BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780417|ref|YP_003064830.1| transcriptional regulator CarD
family protein [Candidatus Liberibacter asiaticus str. psy62]
         (188 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|307943601|ref|ZP_07658945.1| transcription factor CarD [Roseibium sp. TrichSKD4]
 gi|307773231|gb|EFO32448.1| transcription factor CarD [Roseibium sp. TrichSKD4]
          Length = 194

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 117/194 (60%), Positives = 144/194 (74%), Gaps = 6/194 (3%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M    K+ A RQGF+TGE+IVYPAHGVG IT I+EQ VAG  LE  VI F+KDKM L+VP
Sbjct: 1   MASTTKKTAQRQGFKTGEYIVYPAHGVGQITAIEEQNVAGHSLELLVIVFEKDKMTLRVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V K   +GMRKL +   V++AL+ VRG+ RVKRTMWSRRAQEY+AKINSGDLI+I+EVVR
Sbjct: 61  VAKIASVGMRKLGDPDAVKKALETVRGRPRVKRTMWSRRAQEYEAKINSGDLISISEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R+DSQPE+SYSERQLYE+AL+R+ REIAAVN  SE EA   IE  L    ++ +   
Sbjct: 121 DLYRSDSQPEQSYSERQLYEAALDRLAREIAAVNKCSETEATKQIEQTLEKSPNRPKAPA 180

Query: 181 SEN------QDKAA 188
             +      Q++AA
Sbjct: 181 EADSTGSDGQEEAA 194


>gi|163839171|ref|YP_001623576.1| transcriptional regulator [Renibacterium salmoninarum ATCC 33209]
 gi|162952647|gb|ABY22162.1| transcriptional regulator [Renibacterium salmoninarum ATCC 33209]
          Length = 301

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 80/158 (50%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I EIK + + G +  +  +   +  + ++VP      +G+R + 
Sbjct: 144 FEIGETVVYPHHGAAKIEEIKMRTIKGEEKMYLKLKVAQGDLTIEVPAENVDLVGVRDVV 203

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +E    ++R +   + T WSRR +    K+ SGD+I +AEVVRDL R D     S 
Sbjct: 204 GKEGLEHVFDVLRAEFTEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLWRRDHDRGLSA 263

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   ++ E+A      E +A  +++  L+S
Sbjct: 264 GEKRMLAKARQILISELALAEKTDEEKAATVLDEVLAS 301


>gi|315122139|ref|YP_004062628.1| transcriptional regulator CarD family protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495541|gb|ADR52140.1| transcriptional regulator CarD family protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 188

 Score =  151 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 171/188 (90%), Positives = 179/188 (95%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT QQK+  MRQGF+TGEHIVYP HGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP
Sbjct: 1   MTVQQKKSMMRQGFKTGEHIVYPTHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR
Sbjct: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+RT++QPEKSYSERQLYESALNRMVRE+AAVNSISEPEAI+LIEVNLSSK  K EK T
Sbjct: 121 DLYRTENQPEKSYSERQLYESALNRMVREVAAVNSISEPEAIDLIEVNLSSKRPKDEKPT 180

Query: 181 SENQDKAA 188
           +ENQ KAA
Sbjct: 181 NENQCKAA 188


>gi|254780417|ref|YP_003064830.1| transcriptional regulator CarD family protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040094|gb|ACT56890.1| transcriptional regulator CarD family protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 188

 Score =  151 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 188/188 (100%), Positives = 188/188 (100%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP
Sbjct: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR
Sbjct: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST
Sbjct: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180

Query: 181 SENQDKAA 188
           SENQDKAA
Sbjct: 181 SENQDKAA 188


>gi|75674610|ref|YP_317031.1| transcription factor CarD [Nitrobacter winogradskyi Nb-255]
 gi|74419480|gb|ABA03679.1| transcriptional regulator, CarD family [Nitrobacter winogradskyi
           Nb-255]
          Length = 283

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 109/177 (61%), Positives = 140/177 (79%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K    RQGF+TGE +VYPAHGVG I  I+EQE+AG KLE FVI F KDKM L+VP  K 
Sbjct: 87  KKVLTQRQGFKTGEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFIKDKMTLRVPTAKV 146

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
            ++GMRKLSE   V+RAL+ ++G+AR+KRTMWSRRAQEY+AKINSGD++AIAEVVRDL+R
Sbjct: 147 ANVGMRKLSEPGLVKRALETLKGRARIKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLYR 206

Query: 125 TDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTS 181
           ++SQPE+SYSERQLYE+AL+R+ REIA V  ++E EA+  IE  L+    +  K+ +
Sbjct: 207 SESQPEQSYSERQLYEAALDRLSREIAVVQHVTETEAVKEIEGQLAKSPRRGAKAEA 263


>gi|296268490|ref|YP_003651122.1| CarD family transcriptional regulator [Thermobispora bispora DSM
           43833]
 gi|296091277|gb|ADG87229.1| transcriptional regulator, CarD family [Thermobispora bispora DSM
           43833]
          Length = 163

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/160 (31%), Positives = 85/160 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I  + + G +  + V+  DK  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAARIEAITTRTINGQEKTYLVLKVDKGDLTVQVPAENAELVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +ER   ++R     + T WSRR +    K+ SGD+  +AEVVRDL+R D +   S 
Sbjct: 63  GQEGLERVFDVLRMPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLYRRDKERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A   + +E +A  L++  L+S  
Sbjct: 123 GEKRMLAKARQILVSELALAENTNEDKAEALLDEVLNSAR 162


>gi|222150214|ref|YP_002551171.1| transcriptional regulator CarD family [Agrobacterium vitis S4]
 gi|221737196|gb|ACM38159.1| transcriptional regulator CarD family [Agrobacterium vitis S4]
          Length = 223

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 135/188 (71%), Positives = 156/188 (82%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT QQK+ + RQGF+TGE IVYPAHGVGTIT I+EQEVAGMKLE FVI FDKDKM LKVP
Sbjct: 35  MTTQQKKSSTRQGFKTGEAIVYPAHGVGTITAIEEQEVAGMKLELFVIDFDKDKMRLKVP 94

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA+ IGMRKLSE  FV+RALK+V+GKARVKRTMWSRRAQEYDAKINSGDLI+IAEVVR
Sbjct: 95  VTKAVTIGMRKLSETDFVDRALKVVQGKARVKRTMWSRRAQEYDAKINSGDLISIAEVVR 154

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL R + QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ L+EVNL+    + +   
Sbjct: 155 DLFRAEHQPEQSYSERQLYEAALDRMAREIAAVNKMSETEAVRLVEVNLAKGPKRGKSVE 214

Query: 181 SENQDKAA 188
            +   + A
Sbjct: 215 EDETQEEA 222


>gi|110635707|ref|YP_675915.1| CarD family transcriptional regulator [Mesorhizobium sp. BNC1]
 gi|110286691|gb|ABG64750.1| transcriptional regulator, CarD family [Chelativorans sp. BNC1]
          Length = 190

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 130/187 (69%), Positives = 155/187 (82%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  QQK+ A RQGF+TGE IVYPAHGVG I  I++QEVAG KLE FVI F KDKM LKVP
Sbjct: 1   MATQQKKSAQRQGFKTGEFIVYPAHGVGQIVAIEDQEVAGHKLELFVIDFQKDKMRLKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           VGKA  IGMRKLSE  +V+RALK+V+G+ARVKRTMWSRRAQEYDAKINSGDLI+I+EVVR
Sbjct: 61  VGKATAIGMRKLSETDYVDRALKVVQGRARVKRTMWSRRAQEYDAKINSGDLISISEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R D+QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ LIE NL+    +  K+ 
Sbjct: 121 DLYRADNQPEQSYSERQLYEAALDRMAREIAAVNRMSETEAVRLIETNLAKGPRRGTKAE 180

Query: 181 SENQDKA 187
           +++ +K 
Sbjct: 181 NDDAEKE 187


>gi|299132816|ref|ZP_07026011.1| transcriptional regulator, CarD family [Afipia sp. 1NLS2]
 gi|298592953|gb|EFI53153.1| transcriptional regulator, CarD family [Afipia sp. 1NLS2]
          Length = 403

 Score =  149 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 107/171 (62%), Positives = 138/171 (80%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K    RQGF+T E +VYPAHGVG I  I+EQE+AG  LE FVI+F KDKM L+VP  K 
Sbjct: 201 KKVLTQRQGFKTNEFVVYPAHGVGQILAIEEQEIAGATLELFVISFIKDKMTLRVPTAKV 260

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
           I++GMRKLS+   V+RAL+ ++G+AR+KRTMWSRRAQEY+AKINSGD++AIAEVVRDL+R
Sbjct: 261 INVGMRKLSDPALVKRALETLKGRARIKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLYR 320

Query: 125 TDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSK 175
           ++SQPE+SYSERQLYE+AL+R+ REIA V  I+E EA+  +E NL+    +
Sbjct: 321 SESQPEQSYSERQLYEAALDRLSREIAVVQHITETEAVKEVEANLAKSPRR 371


>gi|154244145|ref|YP_001415103.1| CarD family transcriptional regulator [Xanthobacter autotrophicus
           Py2]
 gi|154158230|gb|ABS65446.1| transcriptional regulator, CarD family [Xanthobacter autotrophicus
           Py2]
          Length = 206

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 116/186 (62%), Positives = 147/186 (79%)

Query: 3   FQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
             +K    R GF+TGEHIVYP+HGVG I  I+EQEVAG KLE FVI+F+KDKM L+VPV 
Sbjct: 13  SAKKNAQTRLGFKTGEHIVYPSHGVGRIMAIEEQEVAGFKLELFVISFEKDKMTLRVPVP 72

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
           K   +GMRKLSE + V+++L+ ++G+ARVKRTMWSRRAQEY+AKINSGDL+AI+EVVRDL
Sbjct: 73  KIATVGMRKLSETNIVDKSLETLQGRARVKRTMWSRRAQEYEAKINSGDLVAISEVVRDL 132

Query: 123 HRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSE 182
           +R+D+QPE+SYSERQLYE+AL+RM RE++AVN+I+E EA+ LIE NL     +      E
Sbjct: 133 YRSDAQPEQSYSERQLYEAALDRMARELSAVNNITETEAVKLIEQNLLKGPRRGTAKVVE 192

Query: 183 NQDKAA 188
             D  A
Sbjct: 193 EADLDA 198


>gi|90422072|ref|YP_530442.1| CarD family transcriptional regulator [Rhodopseudomonas palustris
           BisB18]
 gi|90104086|gb|ABD86123.1| transcriptional regulator, CarD family [Rhodopseudomonas palustris
           BisB18]
          Length = 365

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 111/184 (60%), Positives = 140/184 (76%)

Query: 4   QQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGK 63
            +K    RQGF+T E +VYPAHGVG I  I+EQE+AG KLE FVI F KDKM L+VP  K
Sbjct: 167 AKKPLTQRQGFKTNEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFMKDKMTLRVPTAK 226

Query: 64  AIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLH 123
             ++GMRKLSE   V+RAL+ ++G+ARVKRTMWSRRAQEY+AKINSGD++AIAEVVRDL+
Sbjct: 227 VANVGMRKLSEPALVKRALETLKGRARVKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLY 286

Query: 124 RTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSEN 183
           R+DSQPE+SYSERQLYE+AL+R+ REIA V  ++E EA+  +E  L+    +  K+  E 
Sbjct: 287 RSDSQPEQSYSERQLYEAALDRLSREIAVVQHVTETEAVKEVEGQLAKSPRRGAKTEVEA 346

Query: 184 QDKA 187
              A
Sbjct: 347 DADA 350


>gi|239981206|ref|ZP_04703730.1| putative CarD-like transcriptional regulator [Streptomyces albus
           J1074]
 gi|291453071|ref|ZP_06592461.1| transcriptional factor regulator [Streptomyces albus J1074]
 gi|291356020|gb|EFE82922.1| transcriptional factor regulator [Streptomyces albus J1074]
          Length = 160

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 87/158 (55%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ +++ G+   + V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRQIKGVDKNYLVLKVAQGDLTVRVPADNAELVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+I +AEVVRDL R + +   S 
Sbjct: 63  GQDGLDRVFEVLRAPYAEEPTNWSRRYKANLEKLASGDVIRVAEVVRDLWRRERERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A   + +E +A  L++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAENTNEDKAEALLDEVLAS 160


>gi|84500895|ref|ZP_00999130.1| transcriptional regulator, CarD family protein [Oceanicola
           batsensis HTCC2597]
 gi|84390962|gb|EAQ03380.1| transcriptional regulator, CarD family protein [Oceanicola
           batsensis HTCC2597]
          Length = 169

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 98/174 (56%), Positives = 128/174 (73%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  +++VYPAHGVG I  I+ QE+AG+ LE FVI+F+KDKM L+VP
Sbjct: 1   MTKAKK-----AEFRPNDYVVYPAHGVGQIVSIESQEIAGISLELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA ++GMR LS    V +A+  ++GKA+VKR MWSRRAQEY+ KINSGDL+AIAEVVR
Sbjct: 56  TNKATEVGMRSLSTPDVVSKAMSTLKGKAKVKRAMWSRRAQEYEQKINSGDLVAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHR D Q E+SYSERQLYE+AL R+ RE+AAV+   E +A   ++  L S+++
Sbjct: 116 DLHRNDDQREQSYSERQLYEAALERLTREVAAVSGADEVDAARKVDEVLVSRAA 169


>gi|226304175|ref|YP_002764133.1| hypothetical protein RER_06860 [Rhodococcus erythropolis PR4]
 gi|229494349|ref|ZP_04388112.1| transcriptional regulator, CarD family protein [Rhodococcus
           erythropolis SK121]
 gi|226183290|dbj|BAH31394.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
 gi|229318711|gb|EEN84569.1| transcriptional regulator, CarD family protein [Rhodococcus
           erythropolis SK121]
          Length = 162

 Score =  148 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 44/160 (27%), Positives = 83/160 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPADNAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  GQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRREQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A        +A  +++  L++ S
Sbjct: 123 GEKRMLAKARQILVGELALAEGTDTEKAETILDEVLAAAS 162


>gi|15827084|ref|NP_301347.1| transcription factor [Mycobacterium leprae TN]
 gi|221229562|ref|YP_002502978.1| putative transcription factor [Mycobacterium leprae Br4923]
 gi|13092632|emb|CAC29828.1| putative transcription factor [Mycobacterium leprae]
 gi|219932669|emb|CAR70413.1| putative transcription factor [Mycobacterium leprae Br4923]
          Length = 165

 Score =  148 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 44/160 (27%), Positives = 85/160 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   +  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 6   FKVGDTVVYPHHGAALVEAIETRTINGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVV 65

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  ++EVVRDL R D     S 
Sbjct: 66  GQEGLDQVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVSEVVRDLWRRDQDRGLSA 125

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A   S  + +A  +++  L++ S
Sbjct: 126 GEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS 165


>gi|86747677|ref|YP_484173.1| CarD family transcriptional regulator [Rhodopseudomonas palustris
           HaA2]
 gi|86570705|gb|ABD05262.1| transcriptional regulator, CarD family [Rhodopseudomonas palustris
           HaA2]
          Length = 429

 Score =  148 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 107/183 (58%), Positives = 140/183 (76%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K    RQGF+  E +VYPAHGVG I  I+EQE+AG KLE FVI F KDKM L+VP  K 
Sbjct: 230 KKVVTQRQGFKASEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFIKDKMTLRVPTAKV 289

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
            ++GMRKLS+   V++AL+ ++G+ARVKRTMWSRRAQEY+AKINSGD++AIAEVVRDL R
Sbjct: 290 ANVGMRKLSDPALVKKALETLKGRARVKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLFR 349

Query: 125 TDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQ 184
           +DSQPE+SYSERQLYE+AL+R+ REIA V  ++E EA+  +E  L+    +  K+ ++ +
Sbjct: 350 SDSQPEQSYSERQLYEAALDRLSREIAVVQQVTETEAVKEVEGQLAKSPRRGAKAEADAE 409

Query: 185 DKA 187
             A
Sbjct: 410 GDA 412


>gi|111021431|ref|YP_704403.1| CarD family transcriptional regulator [Rhodococcus jostii RHA1]
 gi|226363787|ref|YP_002781569.1| hypothetical protein ROP_43770 [Rhodococcus opacus B4]
 gi|110820961|gb|ABG96245.1| probable transcriptional regulator, CarD family protein
           [Rhodococcus jostii RHA1]
 gi|226242276|dbj|BAH52624.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 162

 Score =  148 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 44/160 (27%), Positives = 83/160 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPADNAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  GQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRREQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A        +A  +++  L++ S
Sbjct: 123 GEKRMLAKARQILVGELALAEGTDSDKAETILDEVLAAAS 162


>gi|163759997|ref|ZP_02167081.1| hypothetical protein HPDFL43_17241 [Hoeflea phototrophica DFL-43]
 gi|162282955|gb|EDQ33242.1| hypothetical protein HPDFL43_17241 [Hoeflea phototrophica DFL-43]
          Length = 189

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 129/188 (68%), Positives = 154/188 (81%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT QQK+ + RQGF+TGE IVYPAHGVG I  I+EQEVAG KLE FVI F+KDKM LKVP
Sbjct: 1   MTTQQKKSSTRQGFKTGESIVYPAHGVGQIVAIEEQEVAGHKLELFVIDFEKDKMRLKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA  IGMRKLSE  FVERALK+V+G+ARVKRTMWSRRAQEYDAKINSGDLI+IAEVVR
Sbjct: 61  VAKASTIGMRKLSETDFVERALKVVQGRARVKRTMWSRRAQEYDAKINSGDLISIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R ++QPE+SYSERQLYE+AL+RM RE+AAVN +S+ EA+ LIE NL+    + + + 
Sbjct: 121 DLYRAENQPEQSYSERQLYEAALDRMARELAAVNKMSDTEAVRLIETNLNKGPKRGKAAD 180

Query: 181 SENQDKAA 188
            +   + A
Sbjct: 181 EDGAQEEA 188


>gi|227823778|ref|YP_002827751.1| putative transcriptional regulator, CarD family [Sinorhizobium
           fredii NGR234]
 gi|227342780|gb|ACP26998.1| putative transcriptional regulator, CarD family [Sinorhizobium
           fredii NGR234]
          Length = 189

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 132/188 (70%), Positives = 155/188 (82%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT QQK+ + RQGF+TGE IVYPAHGVG I  I+EQEVAGMKLE FVI FDKDKM LKVP
Sbjct: 1   MTTQQKKSSTRQGFKTGESIVYPAHGVGQIVAIEEQEVAGMKLELFVIDFDKDKMRLKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA+ IGMRKLSE  FV+RALK+V+GKARVKRTMWSRRAQEYDAKINSGDLI+IAEVVR
Sbjct: 61  VAKAVSIGMRKLSETDFVDRALKVVQGKARVKRTMWSRRAQEYDAKINSGDLISIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ L+E NL+    + +   
Sbjct: 121 DLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKMSETEAVRLVEANLNKGPKRGKAIE 180

Query: 181 SENQDKAA 188
            ++    A
Sbjct: 181 EDDTQDEA 188


>gi|254234156|ref|ZP_04927480.1| hypothetical protein TBCG_03510 [Mycobacterium tuberculosis C]
 gi|124603824|gb|EAY61787.1| hypothetical protein TBCG_03510 [Mycobacterium tuberculosis C]
          Length = 174

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 45/165 (27%), Positives = 88/165 (53%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           + +  F+ G+ +VYP HG   +  I+ + + G + E+ V+   +  + ++VP   A  +G
Sbjct: 10  SNQMIFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVG 69

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           +R +     +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +
Sbjct: 70  VRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQE 129

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
              S  E+++   A   +V E+A   S  + +A  +++  L++ S
Sbjct: 130 RGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS 174


>gi|304394153|ref|ZP_07376076.1| CarD family transcriptional regulator [Ahrensia sp. R2A130]
 gi|303293593|gb|EFL87970.1| CarD family transcriptional regulator [Ahrensia sp. R2A130]
          Length = 193

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 119/182 (65%), Positives = 142/182 (78%)

Query: 6   KRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAI 65
           K+   RQGF+TGE IVYPAHGVG ITEI++QEVAG +LE FVI F KDKM L+VPV K  
Sbjct: 4   KKATQRQGFKTGEFIVYPAHGVGQITEIEQQEVAGFELELFVIEFAKDKMTLRVPVPKIE 63

Query: 66  DIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRT 125
            +GMRKL+E   V+++L  V+G+AR+KRTMWSRRAQEYDAKINSGDLI IAEVVRDL R+
Sbjct: 64  SVGMRKLAEPKLVDKSLMTVQGRARIKRTMWSRRAQEYDAKINSGDLIQIAEVVRDLFRS 123

Query: 126 DSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQD 185
           D+QPE+SYSERQLYE+AL RM REI+ V  ISE EA+ LIE NL+    +  K   E +D
Sbjct: 124 DTQPEQSYSERQLYEAALERMAREISVVKKISETEAVQLIEANLAKGPRRGPKPEGEEED 183

Query: 186 KA 187
            A
Sbjct: 184 GA 185


>gi|84515406|ref|ZP_01002768.1| putative CarD-like transcriptional regulator [Loktanella
           vestfoldensis SKA53]
 gi|84510689|gb|EAQ07144.1| putative CarD-like transcriptional regulator [Loktanella
           vestfoldensis SKA53]
          Length = 225

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 100/169 (59%), Positives = 118/169 (69%), Gaps = 6/169 (3%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT ++        F   + +VYPAHGVG I  ++ QEVAG +LE FVIAF+KDKM L+VP
Sbjct: 58  MTKKK------SEFSPDQFVVYPAHGVGKIVSVETQEVAGFELEMFVIAFEKDKMTLRVP 111

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA D+GMR L+    V  ALK +RGKA+VK+ MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 112 THKATDVGMRALATPDVVNHALKTLRGKAKVKKAMWSRRAQEYEQKINSGDLIAIAEVVR 171

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
           DLHR D Q E+SYSERQLYE+AL R+ RE AAV    E  A   I   L
Sbjct: 172 DLHRQDDQREQSYSERQLYEAALERLTREFAAVAGDDENAAAAQIGSVL 220


>gi|91974760|ref|YP_567419.1| transcription factor CarD [Rhodopseudomonas palustris BisB5]
 gi|91681216|gb|ABE37518.1| transcriptional regulator, CarD family [Rhodopseudomonas palustris
           BisB5]
          Length = 432

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 106/180 (58%), Positives = 139/180 (77%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K    RQGF+ GE +VYPAHGVG I  I+EQE+AG KLE FVI F KDKM L+VP  K 
Sbjct: 235 KKAVTQRQGFKAGEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFIKDKMTLRVPTAKV 294

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
            ++GMRKLS+   V++AL+ ++G+ARVKRTMWSRRAQEY+AKINSGD++AIAEVVRDL R
Sbjct: 295 ANVGMRKLSDPALVKKALETLKGRARVKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLFR 354

Query: 125 TDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQ 184
           ++SQPE+SYSERQLYE+AL+R+ REIA V  ++E EA+  +E  L+    +  K+  + +
Sbjct: 355 SESQPEQSYSERQLYEAALDRLSREIAVVQQVTETEAVKEVEGQLAKSPRRGAKAEVDAE 414


