BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780412|ref|YP_003064825.1| hypothetical protein CLIBASIA_01485 [Candidatus Liberibacter asiaticus str. psy62] (94 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780412|ref|YP_003064825.1| hypothetical protein CLIBASIA_01485 [Candidatus Liberibacter asiaticus str. psy62] Length = 94 Score = 187 bits (474), Expect = 4e-50, Method: Compositional matrix adjust. Identities = 94/94 (100%), Positives = 94/94 (100%) Query: 1 MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTT 60 MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTT Sbjct: 1 MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSMGVVRAEEIENVKRTT 60 Query: 61 SHLREEITAIGKRLEKIEQQLADLELFINQKEKE 94 SHLREEITAIGKRLEKIEQQLADLELFINQKEKE Sbjct: 61 SHLREEITAIGKRLEKIEQQLADLELFINQKEKE 94 >gi|254780200|ref|YP_003064613.1| ferrochelatase [Candidatus Liberibacter asiaticus str. psy62] Length = 343 Score = 24.6 bits (52), Expect = 0.35, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Query: 54 ENVKRTTSHLREEITAIGKRLEKIEQQLAD 83 E++ RT H R++ T + KRLE I + D Sbjct: 88 ESILRT--HTRDQATNLAKRLESISSIVVD 115 >gi|254780803|ref|YP_003065216.1| hypothetical protein CLIBASIA_03470 [Candidatus Liberibacter asiaticus str. psy62] Length = 165 Score = 21.6 bits (44), Expect = 2.7, Method: Compositional matrix adjust. Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 5 SNQFFQQASRLASCASDAFKDIS 27 SN FF+ R+ A FK+IS Sbjct: 87 SNAFFKNIGRITLKAKYYFKEIS 109 >537021.9.peg.817_1 Length = 148 Score = 21.2 bits (43), Expect = 4.0, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 9/47 (19%) Query: 28 KEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHLREEITAIGKRL 74 K+ +S A+ ++R GV A HL +EI IGKR+ Sbjct: 54 KDTKSIAKALLKRFATLGGVFGAP---------LHLLQEINRIGKRV 91 >gi|254780423|ref|YP_003064836.1| S-adenosylmethionine synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 413 Score = 20.0 bits (40), Expect = 9.0, Method: Composition-based stats. Identities = 12/48 (25%), Positives = 22/48 (45%), Gaps = 6/48 (12%) Query: 47 VVRAEEIENVKRTTSHLREEITAIGKRLEKIEQQLADLELFINQKEKE 94 VV E+ E V R+ I +IG E + D+E+ ++ + + Sbjct: 82 VVDKEKFEKVVRSV------IRSIGYEQEGFHWETVDVEVLLHSQSSD 123 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.126 0.320 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,860 Number of Sequences: 1233 Number of extensions: 1513 Number of successful extensions: 13 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of query: 94 length of database: 328,796 effective HSP length: 60 effective length of query: 34 effective length of database: 254,816 effective search space: 8663744 effective search space used: 8663744 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)