>TIGR02060 aprB adenylylsulfate reductase, beta subunit; InterPro: IPR011802 During dissimilatory sulphate reduction and sulphur oxidation, adenylylsulphate (APS) reductase catalyzes reversibly the two-electron reduction of APS to sulphite and AMP. Found in several bacterial lineages and in Archaeoglobales, APS reductase is a heterodimer composed of an alpha subunit containing a noncovalently bound FAD, and a beta subunit containing two [4Fe-4S] clusters. This entry describes the beta subunit of APS reductase, which shares a common evolutionary origin with other iron-sulphur cluster-binding proteins..

Probab=98.25 E-value=1.3e-07 Score=60.55 Aligned_cols=55 Identities=36% Similarity=0.700 Sum_probs=48.3 Q ss_pred CEEECHHCCCCC---CCCHHHHCCCCCCCCCCC--EEE-EEHHHCCCCCHHHHHHHHHHCC Q ss_conf 677472208979---975267477743114674--479-9401302577158787420025 Q gi|254780416|r 2 TYVVTENCILCK---HTDCVEVCPVDCFYEGEN--FLA-IHPDECIDCGVCEPECPVDAIK 56 (113) Q Consensus 2 ~yvv~~~C~~C~---~~~Cv~~CP~~ai~~~~~--~~~-id~~~Ci~Cg~C~~~CP~~AI~ 56 (113) T Consensus 3 tFV~~~kCDGC~~~e~t~C~~ICP~DlM~lD~~~~kAYN~EP~~CWECYSCVK~CP~~AI~ 63 (138) T TIGR02060 3 TFVDPTKCDGCKALEKTACVYICPNDLMILDTEKMKAYNREPDMCWECYSCVKICPQGAID 63 (138) T ss_pred CCCCCCCCCCCCCCCCCCEEECCCHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCEE T ss_conf 6447845667787663111110830222305024554168766631210001218887411

HHsearch alignment for GI: 254780416 and conserved domain: TIGR02060