>gi|21222627|ref|NP_628406.1| transcriptional factor regulator [Streptomyces coelicolor A3(2)]
 gi|29830513|ref|NP_825147.1| CarD-like transcriptional regulator [Streptomyces avermitilis
           MA-4680]
 gi|182437804|ref|YP_001825523.1| putative CarD-like transcriptional regulator [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|239930480|ref|ZP_04687433.1| putative CarD-like transcriptional regulator [Streptomyces
           ghanaensis ATCC 14672]
 gi|239942338|ref|ZP_04694275.1| putative CarD-like transcriptional regulator [Streptomyces
           roseosporus NRRL 15998]
 gi|239988803|ref|ZP_04709467.1| putative CarD-like transcriptional regulator [Streptomyces
           roseosporus NRRL 11379]
 gi|254387144|ref|ZP_05002415.1| transcriptional factor regulator [Streptomyces sp. Mg1]
 gi|254388532|ref|ZP_05003766.1| transcriptional factor regulator [Streptomyces clavuligerus ATCC
           27064]
 gi|256786303|ref|ZP_05524734.1| putative CarD-like transcriptional regulator [Streptomyces lividans
           TK24]
 gi|282860513|ref|ZP_06269579.1| transcriptional regulator, CarD family [Streptomyces sp. ACTE]
 gi|289770194|ref|ZP_06529572.1| transcriptional factor regulator [Streptomyces lividans TK24]
 gi|290959414|ref|YP_003490596.1| transcriptional regulator [Streptomyces scabiei 87.22]
 gi|291438841|ref|ZP_06578231.1| transcriptional factor regulator [Streptomyces ghanaensis ATCC
           14672]
 gi|291445795|ref|ZP_06585185.1| transcriptional factor regulator [Streptomyces roseosporus NRRL
           15998]
 gi|294630053|ref|ZP_06708613.1| CarD family transcriptional regulator [Streptomyces sp. e14]
 gi|294814053|ref|ZP_06772696.1| Transcriptional regulator, CarD family [Streptomyces clavuligerus
           ATCC 27064]
 gi|295838029|ref|ZP_06824962.1| CarD family transcriptional regulator [Streptomyces sp. SPB74]
 gi|297193588|ref|ZP_06910986.1| transcriptional regulator [Streptomyces pristinaespiralis ATCC
           25486]
 gi|297200594|ref|ZP_06917991.1| transcriptional regulator [Streptomyces sviceus ATCC 29083]
 gi|302520127|ref|ZP_07272469.1| transcriptional regulator [Streptomyces sp. SPB78]
 gi|302535866|ref|ZP_07288208.1| transcriptional regulator [Streptomyces sp. C]
 gi|302552344|ref|ZP_07304686.1| transcriptional regulator [Streptomyces viridochromogenes DSM
           40736]
 gi|302559957|ref|ZP_07312299.1| CarD family transcriptional regulator [Streptomyces griseoflavus
           Tu4000]
 gi|318058492|ref|ZP_07977215.1| transcriptional regulator [Streptomyces sp. SA3_actG]
 gi|318075598|ref|ZP_07982930.1| transcriptional regulator [Streptomyces sp. SA3_actF]
 gi|326442457|ref|ZP_08217191.1| transcriptional regulator [Streptomyces clavuligerus ATCC 27064]
 gi|326778439|ref|ZP_08237704.1| transcriptional regulator, CarD family [Streptomyces cf. griseus
           XylebKG-1]
 gi|329936179|ref|ZP_08285972.1| transcriptional regulator [Streptomyces griseoaurantiacus M045]
 gi|7242753|emb|CAB77326.1| putative transcriptional factor regulator [Streptomyces coelicolor
           A3(2)]
 gi|29607625|dbj|BAC71682.1| putative CarD-like transcriptional regulator [Streptomyces
           avermitilis MA-4680]
 gi|178466320|dbj|BAG20840.1| putative CarD-like transcriptional regulator [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|194345960|gb|EDX26926.1| transcriptional factor regulator [Streptomyces sp. Mg1]
 gi|197699155|gb|EDY46088.1| CarD family transcriptional regulator [Streptomyces sp. SPB74]
 gi|197702253|gb|EDY48065.1| transcriptional factor regulator [Streptomyces clavuligerus ATCC
           27064]
 gi|197709720|gb|EDY53754.1| transcriptional regulator [Streptomyces sviceus ATCC 29083]
 gi|197718134|gb|EDY62042.1| transcriptional regulator [Streptomyces pristinaespiralis ATCC
           25486]
 gi|260648940|emb|CBG72054.1| putative transcriptional regulator [Streptomyces scabiei 87.22]
 gi|282564249|gb|EFB69785.1| transcriptional regulator, CarD family [Streptomyces sp. ACTE]
 gi|289700393|gb|EFD67822.1| transcriptional factor regulator [Streptomyces lividans TK24]
 gi|291341736|gb|EFE68692.1| transcriptional factor regulator [Streptomyces ghanaensis ATCC
           14672]
 gi|291348742|gb|EFE75646.1| transcriptional factor regulator [Streptomyces roseosporus NRRL
           15998]
 gi|292833386|gb|EFF91735.1| CarD family transcriptional regulator [Streptomyces sp. e14]
 gi|294326652|gb|EFG08295.1| Transcriptional regulator, CarD family [Streptomyces clavuligerus
           ATCC 27064]
 gi|297158399|gb|ADI08111.1| putative transcriptional regulator [Streptomyces bingchenggensis
           BCW-1]
 gi|302429022|gb|EFL00838.1| transcriptional regulator [Streptomyces sp. SPB78]
 gi|302444761|gb|EFL16577.1| transcriptional regulator [Streptomyces sp. C]
 gi|302469962|gb|EFL33055.1| transcriptional regulator [Streptomyces viridochromogenes DSM
           40736]
 gi|302477575|gb|EFL40668.1| CarD family transcriptional regulator [Streptomyces griseoflavus
           Tu4000]
 gi|315455531|emb|CBY85030.1| hypothetical protein [Streptomyces sp. ATCC 55098]
 gi|326658772|gb|EGE43618.1| transcriptional regulator, CarD family [Streptomyces cf. griseus
           XylebKG-1]
 gi|328884013|emb|CCA57252.1| CarD transcriptional regulator [Streptomyces venezuelae ATCC 10712]
 gi|329304289|gb|EGG48169.1| transcriptional regulator [Streptomyces griseoaurantiacus M045]
          Length = 160

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 87/158 (55%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ +++ G+   + V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRQIKGVDKTYLVLKVAQGDLTVRVPADNAEFVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+I +AEVVRDL R + +   S 
Sbjct: 63  GQDGLDRVFEVLRAPYAEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLWRRERERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A   + +E +A  L++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAENTNEDKAEALLDEVLAS 160


>gi|118470459|ref|YP_890299.1| CarD family transcriptional regulator [Mycobacterium smegmatis str.
           MC2 155]
 gi|118171746|gb|ABK72642.1| transcriptional regulator, CarD family protein [Mycobacterium
           smegmatis str. MC2 155]
          Length = 162

 Score =  147 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 45/160 (28%), Positives = 86/160 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPADNAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A   +  + +A  +++  L++ S
Sbjct: 123 GEKRMLAKARQILVGELALAENTDDAKAETILDEVLAAAS 162


>gi|145222036|ref|YP_001132714.1| CarD family transcriptional regulator [Mycobacterium gilvum
           PYR-GCK]
 gi|315446222|ref|YP_004079101.1| CarD family transcriptional regulator [Mycobacterium sp. Spyr1]
 gi|145214522|gb|ABP43926.1| transcriptional regulator, CarD family [Mycobacterium gilvum
           PYR-GCK]
 gi|315264525|gb|ADU01267.1| transcriptional regulator, CarD family [Mycobacterium sp. Spyr1]
          Length = 162

 Score =  147 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 45/160 (28%), Positives = 86/160 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPADNAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A   +  + +A  +++  L++ S
Sbjct: 123 GEKRMLAKARQILVGELALAENTDDAKASTILDEVLAAAS 162


>gi|298293646|ref|YP_003695585.1| CarD family transcriptional regulator [Starkeya novella DSM 506]
 gi|296930157|gb|ADH90966.1| transcriptional regulator, CarD family [Starkeya novella DSM 506]
          Length = 200

 Score =  147 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 117/179 (65%), Positives = 147/179 (82%), Gaps = 1/179 (0%)

Query: 1   MTFQQKRDAM-RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           MT  +K     RQGF+TGEHIVYP+HGVG IT I+EQEVAG KLE FVI F+KDKM L+V
Sbjct: 1   MTSTKKPSTNIRQGFKTGEHIVYPSHGVGRITSIEEQEVAGFKLELFVIHFEKDKMTLRV 60

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV K   +GMRKLSE   +++AL+ ++G+ARVKRTMWSRRAQEY+AKINSGDL+AI+EVV
Sbjct: 61  PVPKIASVGMRKLSEPTILKKALETLKGRARVKRTMWSRRAQEYEAKINSGDLVAISEVV 120

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEK 178
           RDL+R+++QPE+SYSERQLYE+AL+RM RE+AAV++++E EAI LIE NL     +  K
Sbjct: 121 RDLYRSEAQPEQSYSERQLYEAALDRMARELAAVDNLTETEAIKLIEQNLLKGPRRVGK 179


>gi|333026128|ref|ZP_08454192.1| putative transcriptional factor regulator [Streptomyces sp. Tu6071]
 gi|332745980|gb|EGJ76421.1| putative transcriptional factor regulator [Streptomyces sp. Tu6071]
          Length = 160

 Score =  147 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 87/158 (55%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ +++ G+   + V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIDAIETRQIKGVDKTYLVLKVAQGDLTVRVPADNAEFVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+I +AEVVRDL R + +   S 
Sbjct: 63  GQDGLDRVFEVLRAPYAEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLWRRERERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A   + +E +A  L++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAENTNEDKAEALLDEVLAS 160


>gi|118591279|ref|ZP_01548677.1| transcriptional regulator, CarD family protein [Stappia aggregata
           IAM 12614]
 gi|118435951|gb|EAV42594.1| transcriptional regulator, CarD family protein [Stappia aggregata
           IAM 12614]
          Length = 194

 Score =  146 bits (369), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 114/175 (65%), Positives = 140/175 (80%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M    K+ A RQGF+TGE+IVYPAHGVG IT I+EQ+VAG  LE  VI F++DKM L+VP
Sbjct: 1   MATNTKKTAQRQGFKTGEYIVYPAHGVGQITAIEEQKVAGHSLELLVIVFEQDKMTLRVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V K   +GMRKL +   V++AL+ VRG+ RVKRTMWSRRAQEY+AKINSGDLI+I+EVVR
Sbjct: 61  VAKIASVGMRKLGDPAAVKKALETVRGRPRVKRTMWSRRAQEYEAKINSGDLISISEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSK 175
           DL R+++QPE+SYSERQLYE+AL+RM REIAAVN  SE EA+  IE NL+   S+
Sbjct: 121 DLFRSENQPEQSYSERQLYEAALDRMAREIAAVNKCSETEAVKQIEQNLAKSPSR 175


>gi|225628327|ref|ZP_03786361.1| transcriptional regulator [Brucella ceti str. Cudo]
 gi|225616173|gb|EEH13221.1| transcriptional regulator [Brucella ceti str. Cudo]
          Length = 250

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 129/188 (68%), Positives = 153/188 (81%), Gaps = 2/188 (1%)

Query: 1   MTFQQKRDAMRQG-FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           M+ QQK+  + +G F+ GE IVYPAHGVG I  I+EQEVAG KLE FVI F+KDKM LKV
Sbjct: 60  MSSQQKKSPVARGGFKAGEAIVYPAHGVGQIVTIEEQEVAGHKLELFVIDFEKDKMRLKV 119

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV KA  IGMRKLSE  +VERALK+V+G+ARVKRTMWSRRAQEYDAKINSGDLI+I+EVV
Sbjct: 120 PVAKAASIGMRKLSETDYVERALKVVQGRARVKRTMWSRRAQEYDAKINSGDLISISEVV 179

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ LIEVNL+    K  K+
Sbjct: 180 RDLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKLSETEAVRLIEVNLAKG-PKRGKA 238

Query: 180 TSENQDKA 187
            +E  D  
Sbjct: 239 EAELDDDE 246


>gi|320009411|gb|ADW04261.1| transcriptional regulator, CarD family [Streptomyces flavogriseus
           ATCC 33331]
          Length = 160

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 87/158 (55%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ +++ G+   + V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRQIKGVDKTYLVLKVAQGDLTVRVPADNAEFVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+I +AEVVRDL R + +   S 
Sbjct: 63  GQEGLDRVFEVLRAPYAEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLWRRERERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A   + +E +A  L++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAENTNEDKAEALLDEVLAS 160


>gi|271962514|ref|YP_003336710.1| carD family transcriptional regulator [Streptosporangium roseum DSM
           43021]
 gi|270505689|gb|ACZ83967.1| CarD family transcriptional regulator [Streptosporangium roseum DSM
           43021]
          Length = 160

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 50/158 (31%), Positives = 83/158 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I  + + G +  + V+  DK  + ++VP   A  +G+R + 
Sbjct: 3   FQVGDTVVYPHHGAARIEAITTRTIKGEERTYLVLKVDKGDLTVQVPADNAELVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +ER   ++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQEGLERVFDVLRMPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDKERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A     +E +A  L++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAEKTNEDKAEALLDEVLNS 160


>gi|302544415|ref|ZP_07296757.1| CarD family transcriptional regulator [Streptomyces hygroscopicus
           ATCC 53653]
 gi|307326973|ref|ZP_07606163.1| transcriptional regulator, CarD family [Streptomyces violaceusniger
           Tu 4113]
 gi|302462033|gb|EFL25126.1| CarD family transcriptional regulator [Streptomyces himastatinicus
           ATCC 53653]
 gi|306887271|gb|EFN18267.1| transcriptional regulator, CarD family [Streptomyces violaceusniger
           Tu 4113]
          Length = 160

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 87/158 (55%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ +++ G+   + V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRQIKGVDKTYLVLKVAQGDLTVRVPADNAEFVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+I +AEVVRDL R + +   S 
Sbjct: 63  GQDGLDRVFEVLRAPYAEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLWRRERERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A   S +E +A  L++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAESTNEDKAEALLDEVLAS 160


>gi|300024663|ref|YP_003757274.1| CarD family transcriptional regulator [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526484|gb|ADJ24953.1| transcriptional regulator, CarD family [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 333

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 106/188 (56%), Positives = 140/188 (74%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +  Q+K    R GF+  E +VYPAHGVG I  I+EQE+AGM LE FVI FDK+K+ L+VP
Sbjct: 146 LAVQKKPVNQRHGFKANEFVVYPAHGVGRIVGIEEQEIAGMSLELFVITFDKEKLTLRVP 205

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
            GK   +GMRKL++   V++A++ ++G+AR+KRTMWSRRAQEY AKINSGDLI+IAEVVR
Sbjct: 206 TGKLASVGMRKLADEGLVKKAMETLKGRARIKRTMWSRRAQEYVAKINSGDLISIAEVVR 265

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R+++QPE+SYSERQLYE AL+RM RE+AAV  + E  A+  I   LS  +     + 
Sbjct: 266 DLYRSEAQPEQSYSERQLYEDALDRMARELAAVEKLDERGAVQRITEILSKSAKGRRLAD 325

Query: 181 SENQDKAA 188
           SE+  +AA
Sbjct: 326 SESVGEAA 333


>gi|120406288|ref|YP_956117.1| CarD family transcriptional regulator [Mycobacterium vanbaalenii
           PYR-1]
 gi|119959106|gb|ABM16111.1| transcriptional regulator, CarD family [Mycobacterium vanbaalenii
           PYR-1]
          Length = 162

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 45/160 (28%), Positives = 86/160 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVSQGDLTVRVPADNAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A   +  + +A  +++  L++ S
Sbjct: 123 GEKRMLAKARQILVGELALAENTDDAKASTILDEVLAAAS 162


>gi|328542018|ref|YP_004302127.1| CarD-like transcriptional regulator family [polymorphum gilvum
           SL003B-26A1]
 gi|326411768|gb|ADZ68831.1| CarD-like transcriptional regulator family [Polymorphum gilvum
           SL003B-26A1]
          Length = 192

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 115/187 (61%), Positives = 148/187 (79%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M    K+ A RQGF+TGEHIVYP+HGVG IT I+EQ VAG  LE  VI+F+KDKM L+VP
Sbjct: 1   MATITKKAAQRQGFKTGEHIVYPSHGVGQITAIEEQSVAGHSLELLVISFEKDKMTLRVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V K   +GMRKL++A  V++AL+ VRG+ R+KRTMWSRRAQEY+AKINSGDLI+I+EVVR
Sbjct: 61  VAKIATVGMRKLADAPTVKKALETVRGRPRIKRTMWSRRAQEYEAKINSGDLISISEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R+D+QPE+SYSERQLYE+AL+RM REIAAVN  SE EA+  IE NL+   ++ + + 
Sbjct: 121 DLYRSDTQPEQSYSERQLYEAALDRMAREIAAVNKCSETEAVKQIEQNLARTPNRAKDAE 180

Query: 181 SENQDKA 187
           + + +  
Sbjct: 181 AGDDEGE 187


>gi|158425667|ref|YP_001526959.1| transcription factor protein [Azorhizobium caulinodans ORS 571]
 gi|158332556|dbj|BAF90041.1| transcription factor protein [Azorhizobium caulinodans ORS 571]
          Length = 198

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 116/187 (62%), Positives = 147/187 (78%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M+ ++     R GF+TGEHIVYP+HGVG IT I+EQEVAG KLE FVI+F+KDKM L+VP
Sbjct: 1   MSTKKSSAQARLGFKTGEHIVYPSHGVGRITSIEEQEVAGFKLELFVISFEKDKMTLRVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V K   +GMRKLSE   V +AL+ ++G+ARVKRTMWSRRAQEY+AKINSGDLIAI+EVVR
Sbjct: 61  VPKIASVGMRKLSEGPVVTKALETLKGRARVKRTMWSRRAQEYEAKINSGDLIAISEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R+D+QPE+SYSERQLYE+AL+RM RE++AV +I+E E++ LIE NL     +     
Sbjct: 121 DLYRSDAQPEQSYSERQLYEAALDRMARELSAVQNITETESVKLIEQNLQKGPKRGAGKA 180

Query: 181 SENQDKA 187
            E +D  
Sbjct: 181 EEVEDSE 187


>gi|259417460|ref|ZP_05741379.1| transcriptional regulator, CarD family [Silicibacter sp. TrichCH4B]
 gi|259346366|gb|EEW58180.1| transcriptional regulator, CarD family [Silicibacter sp. TrichCH4B]
          Length = 193

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 105/174 (60%), Positives = 130/174 (74%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  + IVYPAHGVG I  I+EQEVAG KLE FVI F+KDKM L+VP
Sbjct: 25  MTKSKK-----LEFRPNDFIVYPAHGVGQIISIEEQEVAGYKLELFVITFEKDKMTLRVP 79

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA+DIGMR LS    + +A+K ++GKA+VKR MWSRRAQEY+ KINSGDLI+IAEVVR
Sbjct: 80  THKAVDIGMRSLSSPDVINQAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLISIAEVVR 139

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L+S+++
Sbjct: 140 DLHRTDDQREQSYSERQLYEAALERLTREVAAVSGGDEIAAAKQVDEVLTSRAA 193


>gi|150398306|ref|YP_001328773.1| CarD family transcriptional regulator [Sinorhizobium medicae
           WSM419]
 gi|150029821|gb|ABR61938.1| transcriptional regulator, CarD family [Sinorhizobium medicae
           WSM419]
          Length = 189

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 130/188 (69%), Positives = 155/188 (82%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT QQK+ + RQGF+TGE IVYPAHGVG I  I+EQEVAGMKLE FVI F+KDKM LKVP
Sbjct: 1   MTTQQKKSSTRQGFKTGESIVYPAHGVGQIVAIEEQEVAGMKLELFVIDFEKDKMRLKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA+ IGMRKLSE  FV+RALK+V+GKARVKRTMWSRRAQEYDAKINSGDLI+IAEVVR
Sbjct: 61  VAKAVGIGMRKLSETDFVDRALKVVQGKARVKRTMWSRRAQEYDAKINSGDLISIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ L+E +L+    + +   
Sbjct: 121 DLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKMSETEAVRLVEAHLNKGPKRGKAIE 180

Query: 181 SENQDKAA 188
            ++    A
Sbjct: 181 EDDAQDEA 188


>gi|240172169|ref|ZP_04750828.1| transcriptional regulator, CarD family protein [Mycobacterium
           kansasii ATCC 12478]
 gi|296166638|ref|ZP_06849065.1| CarD family transcriptional regulator [Mycobacterium
           parascrofulaceum ATCC BAA-614]
 gi|295898010|gb|EFG77589.1| CarD family transcriptional regulator [Mycobacterium
           parascrofulaceum ATCC BAA-614]
          Length = 162

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 45/160 (28%), Positives = 86/160 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   +  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPADNAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A   S  + +A  +++  L++ S
Sbjct: 123 GEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS 162


>gi|54022399|ref|YP_116641.1| putative transcriptional regulator [Nocardia farcinica IFM 10152]
 gi|54013907|dbj|BAD55277.1| putative transcriptional regulator [Nocardia farcinica IFM 10152]
          Length = 162

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 46/160 (28%), Positives = 84/160 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  GQEGLDRVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRREQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A      + +A  L++  L++ S
Sbjct: 123 GEKRMLAKARQILVGELALAEGTDDGKAETLLDEVLAAAS 162


>gi|15967010|ref|NP_387363.1| hypothetical protein SMc03874 [Sinorhizobium meliloti 1021]
 gi|307302478|ref|ZP_07582235.1| transcriptional regulator, CarD family [Sinorhizobium meliloti
           BL225C]
 gi|307316192|ref|ZP_07595636.1| transcriptional regulator, CarD family [Sinorhizobium meliloti
           AK83]
 gi|15076283|emb|CAC47836.1| Hypothetical protein SMc03874 [Sinorhizobium meliloti 1021]
 gi|306898032|gb|EFN28774.1| transcriptional regulator, CarD family [Sinorhizobium meliloti
           AK83]
 gi|306903148|gb|EFN33738.1| transcriptional regulator, CarD family [Sinorhizobium meliloti
           BL225C]
          Length = 189

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 131/188 (69%), Positives = 155/188 (82%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT QQK+ + RQGF+TGE IVYPAHGVG I  I+EQEVAGMKLE FVI F+KDKM LKVP
Sbjct: 1   MTTQQKKSSTRQGFKTGESIVYPAHGVGQIVAIEEQEVAGMKLELFVIDFEKDKMRLKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA+ IGMRKLSE  FV+RALK+V+GKARVKRTMWSRRAQEYDAKINSGDLI+IAEVVR
Sbjct: 61  VAKAVGIGMRKLSETDFVDRALKVVQGKARVKRTMWSRRAQEYDAKINSGDLISIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ L+E NL+    + +   
Sbjct: 121 DLYRAENQPEQSYSERQLYEAALDRMAREIAAVNRMSETEAVRLVEANLNKGPKRGKAIE 180

Query: 181 SENQDKAA 188
            ++    A
Sbjct: 181 EDDAQDEA 188


>gi|311896848|dbj|BAJ29256.1| putative CarD family transcriptional regulator [Kitasatospora setae
           KM-6054]
          Length = 160

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 87/158 (55%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ +++ G+   + V+   +  + L+VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRQIKGVDKTYLVLKVQQGDLTLRVPAENAEFVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+I +AEVVRDL R + +   S 
Sbjct: 63  GQEGLDRVFEVLRAPYTEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLWRRERERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A   + +E +A  L++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAENTNEDKAETLLDEVLAS 160


>gi|254504462|ref|ZP_05116613.1| CarD-like transcriptional regulator family [Labrenzia alexandrii
           DFL-11]
 gi|222440533|gb|EEE47212.1| CarD-like transcriptional regulator family [Labrenzia alexandrii
           DFL-11]
          Length = 199

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 115/175 (65%), Positives = 139/175 (79%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M    K+ A RQGF+TGE+IVYPAHGVG IT I+EQ VAG  LE  VI F++DKM L+VP
Sbjct: 1   MATNTKKTAQRQGFKTGEYIVYPAHGVGQITAIEEQNVAGHSLELLVIVFEQDKMTLRVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V K   +GMRKL +   V++AL+ V+G+ R+KRTMWSRRAQEY+AKINSGDLIAI+EVVR
Sbjct: 61  VAKIASVGMRKLGDPAAVKKALETVQGRPRIKRTMWSRRAQEYEAKINSGDLIAISEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSK 175
           DL R++SQPE+SYSERQLYE+AL+RM REIAAVN  SE EAI  IE NL+   S+
Sbjct: 121 DLFRSESQPEQSYSERQLYEAALDRMAREIAAVNKCSETEAIKEIEQNLAKSPSR 175


>gi|56551117|ref|YP_161956.1| CarD family transcriptional regulator [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241761475|ref|ZP_04759563.1| transcriptional regulator, CarD family [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753230|ref|YP_003226123.1| CarD family transcriptional regulator [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|56542691|gb|AAV88845.1| transcriptional regulator, CarD family [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241374382|gb|EER63879.1| transcriptional regulator, CarD family [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552593|gb|ACV75539.1| transcriptional regulator, CarD family [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 184

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 85/181 (46%), Positives = 130/181 (71%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            +    F  G+++VYP HGVG + E++ QE+AG +LE +V+ F+K++M L+VP  KA  +
Sbjct: 2   ASKALSFVVGDYVVYPKHGVGRVVELQSQEIAGTRLELYVLRFEKERMTLRVPTNKAEAV 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMRKLS +  ++ A++ ++GK R+KRTMWSRRAQEY+ KINSGDL++IAEVVRDL R D 
Sbjct: 62  GMRKLSSSATLQEAIQTLKGKPRIKRTMWSRRAQEYETKINSGDLVSIAEVVRDLFRADD 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDKA 187
           QPE+SYSERQ++E A +R+ RE+ A+ +  E +A++ I   L + +++  ++  E   + 
Sbjct: 122 QPEQSYSERQIFEGAASRLARELGAMENTDEAQALDKIFDVLKAAAAEHRQAVKELAKEE 181

Query: 188 A 188
           A
Sbjct: 182 A 182


>gi|297180170|gb|ADI16392.1| transcriptional regulators, similar to M. xanthus card [uncultured
           bacterium HF130_12L15]
          Length = 193

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 130/187 (69%), Positives = 154/187 (82%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  QQK+ A R GF+T E+IVYPAHGVG I  I+EQEVAG KLE FVI F KDKM LKVP
Sbjct: 1   MATQQKKTAARNGFKTAEYIVYPAHGVGQIVAIEEQEVAGHKLELFVIDFQKDKMRLKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA  IGMRKLSE  +V+RALK+V+G+ARVKRTMWSRRAQEYDAKINSGDLI+I+EVVR
Sbjct: 61  VAKAASIGMRKLSETDYVDRALKVVQGRARVKRTMWSRRAQEYDAKINSGDLISISEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R D+QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ LIEVNL+    +  K+ 
Sbjct: 121 DLYRADNQPEQSYSERQLYEAALDRMAREIAAVNRMSETEAVRLIEVNLNKGPRRGVKAD 180

Query: 181 SENQDKA 187
           +E + +A
Sbjct: 181 NEGEPEA 187


>gi|92116128|ref|YP_575857.1| CarD family transcriptional regulator [Nitrobacter hamburgensis
           X14]
 gi|91799022|gb|ABE61397.1| transcriptional regulator, CarD family [Nitrobacter hamburgensis
           X14]
          Length = 259

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 109/177 (61%), Positives = 139/177 (78%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K    RQGFRT E +VYPAHGVG I  I+EQE+AG +LE FVI F KDKM L+VP  K 
Sbjct: 63  KKVLTQRQGFRTNEFVVYPAHGVGQILAIEEQEIAGARLELFVINFMKDKMTLRVPTAKI 122

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
            ++GMRKLSE   V+RAL+ ++G+AR+KRTMWSRRAQEY+AKINSGD++AIAEVVRDL+R
Sbjct: 123 ANVGMRKLSEPGLVKRALETLKGRARIKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLYR 182

Query: 125 TDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTS 181
           ++SQPE+SYSERQLYE+AL+R+ REIA V  ++E EA+  IE  L+    +  K+ S
Sbjct: 183 SESQPEQSYSERQLYEAALDRLSREIAVVQHVTETEAVKEIEGQLAKSPRRGAKAES 239


