synt_2c, tRNA synthetases class II (A). Other tRNA synthetase sub-families are too dissimilar to be included. This family includes only alanyl-tRNA synthetases. Length = 545 Score = 25.7 bits (57), Expect = 2.7 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Query: 23 FKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHL 63 FK I E R +NS +RA +++NV RT H Sbjct: 41 FKPIFLGGEDKPPYN--RAVNSQKCIRAGDLDNVGRTARHH 79 >gnl|CDD|133279 cd01878, HflX, HflX subfamily. A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily. The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear. HflX is widespread, but not universally represented in all three superkingdoms. Length = 204 Score = 25.1 bits (56), Expect = 5.0 Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 62 HLREEITAIGKRLEKIEQQ 80 +RE I + + LEK+++Q Sbjct: 10 LIRERIAKLRRELEKVKKQ 28 >gnl|CDD|30363 COG0013, AlaS, Alanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 879 Score = 24.8 bits (54), Expect = 5.3 Identities = 8/24 (33%), Positives = 12/24 (50%) Query: 40 RTLNSMGVVRAEEIENVKRTTSHL 63 R + S +R +I+NV T H Sbjct: 64 RAVTSQKCIRTNDIDNVGYTARHH 87 >gnl|CDD|29811 cd00673, AlaRS_core, Alanyl-tRNA synthetase (AlaRS) class II core catalytic domain. AlaRS is a homodimer. It is responsible for the attachment of alanine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its predicted structure and the presence of three characteristic sequence motifs.. Length = 232 Score = 24.9 bits (54), Expect = 5.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 40 RTLNSMGVVRAEEIENVKRTTSHL 63 R +NS +RA +I+NV +T H Sbjct: 57 RLVNSQKCIRAGDIDNVGKTGRHH 80 >gnl|CDD|133403 cd04776, HTH_GnyR, Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR. Putative helix-turn-helix (HTH) regulatory protein, GnyR, and other related proteins. GnyR belongs to the gnyRDBHAL cluster, which is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules. Length = 118 Score = 24.4 bits (54), Expect = 6.6 Identities = 8/33 (24%), Positives = 15/33 (45%) Query: 57 KRTTSHLREEITAIGKRLEKIEQQLADLELFIN 89 L + + I KR ++EQQ D++ + Sbjct: 72 GGNRKQLEKMLEKIEKRRAELEQQRRDIDAALA 104 >gnl|CDD|35461 KOG0240, KOG0240, KOG0240, Kinesin (SMY1 subfamily) [Cytoskeleton]. Length = 607 Score = 24.6 bits (53), Expect = 7.0 Identities = 13/50 (26%), Positives = 26/50 (52%) Query: 45 MGVVRAEEIENVKRTTSHLREEITAIGKRLEKIEQQLADLELFINQKEKE 94 M + +EE ++ + L EE + +R+E + QQL + IN++ + Sbjct: 394 MSAILSEEEMSITKLKGSLEEEEDILTERIESLYQQLDQKDDQINKQSQL 443 >gnl|CDD|112592 pfam03786, UxuA, D-mannonate dehydratase (UxuA). UxuA (this family) and UxuB are required for hexuronate degradation. Length = 350 Score = 24.3 bits (53), Expect = 8.6 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 49 RAEEIENVKRTTSHL 63 R IEN K+T +L Sbjct: 80 RDRYIENYKQTIRNL 94 >gnl|CDD|35832 KOG0612, KOG0612, KOG0612, Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]. Length = 1317 Score = 24.2 bits (52), Expect = 8.8 Identities = 15/44 (34%), Positives = 22/44 (50%) Query: 51 EEIENVKRTTSHLREEITAIGKRLEKIEQQLADLELFINQKEKE 94 E I +K S L E + A K L K+E+ + + I+ EKE Sbjct: 623 EIIAELKEEISSLEETLKAGKKELLKVEELKRENQERISDSEKE 666 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.126 0.320 Gapped Lambda K H 0.267 0.0573 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 972,532 Number of extensions: 41112 Number of successful extensions: 312 Number of sequences better than 10.0: 1 Number of HSP's gapped: 308 Number of HSP's successfully gapped: 91 Length of query: 94 Length of database: 6,263,737 Length adjustment: 62 Effective length of query: 32 Effective length of database: 4,923,979 Effective search space: 157567328 Effective search space used: 157567328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.8 bits)