>gi|85713774|ref|ZP_01044764.1| transcription factor CarD [Nitrobacter sp. Nb-311A]
 gi|85699678|gb|EAQ37545.1| transcription factor CarD [Nitrobacter sp. Nb-311A]
          Length = 220

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 109/180 (60%), Positives = 140/180 (77%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K    RQGF+T E +VYPAHGVG I  I+EQE+AG KLE FVI F KDKM L+VP  K 
Sbjct: 22  KKVLTQRQGFKTNEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFIKDKMTLRVPTAKI 81

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
            ++GMRKLSE   V+RAL+ ++G+AR+KRTMWSRRAQEY+AKINSGD++AIAEVVRDL+R
Sbjct: 82  ANVGMRKLSEPDLVKRALETLKGRARIKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLYR 141

Query: 125 TDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQ 184
           ++SQPE+SYSERQLYE+AL+R+ REIA V  ++E EAI  IE  L+    +  K+  + +
Sbjct: 142 SESQPEQSYSERQLYEAALDRLSREIAVVQHVTETEAIKEIEGQLAKSPRRGAKAELDAE 201


>gi|152964866|ref|YP_001360650.1| CarD family transcriptional regulator [Kineococcus radiotolerans
           SRS30216]
 gi|151359383|gb|ABS02386.1| transcriptional regulator, CarD family [Kineococcus radiotolerans
           SRS30216]
          Length = 160

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 83/158 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I EIK + + G    + V+   +  + ++VP      +G+R + 
Sbjct: 3   FTVGETVVYPHHGAALIEEIKTRTIKGEDKLYLVLKVAQGDLTIEVPADNVDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R   ++R     + T WSRR +    K+ SGD++ +AEVVRDL R D     S 
Sbjct: 63  GREGLDRVFSVLRTPYAEEPTNWSRRYKANLEKLASGDVVKVAEVVRDLWRRDQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A   + +E +A +L++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAENTNEDKAESLLDEVLAS 160


>gi|312138097|ref|YP_004005433.1| card like transcriptional regulator [Rhodococcus equi 103S]
 gi|325674999|ref|ZP_08154686.1| CarD family transcriptional regulator [Rhodococcus equi ATCC 33707]
 gi|311887436|emb|CBH46748.1| CarD like transcriptional regulator [Rhodococcus equi 103S]
 gi|325554585|gb|EGD24260.1| CarD family transcriptional regulator [Rhodococcus equi ATCC 33707]
          Length = 162

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 44/160 (27%), Positives = 84/160 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  GQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRREQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A      + +A  +++  L++ S
Sbjct: 123 GEKRMLAKARQILVGELALAEGTDDAKAEIILDEVLAAAS 162


>gi|15610719|ref|NP_218100.1| transcription factor [Mycobacterium tuberculosis H37Rv]
 gi|15843196|ref|NP_338233.1| hypothetical protein MT3689 [Mycobacterium tuberculosis CDC1551]
 gi|31794760|ref|NP_857253.1| putative transcription factor [Mycobacterium bovis AF2122/97]
 gi|41406573|ref|NP_959409.1| hypothetical protein MAP0475 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118464023|ref|YP_879850.1| CarD family transcriptional regulator [Mycobacterium avium 104]
 gi|118619338|ref|YP_907670.1| transcriptional regulatory protein [Mycobacterium ulcerans Agy99]
 gi|121639503|ref|YP_979727.1| putative transcription factor [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148663447|ref|YP_001284970.1| putative transcription factor [Mycobacterium tuberculosis H37Ra]
 gi|148824789|ref|YP_001289543.1| transcription factor [Mycobacterium tuberculosis F11]
 gi|167967112|ref|ZP_02549389.1| hypothetical transcription factor [Mycobacterium tuberculosis
           H37Ra]
 gi|183985051|ref|YP_001853342.1| transcriptional regulatory protein [Mycobacterium marinum M]
 gi|215405632|ref|ZP_03417813.1| transcriptional regulatory protein [Mycobacterium tuberculosis
           02_1987]
 gi|215413503|ref|ZP_03422180.1| transcriptional regulatory protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|215429084|ref|ZP_03427003.1| transcriptional regulatory protein [Mycobacterium tuberculosis T92]
 gi|215432556|ref|ZP_03430475.1| transcriptional regulatory protein [Mycobacterium tuberculosis
           EAS054]
 gi|215447917|ref|ZP_03434669.1| transcriptional regulatory protein [Mycobacterium tuberculosis T85]
 gi|218755367|ref|ZP_03534163.1| transcriptional regulatory protein [Mycobacterium tuberculosis GM
           1503]
 gi|219559660|ref|ZP_03538736.1| transcriptional regulatory protein [Mycobacterium tuberculosis T17]
 gi|253800624|ref|YP_003033625.1| transcriptional regulator [Mycobacterium tuberculosis KZN 1435]
 gi|254366146|ref|ZP_04982190.1| hypothetical transcription factor [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254552692|ref|ZP_05143139.1| transcriptional regulator [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|254773528|ref|ZP_05215044.1| transcriptional regulatory protein [Mycobacterium avium subsp.
           avium ATCC 25291]
 gi|254822710|ref|ZP_05227711.1| transcriptional regulatory protein [Mycobacterium intracellulare
           ATCC 13950]
 gi|260184500|ref|ZP_05761974.1| transcriptional regulator [Mycobacterium tuberculosis CPHL_A]
 gi|260198625|ref|ZP_05766116.1| transcriptional regulator [Mycobacterium tuberculosis T46]
 gi|260202771|ref|ZP_05770262.1| transcriptional regulator [Mycobacterium tuberculosis K85]
 gi|289441013|ref|ZP_06430757.1| transcriptional regulator [Mycobacterium tuberculosis T46]
 gi|289445177|ref|ZP_06434921.1| transcriptional regulator [Mycobacterium tuberculosis CPHL_A]
 gi|289555847|ref|ZP_06445057.1| transcriptional regulator [Mycobacterium tuberculosis KZN 605]
 gi|289571825|ref|ZP_06452052.1| transcriptional regulator [Mycobacterium tuberculosis T17]
 gi|289572236|ref|ZP_06452463.1| transcriptional regulator [Mycobacterium tuberculosis K85]
 gi|289747420|ref|ZP_06506798.1| transcription factor [Mycobacterium tuberculosis 02_1987]
 gi|289752298|ref|ZP_06511676.1| transcriptional regulator [Mycobacterium tuberculosis T92]
 gi|289755712|ref|ZP_06515090.1| transcriptional regulator [Mycobacterium tuberculosis EAS054]
 gi|289759741|ref|ZP_06519119.1| transcriptional regulatory protein [Mycobacterium tuberculosis T85]
 gi|289763762|ref|ZP_06523140.1| transcription factor [Mycobacterium tuberculosis GM 1503]
 gi|294993703|ref|ZP_06799394.1| transcriptional regulator [Mycobacterium tuberculosis 210]
 gi|297636258|ref|ZP_06954038.1| transcriptional regulator [Mycobacterium tuberculosis KZN 4207]
 gi|297733251|ref|ZP_06962369.1| transcriptional regulator [Mycobacterium tuberculosis KZN R506]
 gi|298527062|ref|ZP_07014471.1| transcriptional regulator [Mycobacterium tuberculosis 94_M4241A]
 gi|306777937|ref|ZP_07416274.1| transcriptional regulator [Mycobacterium tuberculosis SUMu001]
 gi|306778466|ref|ZP_07416803.1| transcriptional regulator [Mycobacterium tuberculosis SUMu002]
 gi|306786490|ref|ZP_07424812.1| transcriptional regulator [Mycobacterium tuberculosis SUMu003]
 gi|306790855|ref|ZP_07429177.1| transcriptional regulator [Mycobacterium tuberculosis SUMu004]
 gi|306791178|ref|ZP_07429480.1| transcriptional regulator [Mycobacterium tuberculosis SUMu005]
 gi|306795963|ref|ZP_07434265.1| transcriptional regulator [Mycobacterium tuberculosis SUMu006]
 gi|306801211|ref|ZP_07437879.1| transcriptional regulator [Mycobacterium tuberculosis SUMu008]
 gi|306805423|ref|ZP_07442091.1| transcriptional regulator [Mycobacterium tuberculosis SUMu007]
 gi|306969715|ref|ZP_07482376.1| transcriptional regulator [Mycobacterium tuberculosis SUMu009]
 gi|306974055|ref|ZP_07486716.1| transcriptional regulator [Mycobacterium tuberculosis SUMu010]
 gi|307081764|ref|ZP_07490934.1| transcriptional regulator [Mycobacterium tuberculosis SUMu011]
 gi|307086380|ref|ZP_07495493.1| transcriptional regulator [Mycobacterium tuberculosis SUMu012]
 gi|313660581|ref|ZP_07817461.1| transcriptional regulator [Mycobacterium tuberculosis KZN V2475]
 gi|3261556|emb|CAA17859.1| POSSIBLE TRANSCRIPTION FACTOR [Mycobacterium tuberculosis H37Rv]
 gi|13883549|gb|AAK48047.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551]
 gi|31620357|emb|CAD95800.1| PUTATIVE TRANSCRIPTION FACTOR [Mycobacterium bovis AF2122/97]
 gi|41394922|gb|AAS02792.1| hypothetical protein MAP_0475 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118165310|gb|ABK66207.1| transcriptional regulator, CarD family protein [Mycobacterium avium
           104]
 gi|118571448|gb|ABL06199.1| conserved transcriptional regulatory protein [Mycobacterium
           ulcerans Agy99]
 gi|121495151|emb|CAL73637.1| Putative transcription factor [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|134151658|gb|EBA43703.1| hypothetical transcription factor [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148507599|gb|ABQ75408.1| putative transcription factor [Mycobacterium tuberculosis H37Ra]
 gi|148723316|gb|ABR07941.1| hypothetical transcription factor [Mycobacterium tuberculosis F11]
 gi|183178377|gb|ACC43487.1| conserved transcriptional regulatory protein [Mycobacterium marinum
           M]
 gi|253322127|gb|ACT26730.1| transcriptional regulator [Mycobacterium tuberculosis KZN 1435]
 gi|289413932|gb|EFD11172.1| transcriptional regulator [Mycobacterium tuberculosis T46]
 gi|289418135|gb|EFD15336.1| transcriptional regulator [Mycobacterium tuberculosis CPHL_A]
 gi|289440479|gb|EFD22972.1| transcriptional regulator [Mycobacterium tuberculosis KZN 605]
 gi|289536667|gb|EFD41245.1| transcriptional regulator [Mycobacterium tuberculosis K85]
 gi|289545579|gb|EFD49227.1| transcriptional regulator [Mycobacterium tuberculosis T17]
 gi|289687948|gb|EFD55436.1| transcription factor [Mycobacterium tuberculosis 02_1987]
 gi|289692885|gb|EFD60314.1| transcriptional regulator [Mycobacterium tuberculosis T92]
 gi|289696299|gb|EFD63728.1| transcriptional regulator [Mycobacterium tuberculosis EAS054]
 gi|289711268|gb|EFD75284.1| transcription factor [Mycobacterium tuberculosis GM 1503]
 gi|289715305|gb|EFD79317.1| transcriptional regulatory protein [Mycobacterium tuberculosis T85]
 gi|298496856|gb|EFI32150.1| transcriptional regulator [Mycobacterium tuberculosis 94_M4241A]
 gi|308213809|gb|EFO73208.1| transcriptional regulator [Mycobacterium tuberculosis SUMu001]
 gi|308328563|gb|EFP17414.1| transcriptional regulator [Mycobacterium tuberculosis SUMu002]
 gi|308328978|gb|EFP17829.1| transcriptional regulator [Mycobacterium tuberculosis SUMu003]
 gi|308332800|gb|EFP21651.1| transcriptional regulator [Mycobacterium tuberculosis SUMu004]
 gi|308340291|gb|EFP29142.1| transcriptional regulator [Mycobacterium tuberculosis SUMu005]
 gi|308343630|gb|EFP32481.1| transcriptional regulator [Mycobacterium tuberculosis SUMu006]
 gi|308348097|gb|EFP36948.1| transcriptional regulator [Mycobacterium tuberculosis SUMu007]
 gi|308352020|gb|EFP40871.1| transcriptional regulator [Mycobacterium tuberculosis SUMu008]
 gi|308352807|gb|EFP41658.1| transcriptional regulator [Mycobacterium tuberculosis SUMu009]
 gi|308356657|gb|EFP45508.1| transcriptional regulator [Mycobacterium tuberculosis SUMu010]
 gi|308360612|gb|EFP49463.1| transcriptional regulator [Mycobacterium tuberculosis SUMu011]
 gi|308364200|gb|EFP53051.1| transcriptional regulator [Mycobacterium tuberculosis SUMu012]
 gi|323717777|gb|EGB26975.1| transcriptional regulator [Mycobacterium tuberculosis CDC1551A]
 gi|326905422|gb|EGE52355.1| transcriptional regulator [Mycobacterium tuberculosis W-148]
 gi|328460355|gb|AEB05778.1| transcriptional regulator [Mycobacterium tuberculosis KZN 4207]
          Length = 162

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 45/160 (28%), Positives = 86/160 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   +  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A   S  + +A  +++  L++ S
Sbjct: 123 GEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS 162


>gi|72163306|ref|YP_290963.1| CarD family transcriptional regulator [Thermobifida fusca YX]
 gi|71917038|gb|AAZ56940.1| transcriptional regulator, CarD family [Thermobifida fusca YX]
          Length = 160

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 48/157 (30%), Positives = 85/157 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ + + G +  + V+  DK  + ++VP   A ++G+R + 
Sbjct: 3   FKVGDTVVYPHHGAARIEAIETRTIKGEEKTYLVLKVDKGDLTVRVPADNAEEVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQEGLDRVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDKERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            E+++   A   +V E+A     +E +A  L++  L+
Sbjct: 123 GEKRMLAKARQILVSELALAEKTNEDKAEALLDEVLA 159


>gi|297563240|ref|YP_003682214.1| CarD family transcriptional regulator [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296847688|gb|ADH69708.1| transcriptional regulator, CarD family [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 160

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 48/156 (30%), Positives = 83/156 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ + + G    + V+  DK  + ++VP   A D+G+R + 
Sbjct: 3   FKVGDTVVYPHHGAARIEAIETRNIKGEDRIYLVLRVDKGDLTVRVPAANAEDVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQEGLDKVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDKERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            E+++   A   +V E+A     +E +A  L++  L
Sbjct: 123 GEKRMLAKARQILVSELALAEKTNEDKAEALLDEVL 158


>gi|126738718|ref|ZP_01754414.1| transcriptional regulator, CarD family protein [Roseobacter sp.
           SK209-2-6]
 gi|126719899|gb|EBA16606.1| transcriptional regulator, CarD family protein [Roseobacter sp.
           SK209-2-6]
          Length = 169

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 102/174 (58%), Positives = 129/174 (74%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  +++VYPAHGVG I  I+EQEVAG  LE FVI F+KDKM L+VP
Sbjct: 1   MTKSKK-----LEFRPNDYVVYPAHGVGQIISIEEQEVAGFALELFVITFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA ++GMR LS    + +A+K ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 56  TNKATEVGMRSLSSPDVINQAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L+S+++
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVSGADEILAAKQVDEVLTSRAA 169


>gi|296138335|ref|YP_003645578.1| transcriptional regulator, CarD family [Tsukamurella paurometabola
           DSM 20162]
 gi|296026469|gb|ADG77239.1| transcriptional regulator, CarD family [Tsukamurella paurometabola
           DSM 20162]
          Length = 162

 Score =  144 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 46/160 (28%), Positives = 86/160 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ + + G + E+ V+   +  + +KVP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIEIKTIGGREREYLVLKVAQGDLTVKVPAENAEVVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  GQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRREQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A   +  + +A +L++  L++ S
Sbjct: 123 GEKRMLTKARQILVGELALAEATDDGKAESLLDEALAAAS 162


>gi|313902845|ref|ZP_07836242.1| transcriptional regulator, CarD family [Thermaerobacter
           subterraneus DSM 13965]
 gi|313466965|gb|EFR62482.1| transcriptional regulator, CarD family [Thermaerobacter
           subterraneus DSM 13965]
          Length = 166

 Score =  144 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 48/162 (29%), Positives = 80/162 (49%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG G I  I+E+EV G +  ++++      M L +P   A   G+R +
Sbjct: 1   MFQVGDRVVYPMHGAGVIEAIEEREVLGERHRYYILRLPVGDMRLMIPTASAPQSGLRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
             A  V   L+ +        + W+ R +E+  K+ SGD++ +A VVR+L         S
Sbjct: 61  IPADQVPAVLEALCEPVPPLDSNWNHRYREHADKLRSGDILEVAVVVRNLSARQKARGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
             ER+L + A   +V E+A    +   EA  L+E +L +   
Sbjct: 121 GGERRLLDQARQILVSELALAGGMGRDEADALVERHLGAAEP 162


>gi|56696304|ref|YP_166661.1| CarD family transcriptional regulator [Ruegeria pomeroyi DSS-3]
 gi|56678041|gb|AAV94707.1| transcriptional regulator, CarD family [Ruegeria pomeroyi DSS-3]
          Length = 169

 Score =  144 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 101/174 (58%), Positives = 130/174 (74%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  +++VYPAHGVG I  I+EQEVAG KLE FVI+F+KDKM L+VP
Sbjct: 1   MTKSKK-----LEFRPNDYVVYPAHGVGQILSIEEQEVAGFKLELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA + G+R LS    + +A+K ++GKA+VKR MWSRRAQEY+ KINSGDLI+IAEVVR
Sbjct: 56  TNKATESGLRSLSSPDVISQAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLISIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L+S+++
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVSGADEMAAAKQVDEVLTSRAA 169


>gi|108801703|ref|YP_641900.1| CarD family transcriptional regulator [Mycobacterium sp. MCS]
 gi|119870854|ref|YP_940806.1| CarD family transcriptional regulator [Mycobacterium sp. KMS]
 gi|126437690|ref|YP_001073381.1| CarD family transcriptional regulator [Mycobacterium sp. JLS]
 gi|108772122|gb|ABG10844.1| transcriptional regulator, CarD family [Mycobacterium sp. MCS]
 gi|119696943|gb|ABL94016.1| transcriptional regulator, CarD family [Mycobacterium sp. KMS]
 gi|126237490|gb|ABO00891.1| transcriptional regulator, CarD family [Mycobacterium sp. JLS]
          Length = 162

 Score =  144 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 45/160 (28%), Positives = 87/160 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPADNAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A   ++ + +A  +++  L++ S
Sbjct: 123 GEKRMLAKARQILVGELALAENVEDEKATIILDEALAAAS 162


>gi|317126037|ref|YP_004100149.1| CarD family transcriptional regulator [Intrasporangium calvum DSM
           43043]
 gi|315590125|gb|ADU49422.1| transcriptional regulator, CarD family [Intrasporangium calvum DSM
           43043]
          Length = 160

 Score =  144 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 81/158 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I EI  + + G    +  +   +  + ++VP      +G+R + 
Sbjct: 3   FKVGETVVYPHHGAALIEEINTRTIKGEDKLYLKLKVAQGDLTIEVPAENCDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+I +AEVVRDL R D     S 
Sbjct: 63  GQEGLDRVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLWRRDQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E +A ++++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAEKTDEDKAESILDEVLAS 160


>gi|111225860|ref|YP_716654.1| putative CarD-like transcriptional regulator [Frankia alni ACN14a]
 gi|111153392|emb|CAJ65148.1| putative CarD-like transcriptional regulator [Frankia alni ACN14a]
          Length = 160

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I  I+ + + G +  + V+   +  + ++VP      +G+R + 
Sbjct: 3   FQVGETVVYPHHGAALIDAIETRVIKGEERLYLVLKVAQGDLTVRVPADNVGMVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +ER  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQDGLERVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDRERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            E+++   A   +V E+A     +E +A  +++  L+
Sbjct: 123 GEKRMLSKARQILVSELALAEGTNEDKAEAMLDEVLA 159


>gi|84687443|ref|ZP_01015321.1| transcriptional regulator, CarD family protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664601|gb|EAQ11087.1| transcriptional regulator, CarD family protein [Rhodobacterales
           bacterium HTCC2654]
          Length = 169

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 101/174 (58%), Positives = 129/174 (74%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M+  +K       FR  E++VYPAHGVG I  I+EQEVAG+ LE FVI+F+KDKM L+VP
Sbjct: 1   MSKAKK-----LDFRPNEYVVYPAHGVGQIVSIEEQEVAGLTLELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA ++GMR LS    V +A+  ++GKARVKR MWSRRAQEY+ KINSGDLI+IAEVVR
Sbjct: 56  TNKATEVGMRSLSSPDVVSKAMDTLKGKARVKRAMWSRRAQEYEQKINSGDLISIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHR D Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L+S+++
Sbjct: 116 DLHRNDDQREQSYSERQLYEAALERLTREVAAVSGGDEAAAQEKVDGVLTSRAA 169


>gi|220921710|ref|YP_002497011.1| CarD family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219946316|gb|ACL56708.1| transcriptional regulator, CarD family [Methylobacterium nodulans
           ORS 2060]
          Length = 197

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 116/187 (62%), Positives = 151/187 (80%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K  A RQGF+TGE IVYPAHGVG IT I+EQE+AG KLE FV++F+KDKM L+VP
Sbjct: 1   MTTAKKTTAARQGFKTGEAIVYPAHGVGRITAIEEQEIAGYKLELFVVSFEKDKMVLRVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA  +GMRKL+E   V++AL ++ G+ARVKRTMWSRRAQEY+AKINSGDLIA+ EVVR
Sbjct: 61  TAKANAVGMRKLAEPELVKKALDVLTGRARVKRTMWSRRAQEYEAKINSGDLIAVTEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R+++QPE+SYSERQLYE+AL+R+VREIAAVN I++ E++ LIE +L+    + + + 
Sbjct: 121 DLYRSEAQPEQSYSERQLYEAALDRVVREIAAVNKITDTESLKLIEQSLAKSPRRAKSAE 180

Query: 181 SENQDKA 187
            E +  A
Sbjct: 181 VEGEPDA 187


>gi|260434064|ref|ZP_05788035.1| transcriptional regulator, CarD family [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417892|gb|EEX11151.1| transcriptional regulator, CarD family [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 169

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 101/174 (58%), Positives = 131/174 (75%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M+  +K       FR  + +VYPAHGVG I  I+EQEVAG KLE FVI+F+KDKM L+VP
Sbjct: 1   MSKSKK-----LEFRPNDFVVYPAHGVGKIISIEEQEVAGFKLELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA + G+R LS    +++A+K +RGKA+VKR MWSRRAQEY+ KINSGDLI+IAEVVR
Sbjct: 56  TNKATESGLRSLSTPDVIDQAMKTLRGKAKVKRAMWSRRAQEYEQKINSGDLISIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHRTD Q E+SYSERQLYE+AL+R+ RE+AAV+   E  A   ++  L+S+++
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALDRLTREVAAVSGADEIAAAKQVDEVLTSRAA 169


>gi|119384562|ref|YP_915618.1| CarD family transcriptional regulator [Paracoccus denitrificans
           PD1222]
 gi|119374329|gb|ABL69922.1| transcriptional regulator, CarD family [Paracoccus denitrificans
           PD1222]
          Length = 169

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 101/174 (58%), Positives = 131/174 (75%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M+  +K       FR  + +VYP HGVG I  I+EQEVAG++LE FVI+F+KDKM L+VP
Sbjct: 1   MSKAKK-----TEFRPDDFVVYPTHGVGRIVSIEEQEVAGLRLEMFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +A +IGMR LS    VERAL  ++GKARVKR MWSRRAQEY+ KINSGDL++IAEVVR
Sbjct: 56  TARATEIGMRGLSTPDLVERALDTLKGKARVKRAMWSRRAQEYEQKINSGDLMSIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHR D Q E+SYSERQLYE+AL+R+ RE+AAV+ + E  A   +E  L+++++
Sbjct: 116 DLHRNDDQREQSYSERQLYEAALDRLTREVAAVSGMDEAGAQKRVETVLTARAA 169


>gi|331699819|ref|YP_004336058.1| CarD family transcriptional regulator [Pseudonocardia dioxanivorans
           CB1190]
 gi|326954508|gb|AEA28205.1| transcriptional regulator, CarD family [Pseudonocardia
           dioxanivorans CB1190]
          Length = 164

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/160 (28%), Positives = 83/160 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I  I+ + + G + ++ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGETVVYPHHGAALIEAIETRTIKGEERKYLVLKVAQGDLTVRVPAENAEVVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  GQEGLDRVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRREKDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A      E  A  L++  L++ +
Sbjct: 123 GEKRMLAKARQILVSELALAEGTDEERAEVLLDEVLATAA 162


>gi|254511434|ref|ZP_05123501.1| transcriptional regulator, CarD family [Rhodobacteraceae bacterium
           KLH11]
 gi|221535145|gb|EEE38133.1| transcriptional regulator, CarD family [Rhodobacteraceae bacterium
           KLH11]
          Length = 170

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 97/174 (55%), Positives = 128/174 (73%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M+  +K       FR  +++VYPAHGVG I  I+EQ+VAG  LE FVI+F+KDKM L+VP
Sbjct: 1   MSKSKK-----LEFRPNDYVVYPAHGVGQIISIEEQDVAGFSLELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K  + G+R LS    + +A+K ++GKA+VKR MWSRRAQEY+ KINSGDLI+IAEVVR
Sbjct: 56  TNKVTESGLRSLSSPDVISQAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLISIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L+S+++
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVSGADEISAAKQVDEVLTSRAA 169


>gi|146337765|ref|YP_001202813.1| CarD family transcriptional regulator [Bradyrhizobium sp. ORS278]
 gi|146190571|emb|CAL74573.1| putative transcriptional regulatory protein, CarD family
           [Bradyrhizobium sp. ORS278]
          Length = 204

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 106/179 (59%), Positives = 138/179 (77%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
              RQGF+T E +VYPAHGVG I  I+EQE+AG KLE FVI F KDKM L+VP  K  ++
Sbjct: 2   PTQRQGFKTNEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFIKDKMTLRVPTAKVANV 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMRKLS+   V++AL+ ++G+ARVKRTMWSRRAQEY+AKINSGD++AIAEVVRDL+R++S
Sbjct: 62  GMRKLSDPALVKKALETLKGRARVKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLYRSES 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDK 186
           QPE+SYSERQLYE+AL+R+ REIA V   +E EA+  IE  L+    +  K+ ++   +
Sbjct: 122 QPEQSYSERQLYEAALDRLSREIAVVQHSTETEAVKEIETQLAKSPRRGAKTEADAVAE 180


>gi|89055799|ref|YP_511250.1| CarD family transcriptional regulator [Jannaschia sp. CCS1]
 gi|88865348|gb|ABD56225.1| transcriptional regulator, CarD family [Jannaschia sp. CCS1]
          Length = 172

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 101/172 (58%), Positives = 124/172 (72%), Gaps = 4/172 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       F   +++VYPAHGVG I  I+EQEVAG+ LE FVI+F+KDKM L+VP
Sbjct: 1   MTKARKT----LDFSPNDYVVYPAHGVGQIITIEEQEVAGLNLELFVISFEKDKMTLRVP 56

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA ++GMR LS+   V +AL  ++GKARVKR MWSRRAQEY+ KINSGDLI+IAEVVR
Sbjct: 57  TAKATEVGMRPLSDPTVVSKALDTLKGKARVKRAMWSRRAQEYEQKINSGDLISIAEVVR 116

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           DLHR D Q E+SYSERQLYE+AL R+ RE+A V  I E  A   +   LS +
Sbjct: 117 DLHRADDQREQSYSERQLYEAALERLTRELAVVKGIDEAGAGAQLVDVLSKR 168


>gi|163738513|ref|ZP_02145928.1| transcriptional regulator, CarD family protein [Phaeobacter
           gallaeciensis BS107]
 gi|163743575|ref|ZP_02150952.1| transcriptional regulator, CarD family protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161383160|gb|EDQ07552.1| transcriptional regulator, CarD family protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161388434|gb|EDQ12788.1| transcriptional regulator, CarD family protein [Phaeobacter
           gallaeciensis BS107]
          Length = 170

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 101/174 (58%), Positives = 128/174 (73%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  +++VYPAHGVG I  I+EQEVAG  LE FVI F+KDKM L+VP
Sbjct: 1   MTKSKK-----PEFRPDDYVVYPAHGVGQIISIEEQEVAGFALELFVITFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA +IGMR LS    + +A+  ++GKA+VKR MWSRRAQEY+ KINSGDLI+IAEVVR
Sbjct: 56  TNKATEIGMRSLSSPDVIAKAMTTLKGKAKVKRAMWSRRAQEYEQKINSGDLISIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L+S+++
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVSGGDEISAAKQVDEVLTSRAA 169


>gi|134097051|ref|YP_001102712.1| transcription regulator CarD [Saccharopolyspora erythraea NRRL
           2338]
 gi|291007008|ref|ZP_06564981.1| transcription regulator CarD [Saccharopolyspora erythraea NRRL
           2338]
 gi|133909674|emb|CAL99786.1| CarD family transcriptional regulator [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 162

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 82/159 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I  I+ + + G + ++ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGETVVYPHHGAALIEAIETRVIKGEEKQYLVLKVAQGDLTVRVPADNAEIVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R   ++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  GQEGLDRVFDVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRREKDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            E+++   A   +V E+A      E +A  L++  L++ 
Sbjct: 123 GEKRMLAKARQILVSELALAEGTDEGKAETLLDEVLATA 161


>gi|284989246|ref|YP_003407800.1| CarD family transcriptional regulator [Geodermatophilus obscurus
           DSM 43160]
 gi|284062491|gb|ADB73429.1| transcriptional regulator, CarD family [Geodermatophilus obscurus
           DSM 43160]
          Length = 160

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/159 (30%), Positives = 82/159 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
           GF  GE +VYP HG   I  I+ + + G +  + V+   +  + ++VP   A  +G+R +
Sbjct: 2   GFTVGETVVYPHHGAALIEAIETRVIKGEERAYLVLKVAQGDLTVRVPADNAEIVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                + R  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGQDGLNRVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDKDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E+++   A   +V E+A     +E +A  L++  L+S
Sbjct: 122 AGEKRMLSKARQILVSELALAEGTNEDKAEVLLDEVLAS 160


>gi|224992000|ref|YP_002646689.1| putative transcription factor [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|224775115|dbj|BAH27921.1| putative transcription factor [Mycobacterium bovis BCG str. Tokyo
           172]
          Length = 162

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 45/160 (28%), Positives = 86/160 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   +  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPRHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A   S  + +A  +++  L++ S
Sbjct: 123 GEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS 162


>gi|257057465|ref|YP_003135297.1| transcriptional regulator, CarD family [Saccharomonospora viridis
           DSM 43017]
 gi|256587337|gb|ACU98470.1| transcriptional regulator, CarD family [Saccharomonospora viridis
           DSM 43017]
          Length = 163

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 80/159 (50%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I  I+ + + G + ++ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGETVVYPHHGAALIEAIETRVIKGEEKQYLVLKVAQGDLTVRVPADNAEIVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               + R   ++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  GQEGLNRVFDVLRAPHTDEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRREKDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            E+++   A   +V E+A      E +A  L++  L + 
Sbjct: 123 GEKRMLAKARQILVSELALAEGTDESKAEVLLDEVLETA 161


>gi|312194274|ref|YP_004014335.1| CarD family transcriptional regulator [Frankia sp. EuI1c]
 gi|311225610|gb|ADP78465.1| transcriptional regulator, CarD family [Frankia sp. EuI1c]
          Length = 160

 Score =  143 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I  I+ + + G +  + V+   +  + ++VP      +G+R + 
Sbjct: 3   FQVGETVVYPHHGAALIDAIETRVIKGEEKLYLVLKVAQGDLTVRVPADNIGMVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +ER  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQDGLERVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDRERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            E+++   A   +V E+A     +E +A  +++  L+
Sbjct: 123 GEKRMLSKARQILVSELALAEGTNEDKAEAMLDEVLA 159


>gi|86742930|ref|YP_483330.1| CarD family transcriptional regulator [Frankia sp. CcI3]
 gi|158312226|ref|YP_001504734.1| CarD family transcriptional regulator [Frankia sp. EAN1pec]
 gi|288923580|ref|ZP_06417692.1| transcriptional regulator, CarD family [Frankia sp. EUN1f]
 gi|289642338|ref|ZP_06474486.1| transcriptional regulator, CarD family [Frankia symbiont of Datisca
           glomerata]
 gi|86569792|gb|ABD13601.1| transcriptional regulator, CarD family [Frankia sp. CcI3]
 gi|158107631|gb|ABW09828.1| transcriptional regulator, CarD family [Frankia sp. EAN1pec]
 gi|288345079|gb|EFC79496.1| transcriptional regulator, CarD family [Frankia sp. EUN1f]
 gi|289507870|gb|EFD28821.1| transcriptional regulator, CarD family [Frankia symbiont of Datisca
           glomerata]
          Length = 160

 Score =  143 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I  I+ + + G +  + V+   +  + ++VP      +G+R + 
Sbjct: 3   FQVGETVVYPHHGAALIDAIETRVIKGEEKLYLVLKVAQGDLTVRVPADNVGMVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +ER  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQDGLERVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDRERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            E+++   A   +V E+A     +E +A  +++  L+
Sbjct: 123 GEKRMLSKARQILVSELALAEGTNEDKAEAMLDEVLA 159


>gi|327191760|gb|EGE58762.1| CarD family transcriptional regulator [Rhizobium etli CNPAF512]
          Length = 199

 Score =  143 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 132/189 (69%), Positives = 155/189 (82%), Gaps = 1/189 (0%)

Query: 1   MTFQQKR-DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           MT QQK+    R GF+TGE IVYPAHGVGTIT I+EQEVAGMKLE FVI F+KDKM LKV
Sbjct: 10  MTTQQKKPSTARHGFKTGESIVYPAHGVGTITAIEEQEVAGMKLELFVIDFEKDKMRLKV 69

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV KA+ IGMRKLSE  FV+RALK+V+GKARVKRTMWSRRAQEYDAKINSGDLI+IAEVV
Sbjct: 70  PVAKAMSIGMRKLSETDFVDRALKVVQGKARVKRTMWSRRAQEYDAKINSGDLISIAEVV 129

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ L+E NL+    + +  
Sbjct: 130 RDLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKMSETEAVRLVETNLNKGPKRGKAI 189

Query: 180 TSENQDKAA 188
             ++    A
Sbjct: 190 EEDDSQDEA 198


>gi|148258713|ref|YP_001243298.1| CarD family transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146410886|gb|ABQ39392.1| transcriptional regulator, CarD family [Bradyrhizobium sp. BTAi1]
          Length = 278

 Score =  143 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 107/183 (58%), Positives = 141/183 (77%)

Query: 4   QQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGK 63
           ++K    RQGF+T E +VYPAHGVG I  I+EQE+AG KLE FVI F KDKM L+VP  K
Sbjct: 72  EKKLPTQRQGFKTNEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFIKDKMTLRVPTAK 131

Query: 64  AIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLH 123
             ++GMRKLS+   V++AL+ ++G+ARVKRTMWSRRAQEY+AKINSGD++AIAEVVRDL+
Sbjct: 132 VANVGMRKLSDPALVKKALETLKGRARVKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLY 191

Query: 124 RTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSEN 183
           R++SQPE+SYSERQLYE+AL+R+ REIA V   +E EA+  IE  L+    +  K+ ++ 
Sbjct: 192 RSESQPEQSYSERQLYEAALDRLSREIAVVQHSTETEAVKEIETQLAKSPRRGAKTEADA 251

Query: 184 QDK 186
             +
Sbjct: 252 VAE 254


>gi|190893877|ref|YP_001980419.1| transcriptional regulator protein, CarD family [Rhizobium etli CIAT
           652]
 gi|190699156|gb|ACE93241.1| probable transcriptional regulator protein, CarD family [Rhizobium
           etli CIAT 652]
          Length = 190

 Score =  143 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 130/189 (68%), Positives = 155/189 (82%), Gaps = 1/189 (0%)

Query: 1   MTFQQKR-DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           MT QQK+    R GF+TGE IVYPAHGVGTIT I+EQEVAGMKLE FVI F+KDKM LKV
Sbjct: 1   MTTQQKKPSTARHGFKTGESIVYPAHGVGTITAIEEQEVAGMKLELFVIDFEKDKMRLKV 60

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV KA+ IGMRKLSE  FV+RALK+V+GKARVKRTMWSRRAQEYDAKINSGDLI+IAEVV
Sbjct: 61  PVAKAMSIGMRKLSETDFVDRALKVVQGKARVKRTMWSRRAQEYDAKINSGDLISIAEVV 120

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL+R ++QPE+SYSERQLYE+AL+ M REIAAVN++SE +A+ L+E NL+    + +  
Sbjct: 121 RDLYRAENQPEQSYSERQLYEAALDSMAREIAAVNNMSETDAVRLVETNLNKGPKRGKAI 180

Query: 180 TSENQDKAA 188
             ++    A
Sbjct: 181 EEDDSQDEA 189


>gi|254563203|ref|YP_003070298.1| carD family transcriptional regulator [Methylobacterium extorquens
           DM4]
 gi|254270481|emb|CAX26481.1| transcriptional regulator, CarD family [Methylobacterium extorquens
           DM4]
          Length = 224

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 113/196 (57%), Positives = 151/196 (77%), Gaps = 8/196 (4%)

Query: 1   MTFQQKRDAM-RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           MT  +K     RQGF+TGE +VYPAHGVG IT I+EQE+AG KLE FV++F+KDKM L+V
Sbjct: 29  MTTAKKTTVAGRQGFKTGEAVVYPAHGVGRITAIEEQEIAGYKLELFVVSFEKDKMVLRV 88

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           P  KA  +GMRKL+E   V++AL ++ G+AR+KRTMWSRRAQEY+AKINSGDLI++ EVV
Sbjct: 89  PTAKANSVGMRKLAEPELVKKALDVLTGRARIKRTMWSRRAQEYEAKINSGDLISVTEVV 148

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL R+++QPE+SYSERQLYE+AL+R+VREI++VN I+E EA+ LIE +L+    + +  
Sbjct: 149 RDLFRSEAQPEQSYSERQLYEAALDRVVREISSVNKITETEALKLIEQSLAKSPRRAKAD 208

Query: 180 -------TSENQDKAA 188
                    + Q++AA
Sbjct: 209 AEADAEGEDDVQEEAA 224


>gi|149202302|ref|ZP_01879275.1| transcriptional regulator, CarD family protein [Roseovarius sp.
           TM1035]
 gi|149144400|gb|EDM32431.1| transcriptional regulator, CarD family protein [Roseovarius sp.
           TM1035]
          Length = 169

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 98/167 (58%), Positives = 126/167 (75%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
              +  FR  +++VYPAHGVG I  I+EQE+AG+ LE FVI+F+KDKM L+VP  KA +I
Sbjct: 3   KTKKSEFRPDDYVVYPAHGVGQIVSIEEQEIAGITLELFVISFEKDKMTLRVPTNKATEI 62

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMR LS    V +A+  ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVRDLHR+D 
Sbjct: 63  GMRGLSSPDVVSKAMSTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVRDLHRSDD 122

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L S+++
Sbjct: 123 QREQSYSERQLYEAALERLTREVAAVSGGDEVLAARKVDEVLVSRAA 169


>gi|319948870|ref|ZP_08022983.1| CarD family transcriptional regulator [Dietzia cinnamea P4]
 gi|319437472|gb|EFV92479.1| CarD family transcriptional regulator [Dietzia cinnamea P4]
          Length = 164

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 50/162 (30%), Positives = 85/162 (52%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG  TI  I+ + V G + E+ V+   +  + +KVP   A  +G+R +
Sbjct: 2   EFKVGDTVVYPHHGAATIQAIEMRTVRGTEKEYLVLKVSQGDLTVKVPAENAEYVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +++  +++R +   + T WSRR +    K+ SGD+  +AEVVRDL R D     S
Sbjct: 62  VDQAGLDKVFEVLRTEHAEEPTNWSRRYKANGEKLASGDVNKVAEVVRDLWRRDLDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
             E+++   A   +V E+A      E  A  L++  L S + 
Sbjct: 122 AGEKRMLAKARQVLVGELALAERSDEERADALLDEVLGSAAP 163


>gi|325294135|ref|YP_004279999.1| transcriptional regulator, CarD family [Agrobacterium sp. H13-3]
 gi|325061988|gb|ADY65679.1| transcriptional regulator, CarD family [Agrobacterium sp. H13-3]
          Length = 189

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 133/188 (70%), Positives = 156/188 (82%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT QQK+     GF+TGE IVYPAHGVGTI+ I+EQEVAGMKLE FVI F+KDKM LKVP
Sbjct: 1   MTTQQKKSPAHHGFKTGEAIVYPAHGVGTISAIEEQEVAGMKLELFVIDFEKDKMRLKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA+ IGMRKLSE  FVERALK+V+GKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR
Sbjct: 61  VAKAVSIGMRKLSEGDFVERALKVVQGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ L+EVNL+    + +   
Sbjct: 121 DLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKMSETEAVRLVEVNLAKGPKRGKAVE 180

Query: 181 SENQDKAA 188
            ++  + A
Sbjct: 181 EDDSQEEA 188


>gi|319781058|ref|YP_004140534.1| transcription factor CarD [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166946|gb|ADV10484.1| transcription factor CarD [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 193

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 129/179 (72%), Positives = 149/179 (83%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +T Q+K  A R GF+TGE+IVYPAHGVG I  I EQEVAG KLE FVI F KDKM LKVP
Sbjct: 4   ITPQKKSTAARHGFKTGEYIVYPAHGVGQIVSIDEQEVAGHKLELFVIDFSKDKMRLKVP 63

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA  IGMRKLSE  +VERALK+V+G+ARVKRTMWSRRAQEYDAKINSGDLI+I+EVVR
Sbjct: 64  VAKATSIGMRKLSEEDYVERALKVVQGRARVKRTMWSRRAQEYDAKINSGDLISISEVVR 123

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           DL+R D+QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ LIEVNL+    +  K+
Sbjct: 124 DLYRADNQPEQSYSERQLYEAALDRMAREIAAVNRMSETEAVRLIEVNLNKGPKRGAKA 182


>gi|144899571|emb|CAM76435.1| Transcription factor CarD-like [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 164

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 86/160 (53%), Positives = 118/160 (73%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+++VYP HGVG +  I+ QE+ GMKL+ FVI F++D+M L+VPV KA   G+RKL
Sbjct: 5   SFAEGDYVVYPTHGVGQVMAIENQEIGGMKLQLFVITFERDRMTLRVPVAKATKSGLRKL 64

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           S    ++ AL  ++G+A+VKRTMWSRRAQEY+AKINSGD ++IAEVVRDL+R  +QP++S
Sbjct: 65  SSRKDMDTALSTLKGRAKVKRTMWSRRAQEYEAKINSGDPVSIAEVVRDLYRNANQPDQS 124

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           YSERQ+YE+AL R+  E+AAV  I    A   +   L++ 
Sbjct: 125 YSERQIYEAALERLAAELAAVEGIDAEAAAAKLCELLAAA 164


>gi|159043338|ref|YP_001532132.1| transcriptional regulator [Dinoroseobacter shibae DFL 12]
 gi|157911098|gb|ABV92531.1| transcriptional regulator [Dinoroseobacter shibae DFL 12]
          Length = 170

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 101/168 (60%), Positives = 125/168 (74%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +      FR  E++VYPAHGVG I  I+EQEVAG+ LE FVI+F+KDKM L+VP  KA +
Sbjct: 3   KANKSNEFRPNEYVVYPAHGVGQIVSIEEQEVAGLTLELFVISFEKDKMTLRVPTNKATE 62

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +GMR LS    V +A+  ++GKARVKR MWSRRAQEY+ KINSGDLIAIAEVVRDLHR D
Sbjct: 63  VGMRSLSSPDIVSKAMDTLKGKARVKRAMWSRRAQEYEQKINSGDLIAIAEVVRDLHRND 122

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            Q E+SYSERQLYE+AL R+ REIAAV+   E  A   ++  L S+++
Sbjct: 123 DQREQSYSERQLYEAALERLTREIAAVSGDDEGNAQKRVDDVLVSRAA 170


>gi|27375267|ref|NP_766796.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27348403|dbj|BAC45421.1| bll0156 [Bradyrhizobium japonicum USDA 110]
          Length = 328

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 108/185 (58%), Positives = 140/185 (75%)

Query: 4   QQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGK 63
           ++K    RQGF+  E +VYPAHGVG I  I+EQE+AG KLE FVI F KDKM L+VP  K
Sbjct: 125 EKKVVTQRQGFKANEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFIKDKMTLRVPTAK 184

Query: 64  AIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLH 123
             ++GMRKLSE   V++AL+ ++G+ARVKRTMWSRRAQEY+AKINSGD++AIAEVVRDL+
Sbjct: 185 VANVGMRKLSEPALVKKALETLKGRARVKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLY 244

Query: 124 RTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSEN 183
           R++SQPE+SYSERQLYE+AL+R+ REIA V   +E EA+  IE  L+    +  K+ +  
Sbjct: 245 RSESQPEQSYSERQLYEAALDRLSREIAVVQHSTETEAVKEIEAQLAKSPRRNAKAEATE 304

Query: 184 QDKAA 188
            +  A
Sbjct: 305 GEADA 309


>gi|86359604|ref|YP_471496.1| CarD family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86283706|gb|ABC92769.1| probable transcriptional regulator protein, CarD family [Rhizobium
           etli CFN 42]
          Length = 190

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 132/189 (69%), Positives = 155/189 (82%), Gaps = 1/189 (0%)

Query: 1   MTFQQKR-DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           MT QQK+    R GF+TGE IVYPAHGVGTIT I+EQEVAGMKLE FVI F+KDKM LKV
Sbjct: 1   MTTQQKKPSTARHGFKTGESIVYPAHGVGTITAIEEQEVAGMKLELFVIDFEKDKMRLKV 60

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV KA+ IGMRKLSE  FV+RALK+V+GKARVKRTMWSRRAQEYDAKINSGDLI+IAEVV
Sbjct: 61  PVAKAMSIGMRKLSETDFVDRALKVVQGKARVKRTMWSRRAQEYDAKINSGDLISIAEVV 120

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ L+E NL+    + +  
Sbjct: 121 RDLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKMSETEAVRLVETNLNKGPKRGKAI 180

Query: 180 TSENQDKAA 188
             ++    A
Sbjct: 181 EEDDSQDEA 189


>gi|300790484|ref|YP_003770775.1| CarD family transcriptional regulator [Amycolatopsis mediterranei
           U32]
 gi|299799998|gb|ADJ50373.1| CarD family transcriptional regulator [Amycolatopsis mediterranei
           U32]
          Length = 163

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 45/159 (28%), Positives = 81/159 (50%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I  I+ + + G + ++ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGETVVYPHHGAALIEAIETRVIKGEEKKYLVLKVAQGDLTVRVPADNAEIVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++   ++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  GQEGLDKVFDVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRREKDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            E+++   A   +V E+A      E +A  L++  L + 
Sbjct: 123 GEKRMLAKARQILVSELALAEGTDEDKAEVLLDEVLETA 161


>gi|260426540|ref|ZP_05780519.1| transcriptional regulator, CarD family [Citreicella sp. SE45]
 gi|260421032|gb|EEX14283.1| transcriptional regulator, CarD family [Citreicella sp. SE45]
          Length = 170

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 102/169 (60%), Positives = 128/169 (75%), Gaps = 4/169 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT + K++     FR  +++VYPAHGVG I  I+EQE+AG+KLE FVI+F+KDKM L+VP
Sbjct: 1   MTTKTKKN----EFRPNDYVVYPAHGVGQIVLIEEQEIAGIKLELFVISFEKDKMTLRVP 56

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA +IGMR LS    V +A+K ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 57  THKASEIGMRSLSSPDVVSQAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVR 116

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
           DLHR D Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L
Sbjct: 117 DLHRADDQREQSYSERQLYEAALERLTREVAAVSGGDEVAAARQVDEVL 165


>gi|256374519|ref|YP_003098179.1| CarD family transcriptional regulator [Actinosynnema mirum DSM
           43827]
 gi|255918822|gb|ACU34333.1| transcriptional regulator, CarD family [Actinosynnema mirum DSM
           43827]
          Length = 162

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 46/160 (28%), Positives = 84/160 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I  I+ + + G + ++ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGETVVYPHHGAALIEAIETRVIKGEEKKYLVLKVAQGDLTVRVPADNAEIVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  GQEGLDKVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRREKDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A      E +A  L++  L++ S
Sbjct: 123 GEKRMLAKARQILVSELALAEGTDEDKAEVLLDEVLATAS 162


>gi|15890014|ref|NP_355695.1| CarD family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|15157987|gb|AAK88480.1| transcriptional regulator, CarD family [Agrobacterium tumefaciens
           str. C58]
          Length = 189

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 133/188 (70%), Positives = 155/188 (82%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT QQK+     GF+TGE IVYPAHGVGTI+ I+EQEVAGMKLE FVI F+KDKM LKVP
Sbjct: 1   MTTQQKKSPAHHGFKTGEAIVYPAHGVGTISAIEEQEVAGMKLELFVIDFEKDKMRLKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA+ IGMRKLSE  FVERALK+V+GKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR
Sbjct: 61  VAKAVSIGMRKLSEGDFVERALKVVQGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ L+EVNL+    + +   
Sbjct: 121 DLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKMSETEAVRLVEVNLAKGPKRGKTVE 180

Query: 181 SENQDKAA 188
            ++    A
Sbjct: 181 EDDSQDEA 188


>gi|77462983|ref|YP_352487.1| CarD family transcriptional regulator [Rhodobacter sphaeroides
           2.4.1]
 gi|126461857|ref|YP_001042971.1| CarD family transcriptional regulator [Rhodobacter sphaeroides ATCC
           17029]
 gi|146277597|ref|YP_001167756.1| CarD family transcriptional regulator [Rhodobacter sphaeroides ATCC
           17025]
 gi|221638839|ref|YP_002525101.1| CarD family transcriptional regulator [Rhodobacter sphaeroides
           KD131]
 gi|332557859|ref|ZP_08412181.1| Transcriptional regulator, CarD family protein [Rhodobacter
           sphaeroides WS8N]
 gi|77387401|gb|ABA78586.1| transcriptional regulator, CarD family [Rhodobacter sphaeroides
           2.4.1]
 gi|126103521|gb|ABN76199.1| transcriptional regulator, CarD family [Rhodobacter sphaeroides
           ATCC 17029]
 gi|145555838|gb|ABP70451.1| transcriptional regulator, CarD family [Rhodobacter sphaeroides
           ATCC 17025]
 gi|221159620|gb|ACM00600.1| Transcriptional regulator, CarD family [Rhodobacter sphaeroides
           KD131]
 gi|332275571|gb|EGJ20886.1| Transcriptional regulator, CarD family protein [Rhodobacter
           sphaeroides WS8N]
          Length = 169

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 102/174 (58%), Positives = 130/174 (74%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  E +VYPAHGVG I  I+EQE+AG++LE FVI+F+KDKM L+VP
Sbjct: 1   MTKTKK-----PEFRPNEFVVYPAHGVGRIISIEEQEIAGIRLELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA ++GMR LS    V +AL  ++GKARVKR MWSRRAQEY+ KINSGDL++IAEVVR
Sbjct: 56  THKATEVGMRSLSTPDVVTKALDTLKGKARVKRAMWSRRAQEYEQKINSGDLMSIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV+ + E  A   ++  L S+++
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVSGVDEAGAQKAVDAVLVSRAA 169


>gi|254463989|ref|ZP_05077400.1| transcriptional regulator, CarD family [Rhodobacterales bacterium
           Y4I]
 gi|206684897|gb|EDZ45379.1| transcriptional regulator, CarD family [Rhodobacterales bacterium
           Y4I]
          Length = 169

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 102/174 (58%), Positives = 130/174 (74%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  +++VYPAHGVG I  I+EQEVAG  LE FVI F+KDKM L+VP
Sbjct: 1   MTKSKK-----LEFRPDDYVVYPAHGVGQIISIEEQEVAGFALELFVITFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA ++GMR LS    +E+A+K ++GKA+VKR MWSRRAQEY+ KINSGDLI+IAEVVR
Sbjct: 56  TNKATEVGMRSLSSPDVIEQAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLISIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L+S+++
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVSGNDEIAAAKQVDEVLTSRAA 169


>gi|288957083|ref|YP_003447424.1| transcriptional regulator [Azospirillum sp. B510]
 gi|288909391|dbj|BAI70880.1| transcriptional regulator [Azospirillum sp. B510]
          Length = 166

 Score =  142 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 82/165 (49%), Positives = 122/165 (73%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           + +  F  G+ +VYPAHGVG +  I+   +AG++++ + I F+K++M LKVPV KA + G
Sbjct: 2   SNKLDFDAGDFVVYPAHGVGRVEGIETHSIAGLEVQLYAITFEKERMTLKVPVTKARNAG 61

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           +R+LS    ++ AL+ ++G++RV+RTMWSRRAQEY+AKINSGD ++IAEVVRDL+R   Q
Sbjct: 62  LRRLSSKDRIKVALETLQGRSRVRRTMWSRRAQEYEAKINSGDPVSIAEVVRDLYRGADQ 121

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            ++SYSERQ+Y++AL R+ RE+AAV  I E +A   +E  LS  +
Sbjct: 122 SDQSYSERQIYQAALERLARELAAVEKIDETKATERLESVLSKAA 166


>gi|302530715|ref|ZP_07283057.1| transcription regulator CarD [Streptomyces sp. AA4]
 gi|302439610|gb|EFL11426.1| transcription regulator CarD [Streptomyces sp. AA4]
          Length = 163

 Score =  142 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 45/159 (28%), Positives = 81/159 (50%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I  I+ + + G + ++ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGETVVYPHHGAALIEAIETRVIKGEEKKYLVLKVAQGDLTVRVPADNAEIVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++   ++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  GQEGLDKVFDVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRREKDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            E+++   A   +V E+A      E +A  L++  L + 
Sbjct: 123 GEKRMLAKARQILVSELALAEGTDEGKAETLLDEVLETA 161


>gi|13473303|ref|NP_104870.1| transcriptional factor regulator [Mesorhizobium loti MAFF303099]
 gi|260461457|ref|ZP_05809704.1| transcriptional regulator, CarD family [Mesorhizobium opportunistum
           WSM2075]
 gi|14024051|dbj|BAB50656.1| transcriptional factor regulator [Mesorhizobium loti MAFF303099]
 gi|259032527|gb|EEW33791.1| transcriptional regulator, CarD family [Mesorhizobium opportunistum
           WSM2075]
          Length = 193

 Score =  142 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 128/179 (71%), Positives = 148/179 (82%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +T Q+K    R GF+TGE+IVYPAHGVG I  I EQEVAG KLE FVI F KDKM LKVP
Sbjct: 4   ITPQKKSTGARHGFKTGEYIVYPAHGVGQIVSIDEQEVAGHKLELFVIDFQKDKMRLKVP 63

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA  IGMRKLSE  +VERALK+V+G+ARVKRTMWSRRAQEYDAKINSGDLI+I+EVVR
Sbjct: 64  VAKATSIGMRKLSEEDYVERALKVVQGRARVKRTMWSRRAQEYDAKINSGDLISISEVVR 123

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           DL+R D+QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ LIEVNL+    +  K+
Sbjct: 124 DLYRADNQPEQSYSERQLYEAALDRMAREIAAVNRMSETEAVRLIEVNLNKGPKRGAKA 182


>gi|269124964|ref|YP_003298334.1| CarD family transcriptional regulator [Thermomonospora curvata DSM
           43183]
 gi|268309922|gb|ACY96296.1| transcriptional regulator, CarD family [Thermomonospora curvata DSM
           43183]
          Length = 160

 Score =  142 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 48/157 (30%), Positives = 83/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  G+ +VYP HG   I  I+ + + G    + V+  DK  + ++VPV    ++G+R + 
Sbjct: 3   FTVGDTVVYPHHGAARIEAIETRTIKGEDKTYLVLKVDKGDLTVRVPVENVEEVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +E+  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  GQEGLEKVFEVLRAPYTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDKERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            E+++   A   +V E+A     +E +A  L++  L+
Sbjct: 123 GEKRMLAKARQILVSELALAEKTNEDKAEALLDEVLA 159


>gi|114764920|ref|ZP_01444093.1| transcriptional regulator, CarD family protein [Pelagibaca
           bermudensis HTCC2601]
 gi|114542632|gb|EAU45656.1| transcriptional regulator, CarD family protein [Roseovarius sp.
           HTCC2601]
          Length = 169

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 103/169 (60%), Positives = 125/169 (73%), Gaps = 5/169 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  +++VYPAHGVG I  I+EQEVAGM LE FVI+F+KDKM L+VP
Sbjct: 1   MTKSKKN-----EFRPNDYVVYPAHGVGQIMSIEEQEVAGMTLELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA +IGMR LS    V +A+K ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 56  THKATEIGMRSLSSPDVVSQAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
           DLHR D Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L
Sbjct: 116 DLHRADDQREQSYSERQLYEAALERLTREVAAVSGGDEVAAARQVDEVL 164


>gi|50955384|ref|YP_062672.1| transcriptional regulator, CarD-like regulator [Leifsonia xyli
           subsp. xyli str. CTCB07]
 gi|50951866|gb|AAT89567.1| transcriptional regulator, CarD-like regulator [Leifsonia xyli
           subsp. xyli str. CTCB07]
          Length = 160

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 85/158 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG  TITE+K++ + G +  +  +   +  + ++VP      +G+R + 
Sbjct: 3   FEVGETVVYPHHGAATITEVKKRTIKGEEKLYLKLNVTQGDLTIEVPADNVDLVGVRDVI 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+I ++EVVRDL R D     S 
Sbjct: 63  GREGLDRVFEVLRAPFTEEPTNWSRRYKANLEKLASGDVIKVSEVVRDLWRRDQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   ++ E+A      + +A +L++  L+S
Sbjct: 123 GEKRMLAKARQILISELALAEKTDDEKASSLLDEVLAS 160


>gi|84498455|ref|ZP_00997225.1| transcriptional regulator, CarD-like regulator [Janibacter sp.
           HTCC2649]
 gi|84381198|gb|EAP97082.1| transcriptional regulator, CarD-like regulator [Janibacter sp.
           HTCC2649]
          Length = 160

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 84/158 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I EI ++ + G++  +  +   +  + ++VP      +G+R + 
Sbjct: 3   FKVGETVVYPHHGAARIEEINKRTIKGVERLYLKLKVAQGDLVIEVPAENCDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +E+  +++R     + T WSRR +    K+ SGD+I +AEVVRDL R D     S 
Sbjct: 63  DKAGLEKVFEVLRAPFAEEPTNWSRRFKANLEKLASGDVIKVAEVVRDLWRRDKDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E +A  +++  L+S
Sbjct: 123 GEKRMLSKARQILVSELALAEKTDEEKAETILDEVLAS 160


>gi|116254341|ref|YP_770179.1| CarD family transcriptional regulator [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|209551385|ref|YP_002283302.1| CarD family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|241206827|ref|YP_002977923.1| CarD family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|115258989|emb|CAK10098.1| putative CarD family transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|209537141|gb|ACI57076.1| transcriptional regulator, CarD family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|240860717|gb|ACS58384.1| transcriptional regulator, CarD family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 190

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 133/189 (70%), Positives = 155/189 (82%), Gaps = 1/189 (0%)

Query: 1   MTFQQKR-DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           MT QQK+    R GF+TGE IVYPAHGVGTIT I+EQEVAGMKLE FVI F+KDKM LKV
Sbjct: 1   MTTQQKKPSTARHGFKTGESIVYPAHGVGTITAIEEQEVAGMKLELFVIDFEKDKMRLKV 60

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV KA+ IGMRKLSE  FVERALK+V+GKARVKRTMWSRRAQEYDAKINSGDLI+IAEVV
Sbjct: 61  PVAKAMSIGMRKLSETDFVERALKVVQGKARVKRTMWSRRAQEYDAKINSGDLISIAEVV 120

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ L+E NL+    + +  
Sbjct: 121 RDLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKMSETEAVRLVETNLNKGPKRGKAI 180

Query: 180 TSENQDKAA 188
             ++    A
Sbjct: 181 EEDDSQDEA 189


>gi|302384121|ref|YP_003819944.1| CarD family transcriptional regulator [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194749|gb|ADL02321.1| transcriptional regulator, CarD family [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 186

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 101/188 (53%), Positives = 133/188 (70%), Gaps = 5/188 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT +         F+ G+ +VYPAHGVG +  ++ QEVAGM LE +V+ FD +KM L+VP
Sbjct: 1   MTTK-----SVLEFKVGDAVVYPAHGVGKVAAVEVQEVAGMSLEVYVVTFDHEKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA   G+R L+    V +AL  ++G+AR+KRTMWSRRAQEY+AKINSGDL+ IAEVVR
Sbjct: 56  TKKAKTAGLRSLASEDVVTKALSTLKGRARIKRTMWSRRAQEYEAKINSGDLVCIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DLHR DSQPE+SYSERQLYESAL+RM RE+AA N I +  A+ L+  +LS+K +    + 
Sbjct: 116 DLHRADSQPEQSYSERQLYESALDRMAREVAAANRIDKDAAVQLLSKSLSAKKANAPVAE 175

Query: 181 SENQDKAA 188
             ++D  A
Sbjct: 176 VADEDSEA 183


>gi|197104173|ref|YP_002129550.1| transcriptional regulator,CarD family [Phenylobacterium zucineum
           HLK1]
 gi|196477593|gb|ACG77121.1| transcriptional regulator,CarD family [Phenylobacterium zucineum
           HLK1]
          Length = 171

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 97/163 (59%), Positives = 125/163 (76%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
             F  G+H+VYPAHGVG +  I+ QEVAG+KLE +VI FD +KM L+VP  KA   G+R 
Sbjct: 6   HDFSVGDHVVYPAHGVGQVQGIETQEVAGLKLEVYVITFDHEKMTLRVPTAKAKTAGLRP 65

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
           L++   V +AL  ++G+ARVKRTMWSRRAQEY+AKINSGDLI+IAEVVRDLHR ++QPE+
Sbjct: 66  LADTGLVSKALTTLKGRARVKRTMWSRRAQEYEAKINSGDLISIAEVVRDLHRAENQPEQ 125

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           SYSERQLYESAL+RM RE+AA+  I    AI ++  +L   ++
Sbjct: 126 SYSERQLYESALDRMAREVAAIERIDREAAIAMLNKSLVKATA 168


>gi|254476379|ref|ZP_05089765.1| transcriptional regulator, CarD family [Ruegeria sp. R11]
 gi|214030622|gb|EEB71457.1| transcriptional regulator, CarD family [Ruegeria sp. R11]
          Length = 169

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 102/174 (58%), Positives = 129/174 (74%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  +++VYPAHGVG I  I+EQEVAG KLE FVI F+KDKM L+VP
Sbjct: 1   MTKSKK-----PEFRPDDYVVYPAHGVGQIISIEEQEVAGFKLELFVITFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA +IGMR LS    + +A+  ++GKA+VKR MWSRRAQEY+ KINSGDLI+IAEVVR
Sbjct: 56  THKATEIGMRSLSSPDVIAKAMTTLKGKAKVKRAMWSRRAQEYEQKINSGDLISIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L+S+++
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVSGGDEISAAKQVDEVLTSRAA 169


>gi|262200966|ref|YP_003272174.1| transcription factor CarD [Gordonia bronchialis DSM 43247]
 gi|262084313|gb|ACY20281.1| transcription factor CarD [Gordonia bronchialis DSM 43247]
          Length = 162

 Score =  141 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 41/160 (25%), Positives = 87/160 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   + +I  + + G ++E+ V+      M +++P  K   +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAARVEDIVTRTIKGEQIEYLVLKVADGDMTVQIPSTKLEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T W+RR +    K+ SGD+I +AE+VRDL R +     S 
Sbjct: 63  GQEGLDQVFQVLRAPHTEEPTNWARRFKANQEKLISGDIIKVAEIVRDLWRREQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E++   +  + +A ++++  L++ S
Sbjct: 123 GEKRMLTRARRVLVDELSLAQNTDDEKATSILDEVLAAAS 162


>gi|148556439|ref|YP_001264021.1| CarD family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148501629|gb|ABQ69883.1| transcriptional regulator, CarD family [Sphingomonas wittichii RW1]
          Length = 172

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 88/171 (51%), Positives = 124/171 (72%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            A    F  G+++VYP HGVG + E++ QE+AG KLE +V+ F+K++M L+VP  KA  +
Sbjct: 2   AAKALSFVVGDYVVYPKHGVGRVVELQSQEIAGAKLELYVLRFEKERMTLRVPTNKAEAV 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMRKLS +  +  AL  ++GK ++KRTMWSRRAQEY+AKINSGDL++I+EVVRDL R D 
Sbjct: 62  GMRKLSSSVTMGEALTTLKGKPKIKRTMWSRRAQEYEAKINSGDLVSISEVVRDLFRADD 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEK 178
           QPE+SYSERQ++E+A +R+ RE+AA+ ++ EP A   I   L   ++   K
Sbjct: 122 QPEQSYSERQIFEAATSRLARELAAMEAVDEPTAQEKILDILRKAAAIHNK 172


>gi|296284819|ref|ZP_06862817.1| transcriptional regulator [Citromicrobium bathyomarinum JL354]
          Length = 182

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 89/175 (50%), Positives = 127/175 (72%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            A    F  G+++VYP HGVG + E++ +E+AGM+LE +V+ F+K++M L+VPV K   I
Sbjct: 7   AAKALAFDVGDYVVYPKHGVGRVVELQSEEIAGMQLELYVLRFEKERMTLRVPVNKVEAI 66

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMRKLS    ++ A++ ++GK +VKRTMWSRRAQEY+AKINSGDL++IAEV RDL R D 
Sbjct: 67  GMRKLSSDKTLKEAMETLKGKPKVKRTMWSRRAQEYEAKINSGDLVSIAEVTRDLFRPDD 126

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSE 182
           QPE+SYSERQ++E+A +R+ RE+AA+    EP A+  I   L   + +  ++T E
Sbjct: 127 QPEQSYSERQIFEAASSRLARELAAMEKTDEPAALEKILSVLREHAPQYYENTEE 181


>gi|294084639|ref|YP_003551397.1| transcriptional regulator [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664212|gb|ADE39313.1| Transcriptional regulator [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 168

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 116/160 (72%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  G+ +VYP HGVG I   + +EVAG++LE  V+ F++D+M L+VP+ KA  +G+R LS
Sbjct: 9   FEEGDFVVYPTHGVGRILGTETREVAGIELEMLVVRFEQDRMTLRVPMEKAKTLGLRTLS 68

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
            +  +++A+  ++GKARV+RTMWSRRA EY+ KI SGD ++IAEVVRDLHR  +Q E+SY
Sbjct: 69  SSKQMDQAITTLQGKARVRRTMWSRRAAEYETKIKSGDPVSIAEVVRDLHRRTNQSEQSY 128

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           SERQ+Y++AL R+ RE AA+  I +  A   +E  ++  +
Sbjct: 129 SERQMYQAALERLAREYAAIEKIDQDAAALKLEDMMAEAA 168


>gi|99080417|ref|YP_612571.1| CarD family transcriptional regulator [Ruegeria sp. TM1040]
 gi|99036697|gb|ABF63309.1| transcriptional regulator, CarD family [Ruegeria sp. TM1040]
          Length = 169

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 106/174 (60%), Positives = 130/174 (74%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  + IVYPAHGVG I  I+EQEVAG KLE FVI F+KDKM L+VP
Sbjct: 1   MTKSKK-----LEFRPNDFIVYPAHGVGQIISIEEQEVAGYKLELFVITFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KAIDIGMR LS    + +A+K ++GKA+VKR MWSRRAQEY+ KINSGDLI+IAEVVR
Sbjct: 56  THKAIDIGMRSLSSPDVINQAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLISIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L+S+++
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVSGGDEIAAAKQVDEVLTSRAA 169


>gi|115522154|ref|YP_779065.1| CarD family transcriptional regulator [Rhodopseudomonas palustris
           BisA53]
 gi|115516101|gb|ABJ04085.1| transcriptional regulator, CarD family [Rhodopseudomonas palustris
           BisA53]
          Length = 358

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 109/176 (61%), Positives = 138/176 (78%)

Query: 4   QQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGK 63
           ++K    RQGF+T E +VYPAHGVG I  I+EQE+AG KLE FVI F KDKM L+VP  K
Sbjct: 161 EKKPLTQRQGFKTNEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFIKDKMTLRVPTAK 220

Query: 64  AIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLH 123
             ++GMRKLSE   V+RAL+ ++G+ARVKRTMWSRRAQEY+AKINSGD++AIAEVVRDL 
Sbjct: 221 VTNVGMRKLSEPALVKRALETLKGRARVKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLF 280

Query: 124 RTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           R+DSQPE+SYSERQLYE+AL+R+ REIA V  ++E EA+  +E  L+    +  K+
Sbjct: 281 RSDSQPEQSYSERQLYEAALDRLSREIAVVQHVTETEAVKEVEGQLAKSPRRGAKT 336


>gi|46201683|ref|ZP_00208209.1| COG1329: Transcriptional regulators, similar to M. xanthus CarD
           [Magnetospirillum magnetotacticum MS-1]
          Length = 164

 Score =  140 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 87/160 (54%), Positives = 118/160 (73%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+++VYP HGVG +  ++ QE+ GMKL+ FVI FD+D+M L+VPV KA   G+RKL
Sbjct: 5   SFTQGDYVVYPTHGVGQVVAVETQEIGGMKLQLFVITFDRDRMTLRVPVTKAQKSGLRKL 64

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           S    ++ AL  ++G+A+VKRTMWSRRAQEY+AKINSGD ++IAEVVRDLHR  +QP++S
Sbjct: 65  SSRSVMDTALSTLKGRAKVKRTMWSRRAQEYEAKINSGDPVSIAEVVRDLHRNANQPDQS 124

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           YSERQ+YE+AL R+  E+AAV  I    A   ++  L + 
Sbjct: 125 YSERQIYEAALERLASELAAVERIDTQAATEKLQGLLEAA 164


>gi|209883217|ref|YP_002287074.1| transcriptional regulator of CarD family [Oligotropha
           carboxidovorans OM5]
 gi|209871413|gb|ACI91209.1| transcriptional regulator of CarD family [Oligotropha
           carboxidovorans OM5]
          Length = 323

 Score =  140 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 108/171 (63%), Positives = 138/171 (80%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K    RQGF+T E +VYPAHGVG I  I+EQE+AG +LE FVI+F KDKM L+VP  K 
Sbjct: 119 KKPLTQRQGFKTNEFVVYPAHGVGQILAIEEQEIAGARLELFVISFIKDKMTLRVPTAKV 178

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
           I++GMRKLS+   V+RAL  ++G+AR+KRTMWSRRAQEY+AKINSGD++AIAEVVRDL+R
Sbjct: 179 INVGMRKLSDPALVKRALDTLKGRARIKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLYR 238

Query: 125 TDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSK 175
           ++SQPE+SYSERQLYE+AL+R+ REIA V  I+E EAI  +E NL+    +
Sbjct: 239 SESQPEQSYSERQLYEAALDRLSREIAVVQHITETEAIKEVEANLAKSPRR 289


>gi|296392879|ref|YP_003657763.1| CarD family transcriptional regulator [Segniliparus rotundus DSM
           44985]
 gi|296180026|gb|ADG96932.1| transcriptional regulator, CarD family [Segniliparus rotundus DSM
           44985]
          Length = 162

 Score =  140 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 47/160 (29%), Positives = 83/160 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   +  I+ + + G++ E+ V+      + ++VP   A  IG+R + 
Sbjct: 3   FKIGDTVVYPHHGAALVEAIEVRTIKGVEKEYLVLKVGHGDLTVRVPAENAEYIGIRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++   ++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  SDEGLDKVFNVLRDVHTEEPTNWSRRYKANIEKLASGDVHKVAEVVRDLWRREQGRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E++L   A   +V E+A   S  + +A  L++  L+  S
Sbjct: 123 GEKRLLAKARQVLVGELALAESSDDAKAEGLLDEVLAQAS 162


>gi|83313417|ref|YP_423681.1| transcriptional regulator [Magnetospirillum magneticum AMB-1]
 gi|82948258|dbj|BAE53122.1| Transcriptional regulator [Magnetospirillum magneticum AMB-1]
          Length = 167

 Score =  140 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 86/160 (53%), Positives = 117/160 (73%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+++VYP HGVG +  ++ QE+ GMKL+ FVI FD+D+M L+VPV KA   G+R L
Sbjct: 8   SFTQGDYVVYPTHGVGQVVAVETQEIGGMKLQLFVITFDRDRMTLRVPVTKAQKSGLRML 67

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           S    ++ AL  ++G+A+VKRTMWSRRAQEY+AKINSGD ++IAEVVRDLHR  +QP++S
Sbjct: 68  SSRSVMDTALSTLKGRAKVKRTMWSRRAQEYEAKINSGDPVSIAEVVRDLHRNANQPDQS 127

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           YSERQ+YE+AL R+  E+AAV  I    A   ++  L + 
Sbjct: 128 YSERQIYEAALERLASELAAVERIDTQAATEKLQGLLEAA 167


>gi|169627671|ref|YP_001701320.1| putative CarD-like transcriptional regulator [Mycobacterium
           abscessus ATCC 19977]
 gi|169239638|emb|CAM60666.1| Putative CarD-like transcriptional regulator [Mycobacterium
           abscessus]
          Length = 162

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 44/160 (27%), Positives = 85/160 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   I  I+ + + G + E+ V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++   +++R     + T WSRR +    K+ SGD+  +AEVVRDL R + +   S 
Sbjct: 63  GREGLDTVFQVLRAPHTEEPTNWSRRFKANQEKLASGDVKKVAEVVRDLWRREQERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E+A   + +  +A  +++  L++ S
Sbjct: 123 GEKRMLAKARQILVGELALAENTNAAKADTILDEVLAAAS 162


>gi|170742914|ref|YP_001771569.1| CarD family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197188|gb|ACA19135.1| transcriptional regulator, CarD family [Methylobacterium sp. 4-46]
          Length = 197

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 114/177 (64%), Positives = 147/177 (83%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K  A RQGF+TGE IVYPAHGVG IT I+EQE+AG KLE FV++F+KDKM L+VP
Sbjct: 1   MTTAKKTTAARQGFKTGEAIVYPAHGVGRITAIEEQEIAGYKLELFVVSFEKDKMVLRVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA  +GMRKL+E   V++AL ++ G+ARVKRTMWSRRAQEY+AKINSGDLIA+ EVVR
Sbjct: 61  TAKANAVGMRKLAEPDLVKKALDVLTGRARVKRTMWSRRAQEYEAKINSGDLIAVTEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTE 177
           DL+R+++QPE+SYSERQLYE+AL+R+VREIAAVN I++ E++ LIE +L+    + +
Sbjct: 121 DLYRSEAQPEQSYSERQLYEAALDRVVREIAAVNKITDTESLKLIEQSLAKSPRRAK 177


>gi|89069370|ref|ZP_01156729.1| transcriptional regulator, CarD family protein [Oceanicola
           granulosus HTCC2516]
 gi|89045137|gb|EAR51208.1| transcriptional regulator, CarD family protein [Oceanicola
           granulosus HTCC2516]
          Length = 171

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 101/174 (58%), Positives = 126/174 (72%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M+  +K       F   +H+VYPAHGVG I  I++QEVAG +LE FVI+F+KDKM L+VP
Sbjct: 1   MSKSRKN-----EFSPNDHVVYPAHGVGQIVSIEKQEVAGFELELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA ++GMR LS    V  A+K ++GKA+VK+ MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 56  THKAEEVGMRSLSSPDVVAHAMKTLKGKAKVKKAMWSRRAQEYEQKINSGDLIAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHR D Q E+SYSERQLYE+AL R+ REIAAV    E  A   I+  L S+++
Sbjct: 116 DLHRADDQREQSYSERQLYEAALERLTREIAAVGGNDEVAAAKEIDDVLVSRAA 169


>gi|222087730|ref|YP_002546267.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221725178|gb|ACM28334.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 190

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 133/189 (70%), Positives = 156/189 (82%), Gaps = 1/189 (0%)

Query: 1   MTFQQKRDAM-RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           MT QQK+ +  R GF+TGE IVYPAHGVGTIT I+EQEVAGMKLE FVI F+KDKM LKV
Sbjct: 1   MTTQQKKPSAARHGFKTGESIVYPAHGVGTITAIEEQEVAGMKLELFVIDFEKDKMRLKV 60

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV KA+ IGMRKLSE  FVERALK+V+GKARVKRTMWSRRAQEYDAKINSGDLI+IAEVV
Sbjct: 61  PVAKAMSIGMRKLSETDFVERALKVVQGKARVKRTMWSRRAQEYDAKINSGDLISIAEVV 120

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ L+E NL+    + +  
Sbjct: 121 RDLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKMSETEAVRLVETNLNKGPKRGKVV 180

Query: 180 TSENQDKAA 188
             ++    A
Sbjct: 181 EEDDSQDEA 189


>gi|258651110|ref|YP_003200266.1| CarD family transcriptional regulator [Nakamurella multipartita DSM
           44233]
 gi|258554335|gb|ACV77277.1| transcriptional regulator, CarD family [Nakamurella multipartita
           DSM 44233]
          Length = 160

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 82/158 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I   + + V G++  + V+   +  + +KVP   A  +G+R + 
Sbjct: 3   FNVGETVVYPHHGAALIQATETRTVKGVEKLYLVLKVAQGDLTVKVPADNAEIVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++   +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D +   S 
Sbjct: 63  DRTGLDHVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDRERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A     +E  A  +++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAEGTNEVRAEGILDEVLAS 160


>gi|296537276|ref|ZP_06899162.1| CarD family transcriptional regulator [Roseomonas cervicalis ATCC
           49957]
 gi|296262394|gb|EFH09133.1| CarD family transcriptional regulator [Roseomonas cervicalis ATCC
           49957]
          Length = 226

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 74/164 (45%), Positives = 114/164 (69%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
                F+ G+H+VYP HGVG +  I+   VAG +L+  ++ F++++M L+VP+ KA   G
Sbjct: 63  NQGSEFKAGDHVVYPTHGVGQVQGIESMAVAGTELKVIIVTFEENRMTLRVPLNKAASSG 122

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           +RKL+    +  A++ ++G+AR+KRTMWSRRAQEY+ KINSGD + IAEVVRDLHR   Q
Sbjct: 123 LRKLAGGDRMGEAMETLKGRARIKRTMWSRRAQEYEQKINSGDPVQIAEVVRDLHRNAGQ 182

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           P++S+SERQ+YE A++R+  E+AA++   +  A+  +  +L   
Sbjct: 183 PDQSFSERQIYELAMDRLAAEVAAIDGTDKNGAMTKLLEHLKQG 226


>gi|260576851|ref|ZP_05844834.1| transcriptional regulator, CarD family [Rhodobacter sp. SW2]
 gi|259020888|gb|EEW24201.1| transcriptional regulator, CarD family [Rhodobacter sp. SW2]
          Length = 169

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 102/174 (58%), Positives = 129/174 (74%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  E +VYPAHGVG I  I+EQE+AG+ LE FVI+F+KDKM L+VP
Sbjct: 1   MTKSKK-----PEFRPNEFVVYPAHGVGKIISIEEQEIAGLHLELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA +IGMR LS    V +AL  ++GKARVKR MWSRRAQEY+ KINSGDL++IAEVVR
Sbjct: 56  THKATEIGMRGLSSPDIVTKALDTLKGKARVKRAMWSRRAQEYEQKINSGDLLSIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHR+D Q E+SYSERQLYE+AL R+ RE+AAV+ + E  A   +   L+S+++
Sbjct: 116 DLHRSDDQREQSYSERQLYEAALERLTREVAAVSGVDEAGAQKTVGTVLTSRAA 169


>gi|317507825|ref|ZP_07965526.1| CarD/TRCF domain-containing protein [Segniliparus rugosus ATCC
           BAA-974]
 gi|316253867|gb|EFV13236.1| CarD/TRCF domain-containing protein [Segniliparus rugosus ATCC
           BAA-974]
          Length = 162

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 47/160 (29%), Positives = 84/160 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   +  I+ + + G++ E+ V+   +  + ++VP   A  IG+R + 
Sbjct: 3   FKIGDTVVYPHHGAALVEAIEVRTIKGVEKEYLVLKVGQGDLTVRVPAENAEYIGIRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++   ++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  SDEGLDKVFNVLRDVHTEEPTNWSRRYKANIEKLASGDVHKVAEVVRDLWRREQGRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E++L   A   +V E+A   S  + +A  L++  L+  S
Sbjct: 123 GEKRLLAKARQVLVGELALAESSDDEKAECLLDEVLAEAS 162


>gi|254449905|ref|ZP_05063342.1| transcriptional regulator, CarD family [Octadecabacter antarcticus
           238]
 gi|198264311|gb|EDY88581.1| transcriptional regulator, CarD family [Octadecabacter antarcticus
           238]
          Length = 170

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 96/167 (57%), Positives = 120/167 (71%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
              +  +   + +VYPAHGVG I  I+ QE+AG +LE FVIAF+KDKM L+VP  KA D+
Sbjct: 2   AKKKYDYSPNDFVVYPAHGVGKIVSIETQEIAGFELEMFVIAFEKDKMTLRVPTNKAEDV 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMR L+    V   +K ++GKA+VK+ MWSRRAQEY+ KINSGDLIAIAEVVRDLHR D 
Sbjct: 62  GMRSLASTEVVADCMKTLKGKAKVKKAMWSRRAQEYEQKINSGDLIAIAEVVRDLHRADD 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           Q E+SYSERQLYE+AL R+ RE AAV + +E EA   I   L S++ 
Sbjct: 122 QREQSYSERQLYEAALERLTREFAAVGNGNELEAGTEITDTLQSRAP 168


>gi|254418588|ref|ZP_05032312.1| CarD-like transcriptional regulator family [Brevundimonas sp. BAL3]
 gi|196184765|gb|EDX79741.1| CarD-like transcriptional regulator family [Brevundimonas sp. BAL3]
          Length = 176

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 97/169 (57%), Positives = 126/169 (74%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYPAHGVG +  ++ QEVAGM LE +V+ FD +KM L+VP  KA   G+R L
Sbjct: 8   EFKVGDAVVYPAHGVGKVAAVETQEVAGMSLEVYVVTFDHEKMTLRVPTKKAATAGLRSL 67

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +    V +AL  ++G+AR+KRTMWSRRAQEY+AKINSGDLI+IAEVVRDLHR D+QPE+S
Sbjct: 68  AADDVVTKALTTLKGRARIKRTMWSRRAQEYEAKINSGDLISIAEVVRDLHRADTQPEQS 127

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTS 181
           YSERQLYESAL+RM RE+AA N I +  A+ L+  +LS+K        +
Sbjct: 128 YSERQLYESALDRMAREVAAANKIDKDAAVELLAKSLSAKKPIPTAEAA 176


>gi|317123120|ref|YP_004103123.1| CarD family transcriptional regulator [Thermaerobacter marianensis
           DSM 12885]
 gi|315593100|gb|ADU52396.1| transcriptional regulator, CarD family [Thermaerobacter marianensis
           DSM 12885]
          Length = 190

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 44/158 (27%), Positives = 76/158 (48%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG G I  I+E+EV G +  ++V+      M + +P   A   G+R +
Sbjct: 1   MFEVGDRVVYPMHGAGVIEAIEEREVLGKRHRYYVLRLPVGDMRVMIPTTTASRCGLRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
             A  V   L  +   A      W+ R +E+  K+ +GD++ +A VVR+L     +   S
Sbjct: 61  IPAEQVPAVLDALGDPAPPMDPNWNHRYREHADKLRTGDVLEVAAVVRNLSARQRERGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             ER+L + A   +V E+   + + +     L++  L 
Sbjct: 121 GGERRLLDQARQILVSELTLASGLDQAAVDALVDRCLE 158


>gi|17986562|ref|NP_539196.1| transcriptional regulator [Brucella melitensis bv. 1 str. 16M]
 gi|17982170|gb|AAL51460.1| transcriptional regulator [Brucella melitensis bv. 1 str. 16M]
          Length = 207

 Score =  139 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 129/188 (68%), Positives = 153/188 (81%), Gaps = 2/188 (1%)

Query: 1   MTFQQKRDAMRQG-FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           M+ QQK+  + +G F+ GE IVYPAHGVG I  I+EQEVAG KLE FVI F+KDKM LKV
Sbjct: 17  MSSQQKKSPVARGGFKAGEAIVYPAHGVGQIVTIEEQEVAGHKLELFVIDFEKDKMRLKV 76

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV KA  IGMRKLSE  +VERALK+V+G+ARVKRTMWSRRAQEYDAKINSGDLI+I+EVV
Sbjct: 77  PVAKAASIGMRKLSETDYVERALKVVQGRARVKRTMWSRRAQEYDAKINSGDLISISEVV 136

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ LIEVNL+    K  K+
Sbjct: 137 RDLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKLSETEAVRLIEVNLAKG-PKRGKA 195

Query: 180 TSENQDKA 187
            +E  D  
Sbjct: 196 EAELDDDE 203


>gi|163853280|ref|YP_001641323.1| transcription factor CarD [Methylobacterium extorquens PA1]
 gi|163664885|gb|ABY32252.1| transcription factor CarD [Methylobacterium extorquens PA1]
          Length = 196

 Score =  139 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 114/196 (58%), Positives = 151/196 (77%), Gaps = 8/196 (4%)

Query: 1   MTFQQKRDAM-RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           MT  +K     RQGF+TGE +VYPAHGVG IT I+EQE+AG KLE FV++F+KDKM L+V
Sbjct: 1   MTTAKKTTVAGRQGFKTGEAVVYPAHGVGRITAIEEQEIAGYKLELFVVSFEKDKMVLRV 60

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           P  KA  +GMRKL+E   V++AL ++ G+ARVKRTMWSRRAQEY+AKINSGDLI++ EVV
Sbjct: 61  PTAKANSVGMRKLAEPELVKKALDVLTGRARVKRTMWSRRAQEYEAKINSGDLISVTEVV 120

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL R+++QPE+SYSERQLYE+AL+R+VREI++VN I+E EA+ LIE +L+    + +  
Sbjct: 121 RDLFRSEAQPEQSYSERQLYEAALDRVVREISSVNKITETEALKLIEQSLAKSPRRAKAD 180

Query: 180 -------TSENQDKAA 188
                    + Q++AA
Sbjct: 181 AEADAEGEDDVQEEAA 196


>gi|309812604|ref|ZP_07706349.1| CarD-like protein [Dermacoccus sp. Ellin185]
 gi|308433455|gb|EFP57342.1| CarD-like protein [Dermacoccus sp. Ellin185]
          Length = 160

 Score =  139 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 50/159 (31%), Positives = 87/159 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ GE +VYP HG  TI EIK +++ G   ++ V+   +  + ++VP      +G+R +
Sbjct: 2   EFKVGETVVYPHHGAATIEEIKVRKIKGEDKQYLVLNVAQGDLTIEVPAENCDLVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +E+  +++R +   + T WSRR +    K+ SGD+I +AEVVRDL R D     S
Sbjct: 62  VDKAGLEKVFEVLRAEHTEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E+++   A   +V E+A     +E +A   ++  L+S
Sbjct: 122 AGEKRMLAKARQILVSELALAEHTNEDKAEATLDEVLAS 160


>gi|218532096|ref|YP_002422912.1| CarD family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|240140688|ref|YP_002965168.1| transcriptional regulator, CarD family [Methylobacterium extorquens
           AM1]
 gi|218524399|gb|ACK84984.1| transcriptional regulator, CarD family [Methylobacterium
           chloromethanicum CM4]
 gi|240010665|gb|ACS41891.1| transcriptional regulator, CarD family [Methylobacterium extorquens
           AM1]
          Length = 196

 Score =  139 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 113/196 (57%), Positives = 151/196 (77%), Gaps = 8/196 (4%)

Query: 1   MTFQQKRDAM-RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           MT  +K     RQGF+TGE +VYPAHGVG IT I+EQE+AG KLE FV++F+KDKM L+V
Sbjct: 1   MTTAKKTTVAGRQGFKTGEAVVYPAHGVGRITAIEEQEIAGYKLELFVVSFEKDKMVLRV 60

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           P  KA  +GMRKL+E   V++AL ++ G+AR+KRTMWSRRAQEY+AKINSGDLI++ EVV
Sbjct: 61  PTAKANSVGMRKLAEPELVKKALDVLTGRARIKRTMWSRRAQEYEAKINSGDLISVTEVV 120

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL R+++QPE+SYSERQLYE+AL+R+VREI++VN I+E EA+ LIE +L+    + +  
Sbjct: 121 RDLFRSEAQPEQSYSERQLYEAALDRVVREISSVNKITETEALKLIEQSLAKSPRRAKAD 180

Query: 180 -------TSENQDKAA 188
                    + Q++AA
Sbjct: 181 AEADAEGEDDVQEEAA 196


>gi|294678311|ref|YP_003578926.1| CarD family transcriptional regulator [Rhodobacter capsulatus SB
           1003]
 gi|294477131|gb|ADE86519.1| transcriptional regulator, CarD family [Rhodobacter capsulatus SB
           1003]
          Length = 169

 Score =  139 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 100/169 (59%), Positives = 126/169 (74%), Gaps = 5/169 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  + +VYPAHGVG I  I+EQE+AG++LE FVI+F+KDKM L+VP
Sbjct: 1   MTKMKK-----TEFRPDDFVVYPAHGVGKIISIEEQEIAGLRLELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA+DIGMR LS    V +AL+ ++GKA+VKR MWSRRAQEY+ KINSGDL++IAEVVR
Sbjct: 56  THKAVDIGMRGLSSPDVVTKALETLKGKAKVKRAMWSRRAQEYEQKINSGDLLSIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
           DLHR D Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   ++  L
Sbjct: 116 DLHRADDQREQSYSERQLYEAALERLTREVAAVSGTDEAGAAKKVDEVL 164


>gi|163736061|ref|ZP_02143484.1| transcriptional regulator, CarD family, putative [Roseobacter
           litoralis Och 149]
 gi|161390657|gb|EDQ15003.1| transcriptional regulator, CarD family, putative [Roseobacter
           litoralis Och 149]
          Length = 170

 Score =  139 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 103/172 (59%), Positives = 125/172 (72%), Gaps = 5/172 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  E +VYPAHGVG I  I+EQEVAG+ LE FVI+F+KDKM L+VP
Sbjct: 1   MTKSKK-----LDFRPNEFVVYPAHGVGQILSIEEQEVAGISLELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA +IGMR LS    +  A++ ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 56  THKATEIGMRALSSPDVISHAMRTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   +   L S+
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVSGGDELAASKQVGDVLESR 167


>gi|311741767|ref|ZP_07715578.1| CarD family transcriptional regulator [Aeromicrobium marinum DSM
           15272]
 gi|311314773|gb|EFQ84679.1| CarD family transcriptional regulator [Aeromicrobium marinum DSM
           15272]
          Length = 161

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 89/159 (55%), Gaps = 1/159 (0%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFV-IAFDKDKMCLKVPVGKAIDIGMRKL 72
           F  GE +VYP HG   I +I+ +++ G + ++ V     ++ + ++VP      +G+R +
Sbjct: 3   FTVGETVVYPNHGAAVIEDIETRKIKGEERDYLVLRIIAQNDLVVRVPACNLDLVGVRDV 62

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +A  +ER   ++R +   + T WSRR +    K++SGD++ +AEVVRDL R D +   S
Sbjct: 63  VDADGLERVFSVLRAEHVEEPTNWSRRYKANLEKLHSGDVLKVAEVVRDLWRRDHERGLS 122

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E+++   A   +V E+A   + +E +A   ++  L+S
Sbjct: 123 AGEKRMLAKARQILVSELALAENTNEDKAELRLDEVLAS 161


>gi|51894260|ref|YP_076951.1| transcriptional regulator [Symbiobacterium thermophilum IAM 14863]
 gi|51857949|dbj|BAD42107.1| transcriptional regulator [Symbiobacterium thermophilum IAM 14863]
          Length = 159

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 45/159 (28%), Positives = 84/159 (52%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG G I  I+++EV G +  ++V+      M + VP       G+R +
Sbjct: 1   MFQVGDKVVYPMHGAGIIEAIEDREVLGERKRYYVLRLPVADMQVLVPCDGPQSTGLRAV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 ++ L+++R +       W+ R +    KI SGD++A+AEVVR L + + +   S
Sbjct: 61  MSEQVFQQVLEVLRSRPTQAEKNWNHRYRMNMEKIRSGDVLALAEVVRTLSQREREKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             ER++ +SA   ++ EI  +  +   +A +L++  L+ 
Sbjct: 121 TGERKMLDSARQILLSEIVLIRGLELEQASSLLDRVLAQ 159


>gi|88855757|ref|ZP_01130420.1| transcriptional regulator, CarD-like regulator [marine
           actinobacterium PHSC20C1]
 gi|88815081|gb|EAR24940.1| transcriptional regulator, CarD-like regulator [marine
           actinobacterium PHSC20C1]
          Length = 160

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/158 (29%), Positives = 84/158 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG  TITE+K++ + G +  +  +   +  + ++VP      +G+R + 
Sbjct: 3   FEVGETVVYPHHGAATITEVKKRTIKGEEKIYLKLNVTQGDLTIEVPAENVDLVGVRDVI 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    K+ SGD+I ++EVVRDL R D     S 
Sbjct: 63  GREGLDQVFEVLRAPFTEEPTNWSRRYKANLEKLASGDVIKVSEVVRDLWRRDQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   ++ E+A      E +A  +++  L+S
Sbjct: 123 GEKRMLAKARQILISELALAEKTDEEKASLVLDEVLAS 160


>gi|126733165|ref|ZP_01748912.1| transcriptional regulator, CarD family, putative [Roseobacter sp.
           CCS2]
 gi|126716031|gb|EBA12895.1| transcriptional regulator, CarD family, putative [Roseobacter sp.
           CCS2]
          Length = 168

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 99/167 (59%), Positives = 120/167 (71%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
              +  F   E +VYPAHGVG I  I+ QEVAG +LE FVI+F+KDKM L+VP  KA  +
Sbjct: 2   SKKKYDFSPNEFVVYPAHGVGKIVSIETQEVAGFELEMFVISFEKDKMTLRVPTDKATHV 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMR L+    V  A+K +RGKA+VK+ MWSRRAQEY+ KINSGDLIAIAEVVRDLHR D 
Sbjct: 62  GMRALATPDVVSHAMKTLRGKAKVKKAMWSRRAQEYEQKINSGDLIAIAEVVRDLHRQDD 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           Q E+SYSERQLYE+AL R+ REIAAV    E  A   I+  L S+++
Sbjct: 122 QREQSYSERQLYEAALERLTREIAAVAGNDENAAAAEIDSVLVSRAA 168


>gi|94497220|ref|ZP_01303792.1| transcriptional regulator, CarD family protein [Sphingomonas sp.
           SKA58]
 gi|94423325|gb|EAT08354.1| transcriptional regulator, CarD family protein [Sphingomonas sp.
           SKA58]
          Length = 175

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 88/173 (50%), Positives = 126/173 (72%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            A    F  G+++VYP HGVG + E++++++AGM+LE +V+ F+K++M L+VP  KA  +
Sbjct: 2   AAKALSFDVGDYVVYPKHGVGRVIELQKEQIAGMELELYVLRFEKERMTLRVPTNKAEGV 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMRKLS    +E A++ ++GK +VKRTMWSRRAQEY+AKINSGDL++IAEV RDL R D 
Sbjct: 62  GMRKLSSNKTLEEAMETLKGKPKVKRTMWSRRAQEYEAKINSGDLVSIAEVTRDLFRADD 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           QPE+SYSERQ++E+A +R+ RE+AA+    EP A+  I   L+  + K  K  
Sbjct: 122 QPEQSYSERQIFEAASSRLARELAAMEETDEPSALQKILRILNEAAPKYAKVE 174


>gi|39933565|ref|NP_945841.1| CarD-like transcriptional regulator [Rhodopseudomonas palustris
           CGA009]
 gi|39647411|emb|CAE25932.1| possible CarD-like transcriptional regulator [Rhodopseudomonas
           palustris CGA009]
          Length = 220

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 105/171 (61%), Positives = 135/171 (78%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K    RQGF+  E +VYPAHGVG I  I+EQE+AG KLE FVI F KDKM L+VP  K 
Sbjct: 22  KKAVTQRQGFKANEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFIKDKMTLRVPTAKV 81

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
            ++GMRKLS+   V++AL+ ++G+ARVKRTMWSRRAQEY+AKINSGD++AIAEVVRDL+R
Sbjct: 82  GNVGMRKLSDPALVKKALETLKGRARVKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLYR 141

Query: 125 TDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSK 175
           ++SQPE+SYSERQLYE+AL+R+ REIA V  I+E EA+  +E  L+    +
Sbjct: 142 SESQPEQSYSERQLYEAALDRLSREIAVVQHITETEAVKEVESQLAKSPRR 192


>gi|83859720|ref|ZP_00953240.1| hypothetical protein OA2633_06964 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852079|gb|EAP89933.1| hypothetical protein OA2633_06964 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 172

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 91/170 (53%), Positives = 128/170 (75%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K     + F+  +++VYPAHGVG +  ++++ VAG  +E +V++F++DKM L+VP  KA
Sbjct: 3   KKSANDNKTFKKSDYVVYPAHGVGRVVGVEKESVAGFDIEVYVVSFEQDKMTLRVPTAKA 62

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
              GMR L+    ++ ALK ++GK +VKRTMWSRRAQEY+AKINSGDLI+IAEVVRDLHR
Sbjct: 63  TAAGMRPLASDDVLKDALKTLKGKPKVKRTMWSRRAQEYEAKINSGDLISIAEVVRDLHR 122

Query: 125 TDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            + QPE SYSERQLYESAL+RMVRE+AAV  +   +A+ ++   L+ K++
Sbjct: 123 QEDQPEPSYSERQLYESALDRMVREVAAVEKVDREKALEMLTTTLTKKAA 172


>gi|312113407|ref|YP_004011003.1| transcriptional regulator, CarD family [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311218536|gb|ADP69904.1| transcriptional regulator, CarD family [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 187

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 105/176 (59%), Positives = 131/176 (74%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
           GF+  E++VYP HGVG I  I+EQE+AG KLE FVI F+KDKM L+VP  K    GMRKL
Sbjct: 11  GFKANEYVVYPTHGVGRIVAIEEQEIAGCKLELFVINFEKDKMTLRVPTSKTQSAGMRKL 70

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           S+A  + RA++ +RG+ARVKRTMWSRRAQEY+AKINSGDLI IAEVVRDL+R+D+QPE+S
Sbjct: 71  SDAAVLARAMETLRGRARVKRTMWSRRAQEYEAKINSGDLITIAEVVRDLYRSDAQPEQS 130

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDKAA 188
           YSERQLYESAL+RM REIAA   + E  AI  +   L+      ++   + + K A
Sbjct: 131 YSERQLYESALDRMAREIAAAQDVDESIAIQKVAEALTKAGRLRKQEVEDEEKKEA 186


>gi|316931531|ref|YP_004106513.1| CarD family transcriptional regulator [Rhodopseudomonas palustris
           DX-1]
 gi|315599245|gb|ADU41780.1| transcriptional regulator, CarD family [Rhodopseudomonas palustris
           DX-1]
          Length = 264

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 105/171 (61%), Positives = 135/171 (78%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K    RQGF+  E +VYPAHGVG I  I+EQE+AG KLE FVI F KDKM L+VP  K 
Sbjct: 64  KKAVTQRQGFKANEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFIKDKMTLRVPTAKV 123

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
            ++GMRKLS+   V++AL+ ++G+ARVKRTMWSRRAQEY+AKINSGD++AIAEVVRDL+R
Sbjct: 124 GNVGMRKLSDPALVKKALETLKGRARVKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLYR 183

Query: 125 TDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSK 175
           ++SQPE+SYSERQLYE+AL+R+ REIA V  I+E EA+  +E  L+    +
Sbjct: 184 SESQPEQSYSERQLYEAALDRLSREIAVVQHITETEAVKEVESQLAKSPRR 234


>gi|257068115|ref|YP_003154370.1| transcriptional regulator, CarD family [Brachybacterium faecium DSM
           4810]
 gi|256558933|gb|ACU84780.1| transcriptional regulator, CarD family [Brachybacterium faecium DSM
           4810]
          Length = 160

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 45/158 (28%), Positives = 78/158 (49%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I E+K + + G    +  +   +  + ++VP      +G+R + 
Sbjct: 3   FAVGETVVYPHHGAALIEEVKTRTIKGEDRTYLKLKVAQGDLTIEVPADNVDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++    ++R     + T WSRR +    K+ SGD+  +AEVVRDL R D     S 
Sbjct: 63  DKEGLDEVFDVLRQPYTEEPTNWSRRYKANVEKLASGDVKKVAEVVRDLWRRDQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E  A ++++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAEKTDEGNAESILDEVLAS 160


>gi|296447999|ref|ZP_06889905.1| transcriptional regulator, CarD family [Methylosinus trichosporium
           OB3b]
 gi|296254509|gb|EFH01630.1| transcriptional regulator, CarD family [Methylosinus trichosporium
           OB3b]
          Length = 546

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 107/175 (61%), Positives = 133/175 (76%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
           GF+T E IVYPAHGVG I  I+ QEVAG  LE FV+ F KDKM LKVPV K   +GMRKL
Sbjct: 359 GFKTNEFIVYPAHGVGQIMAIETQEVAGFSLELFVVHFVKDKMTLKVPVSKVAAVGMRKL 418

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +E   VE+AL  + G+ARVKRTMWSRRAQEY+AKINSGDL+ IAEVVRDL+R+D+QPE+S
Sbjct: 419 AEPDVVEKALGTLTGRARVKRTMWSRRAQEYEAKINSGDLVTIAEVVRDLYRSDTQPEQS 478

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDKA 187
           YSERQLYE+AL+RM RE+AAV  + + E++ LIE  L+    + +KS   + +  
Sbjct: 479 YSERQLYEAALDRMAREVAAVRKLIDSESLKLIESFLAKSPRRGQKSEDASDEAT 533


>gi|220930938|ref|YP_002507846.1| transcriptional regulator, CarD family [Halothermothrix orenii H
           168]
 gi|219992248|gb|ACL68851.1| transcriptional regulator, CarD family [Halothermothrix orenii H
           168]
          Length = 176

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 43/168 (25%), Positives = 85/168 (50%)

Query: 11  RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMR 70
            + F+ G+ +VYP HG GTI  I+ + + G + +++++      M + +PV K  +IG+R
Sbjct: 9   NKMFKVGDKVVYPNHGAGTIVGIETKNILGEEKKYYIMKLPIGDMKVMIPVEKVEEIGVR 68

Query: 71  KLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
            + +    +  LKL++G        W+RR +    K+ +GD+  + EVVR+L   D +  
Sbjct: 69  NIIDEEEADNVLKLLKGDKSKMSQNWNRRYRANMEKLKTGDIYEVGEVVRNLTIRDHEKG 128

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEK 178
            S  E+++  +A   ++ E+     + E E   +I+       +  E+
Sbjct: 129 LSTGEKKMLSNARQILISELVLAKDMDEKEVEEIIDNVFEENPNLDEE 176


>gi|126729325|ref|ZP_01745139.1| transcriptional regulator, CarD family protein [Sagittula stellata
           E-37]
 gi|126710315|gb|EBA09367.1| transcriptional regulator, CarD family protein [Sagittula stellata
           E-37]
          Length = 171

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 100/169 (59%), Positives = 124/169 (73%), Gaps = 6/169 (3%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  +++VYPAHGVG I  I+EQE+AG+ LE FVI+F+KDKM L+VP
Sbjct: 4   MTKAKK-----AEFRPNDYVVYPAHGVGQIVSIEEQEIAGISLELFVISFEKDKMTLRVP 58

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA ++GMR LS    V  A+K ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 59  THKASEVGMRSLSSPDVVSEAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVR 118

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
           DLHR D Q E+SYSERQLYE+AL R+ RE+AAV +  E  A   ++  L
Sbjct: 119 DLHRADDQREQSYSERQLYEAALERLTREVAAV-TGDEAAAAKQVDEVL 166


>gi|325962196|ref|YP_004240102.1| CarD family transcriptional regulator [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323468283|gb|ADX71968.1| transcriptional regulator, CarD family [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 160

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 81/158 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I EIK + + G +  +  +   +  + ++VP      +G+R + 
Sbjct: 3   FEVGETVVYPHHGAAKIEEIKMRTIKGEEKMYLKLKVAQGDLTIEVPAENVDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +E    ++R +   + T WSRR +    K+ SGD+I +AEVVRDL R D     S 
Sbjct: 63  GKDGLEHVFDVLRAEFTEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLWRRDHDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   ++ E+A      E +A ++++  L+S
Sbjct: 123 GEKRMLAKARQILISELALAEKTDEEKAASVLDEVLAS 160


>gi|192288919|ref|YP_001989524.1| CarD family transcriptional regulator [Rhodopseudomonas palustris
           TIE-1]
 gi|192282668|gb|ACE99048.1| transcriptional regulator, CarD family [Rhodopseudomonas palustris
           TIE-1]
          Length = 278

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 105/171 (61%), Positives = 135/171 (78%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K    RQGF+  E +VYPAHGVG I  I+EQE+AG KLE FVI F KDKM L+VP  K 
Sbjct: 80  KKAVTQRQGFKANEFVVYPAHGVGQILAIEEQEIAGAKLELFVINFIKDKMTLRVPTAKV 139

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
            ++GMRKLS+   V++AL+ ++G+ARVKRTMWSRRAQEY+AKINSGD++AIAEVVRDL+R
Sbjct: 140 GNVGMRKLSDPALVKKALETLKGRARVKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLYR 199

Query: 125 TDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSK 175
           ++SQPE+SYSERQLYE+AL+R+ REIA V  I+E EA+  +E  L+    +
Sbjct: 200 SESQPEQSYSERQLYEAALDRLSREIAVVQHITETEAVKEVESQLAKSPRR 250


>gi|110679120|ref|YP_682127.1| CarD family transcriptional regulator [Roseobacter denitrificans
           OCh 114]
 gi|109455236|gb|ABG31441.1| transcriptional regulator, CarD family, putative [Roseobacter
           denitrificans OCh 114]
          Length = 170

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 103/172 (59%), Positives = 125/172 (72%), Gaps = 5/172 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  E +VYPAHGVG I  I+EQEVAG+ LE FVI+F+KDKM L+VP
Sbjct: 1   MTKSKK-----LDFRPNEFVVYPAHGVGQILSIEEQEVAGLSLELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA +IGMR LS    +  A++ ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 56  THKATEIGMRALSSPDVISHAMRTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   +   L S+
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVSGGDELAASKQVGDVLESR 167


>gi|126727502|ref|ZP_01743336.1| putative CarD-like transcriptional regulator [Rhodobacterales
           bacterium HTCC2150]
 gi|126703282|gb|EBA02381.1| putative CarD-like transcriptional regulator [Rhodobacterales
           bacterium HTCC2150]
          Length = 172

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 100/174 (57%), Positives = 127/174 (72%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M+ ++        FR  E +VYPAHGVG I  I++QE+AG+++E FV+AF+KDKM L+VP
Sbjct: 1   MSKKK-----NYAFRPNEFVVYPAHGVGQIVRIEDQEIAGIEMELFVVAFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA+ +GMR LS    V RA+  ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 56  TEKALHVGMRSLSSPETVTRAMTTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV    E  A   I+  L S++ 
Sbjct: 116 DLHRTDEQREQSYSERQLYEAALERLTREVAAVGGTDEVVAGQQIDGVLMSRAP 169


>gi|16124906|ref|NP_419470.1| hypothetical protein CC_0653 [Caulobacter crescentus CB15]
 gi|221233627|ref|YP_002516063.1| CarD-like transcriptional regulator [Caulobacter crescentus NA1000]
 gi|13421868|gb|AAK22638.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220962799|gb|ACL94155.1| CarD-like transcriptional regulator [Caulobacter crescentus NA1000]
          Length = 185

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 99/171 (57%), Positives = 128/171 (74%), Gaps = 2/171 (1%)

Query: 5   QKRDAMRQ--GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
           ++ +  +    F  G+H+VYPAHGVG+I  I+ QEVAGM LE +VI FD +KM L+VP  
Sbjct: 15  KRTNMSKTGLEFSVGDHVVYPAHGVGSIQAIETQEVAGMSLEVYVITFDHEKMTLRVPTK 74

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
           KA   G+R L+E   V +AL  ++G+ARVKRTMWSRRAQEY+AKINSGDLI+IAEVVRDL
Sbjct: 75  KAKTAGLRPLAEGGTVSQALTTLKGRARVKRTMWSRRAQEYEAKINSGDLISIAEVVRDL 134

Query: 123 HRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           HR ++QPE+SYSERQLYESAL+RM RE+AA+  I    AI ++  +L   +
Sbjct: 135 HRAENQPEQSYSERQLYESALDRMAREVAAIERIDREAAIGILTKSLVKAA 185


>gi|163746984|ref|ZP_02154341.1| transcriptional regulator, CarD family, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380098|gb|EDQ04510.1| transcriptional regulator, CarD family, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 170

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 104/172 (60%), Positives = 125/172 (72%), Gaps = 5/172 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  E +VYPAHGVG I  I+EQEVAG+ LE FVI+F+KDKM L+VP
Sbjct: 1   MTKSKK-----LDFRPNEFVVYPAHGVGQIVSIEEQEVAGIALELFVISFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA +IGMR LS    +  A+K ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 56  THKATEIGMRALSTPDVINHAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV+   E  A   +   L S+
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVSGGDELAAAKQVGDVLESR 167


>gi|332186920|ref|ZP_08388661.1| carD-like/TRCF domain protein [Sphingomonas sp. S17]
 gi|332012930|gb|EGI54994.1| carD-like/TRCF domain protein [Sphingomonas sp. S17]
          Length = 177

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 88/172 (51%), Positives = 125/172 (72%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            A    F  G+++VYP HGVG + E+++QE+AGM+LE +V+ F+K++M L+VP  KA  +
Sbjct: 2   AAKALHFDVGDYVVYPKHGVGRVIELQKQEIAGMQLELYVLRFEKERMTLRVPTNKAESV 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMRKLS    +  A++ ++GK +VKRTMWSRRAQEY+AKINSGDL++IAEVVRDL R D 
Sbjct: 62  GMRKLSSDKTMREAMETLKGKPKVKRTMWSRRAQEYEAKINSGDLVSIAEVVRDLFRADD 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           QPE+SYSERQ++E+A +R+ RE+AA+  + E  A   I   L + ++   K 
Sbjct: 122 QPEQSYSERQIFEAATSRLARELAAMEEVDEQRAQEKILEILRAAAAIYNKE 173


>gi|188583533|ref|YP_001926978.1| CarD family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179347031|gb|ACB82443.1| transcriptional regulator, CarD family [Methylobacterium populi
           BJ001]
          Length = 198

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 111/178 (62%), Positives = 147/178 (82%), Gaps = 1/178 (0%)

Query: 1   MTFQQKRDAM-RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           MT  +K  A  RQGF+TGE +VYPAHGVG IT I+EQE+AG KLE FV++F+KDKM L+V
Sbjct: 1   MTTAKKTTAAGRQGFKTGEAVVYPAHGVGRITAIEEQEIAGYKLELFVVSFEKDKMVLRV 60

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           P  KA  +GMRKL+E   V++AL ++ G+AR+KRTMWSRRAQEY+AKINSGDLI++ EVV
Sbjct: 61  PTAKANSVGMRKLAEPELVKKALDVLTGRARIKRTMWSRRAQEYEAKINSGDLISVTEVV 120

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTE 177
           RDL+R+++QPE+SYSERQLYE+AL+R+VREI++VN I+E EA+ LIE +L+    + +
Sbjct: 121 RDLYRSEAQPEQSYSERQLYEAALDRVVREISSVNRITETEALKLIEQSLAKSPRRAK 178


>gi|116669291|ref|YP_830224.1| CarD family transcriptional regulator [Arthrobacter sp. FB24]
 gi|119961222|ref|YP_946691.1| CarD-like transcriptional regulator [Arthrobacter aurescens TC1]
 gi|220911627|ref|YP_002486936.1| CarD family transcripitonal regulator [Arthrobacter
           chlorophenolicus A6]
 gi|116609400|gb|ABK02124.1| transcriptional regulator, CarD family [Arthrobacter sp. FB24]
 gi|119948081|gb|ABM06992.1| putative CarD-like transcriptional regulator [Arthrobacter
           aurescens TC1]
 gi|219858505|gb|ACL38847.1| transcriptional regulator, CarD family [Arthrobacter
           chlorophenolicus A6]
          Length = 160

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 81/158 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I EIK + + G +  +  +   +  + ++VP      +G+R + 
Sbjct: 3   FEVGETVVYPHHGAAKIEEIKMRTIKGEEKMYLKLKVAQGDLTIEVPAENVDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +E    ++R +   + T WSRR +    K+ SGD+I +AEVVRDL R D     S 
Sbjct: 63  GKEGLEHVFDVLRAEFTEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLWRRDHDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   ++ E+A      E +A ++++  L+S
Sbjct: 123 GEKRMLAKARQILISELALAEKTDEEKAASVLDEVLAS 160


>gi|332669115|ref|YP_004452123.1| CarD family transcriptional regulator [Cellulomonas fimi ATCC 484]
 gi|332338153|gb|AEE44736.1| transcriptional regulator, CarD family [Cellulomonas fimi ATCC 484]
          Length = 160

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 81/158 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I EIK + + G    +  +   +  + ++VP      +G+R + 
Sbjct: 3   FTVGETVVYPHHGAALIEEIKTRTIRGEDKIYLKLKVAQGDLTIEVPAENVDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+I +AEVVRDL R D+    S 
Sbjct: 63  GQEGLDRVFEVLRAPYTEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLSRRDADRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E +A  +++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAEHTEEEKAEAILDEVLAS 160


>gi|269796457|ref|YP_003315912.1| CarD family transcriptional regulator [Sanguibacter keddieii DSM
           10542]
 gi|269098642|gb|ACZ23078.1| transcriptional regulator, CarD family [Sanguibacter keddieii DSM
           10542]
          Length = 160

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 81/158 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I EIK + + G    +  +   +  + ++VP      +G+R + 
Sbjct: 3   FTVGETVVYPHHGAALIEEIKTRTIRGEDKLYLKLKVAQGDLTIEVPAENVDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    KI SGD+I +AEVVRDL R D+    S 
Sbjct: 63  GQEGLDRVFEVLRAPYTEEPTNWSRRYKANVEKIASGDVIKVAEVVRDLSRRDADRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E +A  +++  L+S
Sbjct: 123 GEKRMLARARQILVSELALAEHTEEEKAEAILDEVLAS 160


>gi|294012721|ref|YP_003546181.1| CarD-family transcriptional regulator [Sphingobium japonicum UT26S]
 gi|292676051|dbj|BAI97569.1| CarD-family transcriptional regulator [Sphingobium japonicum UT26S]
          Length = 175

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 88/173 (50%), Positives = 126/173 (72%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            A    F  G+++VYP HGVG + E++++++AGM+LE +V+ F+K++M L+VP  KA  +
Sbjct: 2   AAKALSFDVGDYVVYPKHGVGRVIELQKEQIAGMELELYVLRFEKERMTLRVPTNKAEGV 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMRKLS    +E A++ ++GK +VKRTMWSRRAQEY+AKINSGDL++IAEV RDL R D 
Sbjct: 62  GMRKLSSNKTLEEAVETLKGKPKVKRTMWSRRAQEYEAKINSGDLVSIAEVTRDLFRADD 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           QPE+SYSERQ++E+A +R+ RE+AA+    EP A+  I   L+  + K  K  
Sbjct: 122 QPEQSYSERQIFEAASSRLARELAAMEETDEPSALKKILRILNEAAPKHAKVE 174


>gi|87198150|ref|YP_495407.1| CarD family transcriptional regulator [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87133831|gb|ABD24573.1| transcriptional regulator, CarD family [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 174

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 88/171 (51%), Positives = 124/171 (72%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
               F  G+++VYP HGVG + E++++E+AGMKL+ +V+ F+K++M L+VPV K   IGM
Sbjct: 4   KALAFDVGDYVVYPKHGVGRVVELQDEEIAGMKLQLYVLRFEKERMTLRVPVNKVEAIGM 63

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           RKLS    +  AL  ++GK +VKRTMWSRRAQEY+AKINSGDL++IAEV RDL R D QP
Sbjct: 64  RKLSSDKTLREALDTLKGKPKVKRTMWSRRAQEYEAKINSGDLVSIAEVTRDLFRADDQP 123

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           E+SYSERQ++E+A +R+ RE+AA+    EP A+  I   L+  + K  ++ 
Sbjct: 124 EQSYSERQIFEAASSRLARELAAMEKTDEPAALKKILAILNEHAPKYYETA 174


>gi|256833291|ref|YP_003162018.1| transcriptional regulator, CarD family [Jonesia denitrificans DSM
           20603]
 gi|256686822|gb|ACV09715.1| transcriptional regulator, CarD family [Jonesia denitrificans DSM
           20603]
          Length = 161

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 48/160 (30%), Positives = 80/160 (50%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  GE +VYP HG   I EIK + + G    +  +   +  + ++VP      +G+R +
Sbjct: 2   SFTVGETVVYPHHGAALIEEIKTRTIRGEDKTYLKLRVAQGDLVIEVPAENIDLVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                ++   +++R     + T WSRR +    KI SGD+I +AEVVRDL R D+    S
Sbjct: 62  VGKEGLDEVFEVLRAPYTEEPTNWSRRYKANVEKIASGDVIKVAEVVRDLSRRDTDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
             E+++   A   +V E+A      E +A  +++  L+S 
Sbjct: 122 AGEKRMLSRARQILVSELALAERTEEDKAEAILDEVLASS 161


>gi|313835593|gb|EFS73307.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL037PA2]
 gi|314928689|gb|EFS92520.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL044PA1]
 gi|314970294|gb|EFT14392.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL037PA3]
          Length = 181

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 42/166 (25%), Positives = 88/166 (53%), Gaps = 1/166 (0%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD-KDKMCLKVPVGKAI 65
           +   +  F  GE +VYP HG   I +I+ + + G +  + V+    ++ + ++VP     
Sbjct: 16  KGVAQMTFNVGETVVYPNHGAAVIEDIETRTIKGEEKLYLVLRILGQNDLVVRVPASNLD 75

Query: 66  DIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRT 125
            +G+R + +   +E+  +++R     + + WSRR +    K++SG+++ +AEVVRDL R 
Sbjct: 76  LVGVRDVVDDEGLEKVFEILRKTNVEEPSNWSRRYKANLEKLHSGNVLKVAEVVRDLWRR 135

Query: 126 DSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
           +     S  E+++   A   +V E+A    + + +A  +++  L+S
Sbjct: 136 ERDRGLSAGEKRMLSKARQILVSELALAKRVEDDQAEEMLDEVLAS 181


>gi|300859178|ref|YP_003784161.1| putative transcription factor [Corynebacterium pseudotuberculosis
           FRC41]
 gi|300686632|gb|ADK29554.1| putative transcription factor [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302206868|gb|ADL11210.1| Transcriptional regulator [Corynebacterium pseudotuberculosis C231]
 gi|308277120|gb|ADO27019.1| Transcriptional regulator [Corynebacterium pseudotuberculosis I19]
          Length = 193

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 49/173 (28%), Positives = 88/173 (50%), Gaps = 4/173 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG   I  I+++E+ G  LEF V+  ++  + ++VP   A  +G+R +
Sbjct: 2   EFKVGDTVVYPHHGAAVIEAIEQREMNGETLEFLVLHINQSDLVVRVPSKNAELVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +++    +R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VDDEGLQKVFGFLREIDVEEAGNWSRRFKANQERLASGDVNKVAEVVRDLWRRDQGRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQD 185
             E+++   A   +V E+A   +I E +A    +  L+   +  E+  +   D
Sbjct: 122 AGEKRMLAKARQVLVGELALAENIDENKA----DELLAQVDATVERHRAAGVD 170


>gi|329890831|ref|ZP_08269174.1| carD-like/TRCF domain protein [Brevundimonas diminuta ATCC 11568]
 gi|328846132|gb|EGF95696.1| carD-like/TRCF domain protein [Brevundimonas diminuta ATCC 11568]
          Length = 181

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 97/162 (59%), Positives = 125/162 (77%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYPAHGVG +  I+ QEVAGM LE +V+ F+ +KM L+VP  KA   G+R L
Sbjct: 8   EFKVGDAVVYPAHGVGKVAAIETQEVAGMALEVYVVTFEHEKMTLRVPTKKAKTAGLRTL 67

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +    V +AL  ++G+ARVKRTMWSRRAQEY+AKINSGDLI+IAEVVRDLHR ++QPE+S
Sbjct: 68  AADDTVSKALTTLKGRARVKRTMWSRRAQEYEAKINSGDLISIAEVVRDLHRAETQPEQS 127

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           YSERQLYESAL+RM RE+AA N I +  A+ L+  +LS+K  
Sbjct: 128 YSERQLYESALDRMAREVAAANKIDKDAAMALLGKSLSAKKP 169


>gi|23502623|ref|NP_698750.1| transcriptional regulator [Brucella suis 1330]
 gi|82700550|ref|YP_415124.1| transcription factor CarD [Brucella melitensis biovar Abortus 2308]
 gi|148558867|ref|YP_001259610.1| putative transcriptional regulator [Brucella ovis ATCC 25840]
 gi|161619691|ref|YP_001593578.1| hypothetical protein BCAN_A1804 [Brucella canis ATCC 23365]
 gi|163845343|ref|YP_001622998.1| hypothetical protein BSUIS_B1242 [Brucella suis ATCC 23445]
 gi|189024848|ref|YP_001935616.1| CarD family transcriptional regulator [Brucella abortus S19]
 gi|225853216|ref|YP_002733449.1| hypothetical protein BMEA_A1818 [Brucella melitensis ATCC 23457]
 gi|254694417|ref|ZP_05156245.1| hypothetical protein Babob3T_07112 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698076|ref|ZP_05159904.1| hypothetical protein Babob28_10303 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700418|ref|ZP_05162246.1| hypothetical protein Bsuib55_06119 [Brucella suis bv. 5 str. 513]
 gi|254703537|ref|ZP_05165365.1| hypothetical protein Bsuib36_06359 [Brucella suis bv. 3 str. 686]
 gi|254708586|ref|ZP_05170414.1| hypothetical protein BpinM_16983 [Brucella pinnipedialis
           M163/99/10]
 gi|254708772|ref|ZP_05170583.1| hypothetical protein BpinB_00646 [Brucella pinnipedialis B2/94]
 gi|254714615|ref|ZP_05176426.1| hypothetical protein BcetM6_15022 [Brucella ceti M644/93/1]
 gi|254717513|ref|ZP_05179324.1| hypothetical protein BcetM_14151 [Brucella ceti M13/05/1]
 gi|254719759|ref|ZP_05181570.1| hypothetical protein Bru83_09478 [Brucella sp. 83/13]
 gi|256030298|ref|ZP_05443912.1| hypothetical protein BpinM2_06566 [Brucella pinnipedialis
           M292/94/1]
 gi|256045367|ref|ZP_05448261.1| hypothetical protein Bmelb1R_12807 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061797|ref|ZP_05451932.1| hypothetical protein Bneo5_15748 [Brucella neotomae 5K33]
 gi|256255678|ref|ZP_05461214.1| hypothetical protein BcetB_15638 [Brucella ceti B1/94]
 gi|256258180|ref|ZP_05463716.1| hypothetical protein Babob9C_12716 [Brucella abortus bv. 9 str.
           C68]
 gi|256263295|ref|ZP_05465827.1| transcription factor CarD [Brucella melitensis bv. 2 str. 63/9]
 gi|256370172|ref|YP_003107683.1| transcriptional regulator, CarD family [Brucella microti CCM 4915]
 gi|260167972|ref|ZP_05754783.1| transcriptional regulator, CarD family protein [Brucella sp. F5/99]
 gi|260547126|ref|ZP_05822864.1| transcription factor CarD [Brucella abortus NCTC 8038]
 gi|260565739|ref|ZP_05836222.1| transcription factor CarD [Brucella melitensis bv. 1 str. 16M]
 gi|260568843|ref|ZP_05839311.1| transcription factor CarD [Brucella suis bv. 4 str. 40]
 gi|260755460|ref|ZP_05867808.1| transcriptional regulator [Brucella abortus bv. 6 str. 870]
 gi|260758682|ref|ZP_05871030.1| transcriptional regulator [Brucella abortus bv. 4 str. 292]
 gi|260762517|ref|ZP_05874854.1| transcriptional regulator [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884478|ref|ZP_05896092.1| transcriptional regulator [Brucella abortus bv. 9 str. C68]
 gi|261214731|ref|ZP_05929012.1| transcriptional regulator [Brucella abortus bv. 3 str. Tulya]
 gi|261219348|ref|ZP_05933629.1| transcriptional regulator [Brucella ceti M13/05/1]
 gi|261222884|ref|ZP_05937165.1| transcriptional regulator [Brucella ceti B1/94]
 gi|261316093|ref|ZP_05955290.1| transcriptional regulator [Brucella pinnipedialis M163/99/10]
 gi|261316265|ref|ZP_05955462.1| transcriptional regulator [Brucella pinnipedialis B2/94]
 gi|261322409|ref|ZP_05961606.1| transcriptional regulator [Brucella ceti M644/93/1]
 gi|261325799|ref|ZP_05964996.1| transcriptional regulator [Brucella neotomae 5K33]
 gi|261750916|ref|ZP_05994625.1| transcriptional regulator [Brucella suis bv. 5 str. 513]
 gi|261754170|ref|ZP_05997879.1| transcriptional regulator [Brucella suis bv. 3 str. 686]
 gi|261757414|ref|ZP_06001123.1| transcription factor CarD [Brucella sp. F5/99]
 gi|265984778|ref|ZP_06097513.1| transcriptional regulator [Brucella sp. 83/13]
 gi|265987329|ref|ZP_06099886.1| transcriptional regulator [Brucella pinnipedialis M292/94/1]
 gi|265991795|ref|ZP_06104352.1| transcriptional regulator [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995635|ref|ZP_06108192.1| transcriptional regulator [Brucella melitensis bv. 3 str. Ether]
 gi|265998843|ref|ZP_06111400.1| transcriptional regulator [Brucella ceti M490/95/1]
 gi|306839455|ref|ZP_07472263.1| transcriptional regulator [Brucella sp. NF 2653]
 gi|306844751|ref|ZP_07477336.1| transcriptional regulator [Brucella sp. BO1]
 gi|23348628|gb|AAN30665.1| transcriptional regulator, putative [Brucella suis 1330]
 gi|82616651|emb|CAJ11733.1| Transcription factor CarD [Brucella melitensis biovar Abortus 2308]
 gi|148370124|gb|ABQ60103.1| putative transcriptional regulator [Brucella ovis ATCC 25840]
 gi|161336502|gb|ABX62807.1| Hypothetical protein BCAN_A1804 [Brucella canis ATCC 23365]
 gi|163676066|gb|ABY40176.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189020420|gb|ACD73142.1| Transcription factor CarD [Brucella abortus S19]
 gi|225641581|gb|ACO01495.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|256000335|gb|ACU48734.1| transcriptional regulator, CarD family [Brucella microti CCM 4915]
 gi|260095491|gb|EEW79369.1| transcription factor CarD [Brucella abortus NCTC 8038]
 gi|260151112|gb|EEW86207.1| transcription factor CarD [Brucella melitensis bv. 1 str. 16M]
 gi|260154227|gb|EEW89309.1| transcription factor CarD [Brucella suis bv. 4 str. 40]
 gi|260669000|gb|EEX55940.1| transcriptional regulator [Brucella abortus bv. 4 str. 292]
 gi|260672943|gb|EEX59764.1| transcriptional regulator [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675568|gb|EEX62389.1| transcriptional regulator [Brucella abortus bv. 6 str. 870]
 gi|260874006|gb|EEX81075.1| transcriptional regulator [Brucella abortus bv. 9 str. C68]
 gi|260916338|gb|EEX83199.1| transcriptional regulator [Brucella abortus bv. 3 str. Tulya]
 gi|260921468|gb|EEX88121.1| transcriptional regulator [Brucella ceti B1/94]
 gi|260924437|gb|EEX91005.1| transcriptional regulator [Brucella ceti M13/05/1]
 gi|261295099|gb|EEX98595.1| transcriptional regulator [Brucella ceti M644/93/1]
 gi|261295488|gb|EEX98984.1| transcriptional regulator [Brucella pinnipedialis B2/94]
 gi|261301779|gb|EEY05276.1| transcriptional regulator [Brucella neotomae 5K33]
 gi|261305119|gb|EEY08616.1| transcriptional regulator [Brucella pinnipedialis M163/99/10]
 gi|261737398|gb|EEY25394.1| transcription factor CarD [Brucella sp. F5/99]
 gi|261740669|gb|EEY28595.1| transcriptional regulator [Brucella suis bv. 5 str. 513]
 gi|261743923|gb|EEY31849.1| transcriptional regulator [Brucella suis bv. 3 str. 686]
 gi|262553532|gb|EEZ09301.1| transcriptional regulator [Brucella ceti M490/95/1]
 gi|262766919|gb|EEZ12537.1| transcriptional regulator [Brucella melitensis bv. 3 str. Ether]
 gi|263002751|gb|EEZ15154.1| transcriptional regulator [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093262|gb|EEZ17359.1| transcription factor CarD [Brucella melitensis bv. 2 str. 63/9]
 gi|264659526|gb|EEZ29787.1| transcriptional regulator [Brucella pinnipedialis M292/94/1]
 gi|264663370|gb|EEZ33631.1| transcriptional regulator [Brucella sp. 83/13]
 gi|306274923|gb|EFM56693.1| transcriptional regulator [Brucella sp. BO1]
 gi|306405400|gb|EFM61671.1| transcriptional regulator [Brucella sp. NF 2653]
 gi|326409773|gb|ADZ66838.1| Transcription factor CarD [Brucella melitensis M28]
 gi|326539490|gb|ADZ87705.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 191

 Score =  137 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 129/188 (68%), Positives = 153/188 (81%), Gaps = 2/188 (1%)

Query: 1   MTFQQKRDAMRQG-FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           M+ QQK+  + +G F+ GE IVYPAHGVG I  I+EQEVAG KLE FVI F+KDKM LKV
Sbjct: 1   MSSQQKKSPVARGGFKAGEAIVYPAHGVGQIVTIEEQEVAGHKLELFVIDFEKDKMRLKV 60

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV KA  IGMRKLSE  +VERALK+V+G+ARVKRTMWSRRAQEYDAKINSGDLI+I+EVV
Sbjct: 61  PVAKAASIGMRKLSETDYVERALKVVQGRARVKRTMWSRRAQEYDAKINSGDLISISEVV 120

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ LIEVNL+    K  K+
Sbjct: 121 RDLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKLSETEAVRLIEVNLAKG-PKRGKA 179

Query: 180 TSENQDKA 187
            +E  D  
Sbjct: 180 EAELDDDE 187


>gi|254441381|ref|ZP_05054874.1| CarD-like transcriptional regulator family [Octadecabacter
           antarcticus 307]
 gi|198251459|gb|EDY75774.1| CarD-like transcriptional regulator family [Octadecabacter
           antarcticus 307]
          Length = 170

 Score =  137 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 95/165 (57%), Positives = 119/165 (72%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
              +  +   + +VYPAHGVG +  I+ QE+AG +LE FVIAF+KDKM L+VP  KA ++
Sbjct: 2   AKKKYDYSPNDFVVYPAHGVGKVVSIETQEIAGFELEMFVIAFEKDKMTLRVPTNKAEEV 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMR L+    V   +K +RGKA+VK+ MWSRRAQEY+ KINSGDLIAIAEVVRDLHR D 
Sbjct: 62  GMRSLASTDVVADCMKTLRGKAKVKKAMWSRRAQEYEQKINSGDLIAIAEVVRDLHRADD 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           Q E+SYSERQLYE+AL R+ RE AAV + +E EA   I   L S+
Sbjct: 122 QREQSYSERQLYEAALERLTREFAAVGNGNELEAGTEITDTLQSR 166


>gi|19553858|ref|NP_601860.1| transcriptional regulator [Corynebacterium glutamicum ATCC 13032]
 gi|62391499|ref|YP_226901.1| CarD-like transcriptional regulator [Corynebacterium glutamicum
           ATCC 13032]
 gi|21325433|dbj|BAC00055.1| Transcriptional regulators, similar to M. xanthus CarD
           [Corynebacterium glutamicum ATCC 13032]
 gi|41326841|emb|CAF20685.1| CarD-like transcriptional regulator [Corynebacterium glutamicum
           ATCC 13032]
          Length = 198

 Score =  137 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 87/174 (50%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG   I+ ++++E+ G  +++ V+  +   + ++VP   A  +G+R +
Sbjct: 2   EFKVGDTVVYPHHGAAIISALEQREMNGETVDYLVLQINHSDLVVRVPAKNAELVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +++   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGEEGLQKVFSVLREIDVEEAGNWSRRYKANQERLASGDVNKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDK 186
             E+++   A   +V E+A   ++ + +A   +     + +        + ++K
Sbjct: 122 AGEKRMLSKARQVLVGELALAETVDDEKADAFLSQVDETIARHRADLLGDEEEK 175


>gi|134298063|ref|YP_001111559.1| CarD family transcriptional regulator [Desulfotomaculum reducens
           MI-1]
 gi|134050763|gb|ABO48734.1| transcriptional regulator, CarD family [Desulfotomaculum reducens
           MI-1]
          Length = 158

 Score =  137 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 87/158 (55%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG G I  I+E+EV G K +++++      M + +P+    D+G+R +
Sbjct: 1   MFKIGDKVVYPMHGAGVIEAIEEKEVLGKKRQYYILRLPIGDMKVMIPISNCDDVGLRGI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   V   L+++ G+  V    W+RR +    KI SGD+  +AEVVR+L   D +   S
Sbjct: 61  IDRDEVSTVLEVLEGQTTVMSGNWNRRYRANLEKIKSGDIYEVAEVVRNLLTRDKEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             ER++ E+A   ++ E+     + E +A +LI+   +
Sbjct: 121 SGERKMLENARQILISELVLAAEMEETKARSLIDEVFA 158


>gi|284028991|ref|YP_003378922.1| CarD family transcriptional regulator [Kribbella flavida DSM 17836]
 gi|283808284|gb|ADB30123.1| transcriptional regulator, CarD family [Kribbella flavida DSM
           17836]
          Length = 161

 Score =  137 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 84/159 (52%), Gaps = 1/159 (0%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFV-IAFDKDKMCLKVPVGKAIDIGMRKL 72
           F  GE +VYP HG   I +I+ +++ G    + V     ++ + ++VP      +G+R +
Sbjct: 3   FTVGETVVYPNHGAAVIEDIETRQIKGEDKTYLVLRIVAQNDLVVRVPACNLDLVGVRDV 62

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +ER   ++R     + T WSRR +    K++SGD++ +AEVVRDL R +     S
Sbjct: 63  VDQAGLERVFDVLRAPHTEEPTNWSRRYKANLEKLHSGDVMKVAEVVRDLWRRERDRGLS 122

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E+++   A   +V E+A     +E +A  +++  L+S
Sbjct: 123 AGEKRMLAKARQILVSELALAEHTNEDKAEAILDEVLAS 161


>gi|256824253|ref|YP_003148213.1| CarD family transcriptional regulator [Kytococcus sedentarius DSM
           20547]
 gi|256687646|gb|ACV05448.1| transcriptional regulator, CarD family [Kytococcus sedentarius DSM
           20547]
          Length = 160

 Score =  137 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 84/158 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I E+K+++V G ++ +  +   +  + ++VP      +G+R + 
Sbjct: 3   FEVGETVVYPHHGAALIEEVKQRKVKGKEMTYLKLKVAQGDLTIEVPAENCDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +A  +E+   ++R +   + T WSRR +    K+ SGD+I +AEVVRDL R +     S 
Sbjct: 63  DAEGLEKVFGVLRAENCEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLWRREQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E  A   ++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAEKTDEERAEATLDEVLAS 160


>gi|325000162|ref|ZP_08121274.1| CarD family transcriptional regulator [Pseudonocardia sp. P1]
          Length = 163

 Score =  137 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 44/161 (27%), Positives = 84/161 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I  I+ + + G ++++ V+   +  + +++P      +G+R + 
Sbjct: 3   FKVGETVVYPHHGAALIEAIETRTIKGEEVQYLVLKVQQGDLTVRIPADNVEVVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R +     S 
Sbjct: 63  GQEGLDRVFEVLRAPHTEEPTNWSRRYKANWEKLTSGDVNKVAEVVRDLWRREKDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            E+++   A   +V E+A      E  A  L++  L++ ++
Sbjct: 123 GEKRMLGKARQILVSELALAEGTDEERAEVLLDEVLATATA 163


>gi|307294532|ref|ZP_07574374.1| transcriptional regulator, CarD family [Sphingobium
           chlorophenolicum L-1]
 gi|306879006|gb|EFN10224.1| transcriptional regulator, CarD family [Sphingobium
           chlorophenolicum L-1]
          Length = 175

 Score =  137 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 88/173 (50%), Positives = 126/173 (72%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            A    F  G+++VYP HGVG + E++++++AGM+LE +V+ F+K++M L+VP  KA  +
Sbjct: 2   AAKALSFDVGDYVVYPKHGVGRVIELQKEQIAGMELELYVLRFEKERMTLRVPTNKAEGV 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMRKLS    +E A++ ++GK +VKRTMWSRRAQEY+AKINSGDL++IAEV RDL R D 
Sbjct: 62  GMRKLSSNKTLEEAVETLKGKPKVKRTMWSRRAQEYEAKINSGDLVSIAEVTRDLFRADD 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           QPE+SYSERQ++E+A +R+ RE+AA+    EP A+  I   L+  + K  K  
Sbjct: 122 QPEQSYSERQIFEAASSRLARELAAMEETDEPSALKKILRILNEAAPKHVKVE 174


>gi|315657561|ref|ZP_07910443.1| CarD family transcriptional regulator [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
 gi|315492033|gb|EFU81642.1| CarD family transcriptional regulator [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
          Length = 160

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 86/158 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG  TI EI  + + G++ E+  +   +  + +++P      +G+R + 
Sbjct: 3   FKVGETVVYPHHGAATIEEIITRVIGGVEREYLKLRVAQGDLTIQIPSENVEMVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +E   +++R K   + + WSRR +    KI +GD++ +AEVVRDL R DS    S 
Sbjct: 63  DEAGLEHVFEVLRAKKTDEPSNWSRRYKANVEKIATGDVVKVAEVVRDLSRRDSNRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A     +E +A   ++  L+S
Sbjct: 123 GEKRMLSKARQILVSELALAEKTNEEDASLRLDEVLAS 160


>gi|229819270|ref|YP_002880796.1| CarD family transcriptional regulator [Beutenbergia cavernae DSM
           12333]
 gi|229565183|gb|ACQ79034.1| transcriptional regulator, CarD family [Beutenbergia cavernae DSM
           12333]
          Length = 160

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 79/158 (50%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I EI  + + G +  +  +   +  + ++VP      +G+R + 
Sbjct: 3   FNVGETVVYPHHGAALIEEISTRVIRGEEKLYLRLRVAQGDLTIEVPAENVDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T WSRR +    KI SGD+I +AEVVRDL R D     S 
Sbjct: 63  GKEGLDKVFEVLRAPYTEEPTNWSRRYKANVEKIASGDVIKVAEVVRDLSRRDQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E  A  +++  L+S
Sbjct: 123 GEKRMLARARQILVSELALAEKTEEDRAEAILDEVLAS 160


>gi|90420275|ref|ZP_01228183.1| transcriptional regulator, CarD family [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335609|gb|EAS49359.1| transcriptional regulator, CarD family [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 205

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 127/176 (72%), Positives = 147/176 (83%)

Query: 3   FQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
             QK+ + RQGF+TGE IVYPAHGVG I  I+EQEVAGMKLE FVI F+KDKM LKVPV 
Sbjct: 2   SSQKKASNRQGFKTGESIVYPAHGVGQIVAIEEQEVAGMKLELFVIDFEKDKMRLKVPVA 61

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
           KA  +GMRKLSE  FVER+LK+V+G+ARVK+TMWSRRAQEYDAKINSGDLI IAEVVRDL
Sbjct: 62  KAESVGMRKLSETDFVERSLKVVQGRARVKKTMWSRRAQEYDAKINSGDLIQIAEVVRDL 121

Query: 123 HRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEK 178
           +R DSQPE+SYSERQLYE+AL RM RE+AAVN +SE EA+ LIE+NL+    +  K
Sbjct: 122 YRADSQPEQSYSERQLYEAALGRMARELAAVNEVSETEAVQLIELNLNKGPKRVAK 177


>gi|302331432|gb|ADL21626.1| Transcriptional regulator [Corynebacterium pseudotuberculosis 1002]
          Length = 193

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 49/173 (28%), Positives = 88/173 (50%), Gaps = 4/173 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG   I  I+++E+ G  LEF V+  ++  + ++VP   A  +G+R +
Sbjct: 2   EFKVGDTVVYPHHGAAVIEAIEQREMNGETLEFLVLHINQSDLVVRVPSKNAELVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +++    +R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VDDEGLQKVFGFLREIDVEEAGNWSRRFKANQGRLASGDVNKVAEVVRDLWRRDQGRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQD 185
             E+++   A   +V E+A   +I E +A    +  L+   +  E+  +   D
Sbjct: 122 AGEKRMLAKARQVLVGELALAENIDENKA----DELLAQVDATVERHRAAGVD 170


>gi|114705884|ref|ZP_01438787.1| hypothetical protein FP2506_15499 [Fulvimarina pelagi HTCC2506]
 gi|114538730|gb|EAU41851.1| hypothetical protein FP2506_15499 [Fulvimarina pelagi HTCC2506]
          Length = 204

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 123/178 (69%), Positives = 146/178 (82%), Gaps = 1/178 (0%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M+  +K  +  +GF+TGE IVYPAHGVG I  I+EQEVAGMKLE FV+ F+KDKM LKVP
Sbjct: 1   MSSPKK-ASASKGFKTGESIVYPAHGVGKIVAIEEQEVAGMKLELFVVDFEKDKMRLKVP 59

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA  +GMRKLSE  FV+RALK+V+G+ARVK+TMWSRRAQEYDAKINSGDLI IAEVVR
Sbjct: 60  VAKAKSVGMRKLSETDFVDRALKVVQGRARVKKTMWSRRAQEYDAKINSGDLIQIAEVVR 119

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEK 178
           DL+R D+QPE+SYSERQLYE+AL RM RE+AAVN +SE EA+ LIE NL+    +  K
Sbjct: 120 DLYRADTQPEQSYSERQLYEAALGRMARELAAVNEVSETEAVRLIEENLNKGPKRGPK 177


>gi|149185279|ref|ZP_01863596.1| transcriptional regulator [Erythrobacter sp. SD-21]
 gi|148831390|gb|EDL49824.1| transcriptional regulator [Erythrobacter sp. SD-21]
          Length = 177

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 84/175 (48%), Positives = 125/175 (71%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            +    F  G+++VYP HGVG + E++ +E+AGM+L+ +V+ F+K++M L+VPV K   I
Sbjct: 2   ASKADAFDVGDYVVYPKHGVGRVIELQSEEIAGMQLDLYVLRFEKERMTLRVPVNKVESI 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMRKLS    ++ A++ ++GK +VKRTMWSRRAQEY+AKINSG+++ IAEV RDL R D 
Sbjct: 62  GMRKLSSDKTLKEAMETLKGKPKVKRTMWSRRAQEYEAKINSGEIVLIAEVTRDLFRPDD 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSE 182
           QPE+SYSERQ++E+A +R+ RE+AA+    E  A+  I   L   + +  ++T E
Sbjct: 122 QPEQSYSERQIFEAASSRLARELAAMEKTDEATALEKILDVLREHAPQYYENTEE 176


>gi|182680042|ref|YP_001834188.1| CarD family transcriptional regulator [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635925|gb|ACB96699.1| transcriptional regulator, CarD family [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 368

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 108/175 (61%), Positives = 137/175 (78%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
           +A R GF+  E IVYPAHGVG I  I+EQEVAG KLE FVI+F KDKM LKVP  KA+ +
Sbjct: 178 NAQRHGFKPLEFIVYPAHGVGQIIAIEEQEVAGFKLELFVISFVKDKMILKVPTPKAVSV 237

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
            MRKL+EA  +++AL+ + G+AR+KRTMWSRRAQEY+AKINSGDLIA+AEVVRDL+R+D+
Sbjct: 238 RMRKLAEADVIDKALETLTGRARIKRTMWSRRAQEYEAKINSGDLIAVAEVVRDLYRSDA 297

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSE 182
           QPE+SYSERQLYE+AL+R+ RE+AAV  ++E E++ LIE  L     +      E
Sbjct: 298 QPEQSYSERQLYEAALDRVARELAAVQKLTETESLKLIEAQLLKGPRRGGSKVEE 352


>gi|256372655|ref|YP_003110479.1| CarD family transcriptional regulator [Acidimicrobium ferrooxidans
           DSM 10331]
 gi|256009239|gb|ACU54806.1| transcriptional regulator, CarD family [Acidimicrobium ferrooxidans
           DSM 10331]
          Length = 159

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 76/157 (48%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  G+ +VYP HG   IT  +  E  G   E+FV+      + +++PV    ++G+R++ 
Sbjct: 3   FDVGDKVVYPQHGAAVITGREVVEAFGEAKEYFVVTVAYGDLTVRLPVDAVDEVGLREVI 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               VE    ++  K       WSRR + +  K+ SGD+  +AEVVR+L   D     S 
Sbjct: 63  NDEEVEEVFAVLGKKDVRMPANWSRRYKNHLEKVKSGDIYQVAEVVRNLTLRDHDKGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            ER++   A   +V E+     ++  EA   ++  L+
Sbjct: 123 GERRMLAKARQVLVSELTFALDVAPEEAEARLDKALA 159


>gi|291297677|ref|YP_003508955.1| CarD family transcriptional regulator [Stackebrandtia nassauensis
           DSM 44728]
 gi|290566897|gb|ADD39862.1| transcriptional regulator, CarD family [Stackebrandtia nassauensis
           DSM 44728]
          Length = 161

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/160 (28%), Positives = 86/160 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  GE +VYP HG   I  ++ + + G++ E+ V+  ++  + ++VP G    +G+R++
Sbjct: 2   SFSVGETVVYPHHGAALIEAVETRTIKGVEQEYLVLRVEQGDLTVRVPAGNVELVGVREV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
             A  +     ++R     + T WSRR +    K+ SG+ + +AEVVRDL R D +   S
Sbjct: 62  VGAEGLTEVFDVLRAPHTEEPTNWSRRYKANLEKLASGNPLKVAEVVRDLWRRDRERGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
             E+++   A + +V E+A   + ++ +A  L++  L+  
Sbjct: 122 AGEKRMLTKARDILVGEVALAEASTKDDAEVLLDKVLAEA 161


>gi|62290636|ref|YP_222429.1| transcriptional regulator [Brucella abortus bv. 1 str. 9-941]
 gi|254689925|ref|ZP_05153179.1| transcriptional regulator [Brucella abortus bv. 6 str. 870]
 gi|254730960|ref|ZP_05189538.1| transcriptional regulator [Brucella abortus bv. 4 str. 292]
 gi|256114331|ref|ZP_05455069.1| transcriptional regulator [Brucella melitensis bv. 3 str. Ether]
 gi|256160471|ref|ZP_05458160.1| transcriptional regulator [Brucella ceti M490/95/1]
 gi|297249030|ref|ZP_06932738.1| CarD family transcriptional regulator [Brucella abortus bv. 5 str.
           B3196]
 gi|62196768|gb|AAX75068.1| hypothetical transcriptional regulator [Brucella abortus bv. 1 str.
           9-941]
 gi|297174163|gb|EFH33520.1| CarD family transcriptional regulator [Brucella abortus bv. 5 str.
           B3196]
          Length = 194

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 129/188 (68%), Positives = 153/188 (81%), Gaps = 2/188 (1%)

Query: 1   MTFQQKRDAMRQG-FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           M+ QQK+  + +G F+ GE IVYPAHGVG I  I+EQEVAG KLE FVI F+KDKM LKV
Sbjct: 4   MSSQQKKSPVARGGFKAGEAIVYPAHGVGQIVTIEEQEVAGHKLELFVIDFEKDKMRLKV 63

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV KA  IGMRKLSE  +VERALK+V+G+ARVKRTMWSRRAQEYDAKINSGDLI+I+EVV
Sbjct: 64  PVAKAASIGMRKLSETDYVERALKVVQGRARVKRTMWSRRAQEYDAKINSGDLISISEVV 123

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ LIEVNL+    K  K+
Sbjct: 124 RDLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKLSETEAVRLIEVNLAKG-PKRGKA 182

Query: 180 TSENQDKA 187
            +E  D  
Sbjct: 183 EAELDDDE 190


>gi|25029078|ref|NP_739132.1| putative transcription factor [Corynebacterium efficiens YS-314]
 gi|23494365|dbj|BAC19332.1| putative transcription factor [Corynebacterium efficiens YS-314]
          Length = 200

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 89/174 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG   IT ++++E+ G  +++ V+  ++  + ++VP   A  +G+R +
Sbjct: 4   DFKVGDTVVYPHHGAAMITALEQRELNGETMDYLVLKINQSDLVVRVPAKNAELVGVRDV 63

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +++   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 64  VGEEGLQKVFSVLRETDVEEAGNWSRRYKANQERLASGDVNKVAEVVRDLWRRDQDRGLS 123

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDK 186
             E+++   A   +V E+A   ++ E +A   +     + +        ++++K
Sbjct: 124 AGEKRMLAKARQVLVGELALAETVDEAKADAFLAEVDETIARHRADLLGDDEEK 177


>gi|298345944|ref|YP_003718631.1| putative transcription factor CarD [Mobiluncus curtisii ATCC 43063]
 gi|304390353|ref|ZP_07372306.1| CarD family transcriptional regulator [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315654533|ref|ZP_07907439.1| CarD family transcriptional regulator [Mobiluncus curtisii ATCC
           51333]
 gi|298236005|gb|ADI67137.1| possible transcription factor CarD [Mobiluncus curtisii ATCC 43063]
 gi|304326109|gb|EFL93354.1| CarD family transcriptional regulator [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315490997|gb|EFU80616.1| CarD family transcriptional regulator [Mobiluncus curtisii ATCC
           51333]
          Length = 160

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 86/158 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG  TI EI  + + G++ E+  +   +  + +++P      +G+R + 
Sbjct: 3   FKVGETVVYPHHGAATIEEIITRVIGGVEREYLKLRVAQGDLTIQIPSENVEMVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +E   +++R K   + + WSRR +    KI +GD++ +AEVVRDL R DS    S 
Sbjct: 63  DEAGLEHVFEVLRAKKTDEPSNWSRRYKANVEKIATGDVVKVAEVVRDLSRRDSNRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A     +E +A   ++  L+S
Sbjct: 123 GEKRMLTKARQILVSELALAEKTNEEDASLRLDEVLAS 160


>gi|172041356|ref|YP_001801070.1| putative transcription factor [Corynebacterium urealyticum DSM
           7109]
 gi|171852660|emb|CAQ05636.1| putative transcription factor [Corynebacterium urealyticum DSM
           7109]
          Length = 190

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/179 (23%), Positives = 85/179 (47%), Gaps = 3/179 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG   I  I+++E  G  +++ V+   +  + ++VP   A  +G+R +
Sbjct: 2   DFKVGDTVVYPHHGAAQIEGIEQREFKGETVDYLVLRLYQGDLSVRVPAANAEKVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                + +   ++R     +   WSRR +    ++ SGD   +AEVVRDL R D     S
Sbjct: 62  VGEEGLLKVFSVLRETDVEEAGNWSRRYKANQERLTSGDQNKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEA---INLIEVNLSSKSSKTEKSTSENQDKAA 188
             E+++   A   +V E+A  + + + +A   +  +   +     +   + + + +  A
Sbjct: 122 AGEKRMLAKARQILVGELALADGVDDKKADAMLAEMHETIERHREQAAAARAADTEGDA 180


>gi|254473139|ref|ZP_05086537.1| transcription factor CarD [Pseudovibrio sp. JE062]
 gi|211957860|gb|EEA93062.1| transcription factor CarD [Pseudovibrio sp. JE062]
          Length = 193

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 111/186 (59%), Positives = 141/186 (75%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M    K+ A RQGF+TGEHI+YP+HGVG IT I+EQ VAG  LE  VI F++DKM L+VP
Sbjct: 1   MATPAKKTAQRQGFKTGEHIIYPSHGVGLITAIEEQTVAGYSLELLVIEFEQDKMTLRVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V K   +GMRKLS+A  V+++L+ + GK RVKRTMWSRRAQEY+AKINSGDL++ AEVVR
Sbjct: 61  VAKIASVGMRKLSDASTVKKSLETIAGKPRVKRTMWSRRAQEYEAKINSGDLVSTAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL+R+D+QPE+SYSERQLYE+AL+RM REIAAV   ++ EAI  IE  LS+   +  K+ 
Sbjct: 121 DLYRSDAQPEQSYSERQLYEAALDRMAREIAAVQKQTDTEAIRQIEGVLSTAPGRAAKAA 180

Query: 181 SENQDK 186
               + 
Sbjct: 181 PAAGED 186


>gi|315226414|ref|ZP_07868202.1| CarD family transcriptional regulator [Parascardovia denticolens
           DSM 10105]
 gi|315120546|gb|EFT83678.1| CarD family transcriptional regulator [Parascardovia denticolens
           DSM 10105]
          Length = 260

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 89/180 (49%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
            ++ G+ +VYP HG   I EI E+ + G+   +  +       + + VP      +G+R+
Sbjct: 32  EYKVGDTVVYPRHGAARIEEITERTLRGVTRIYLRLTVLSSDGLEISVPADAVDKVGVRE 91

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE- 130
           +     V +  +++R     ++T WSRR +    KI +GD+  IAEVVRDL + D     
Sbjct: 92  VVNGVAVAKVFEILRTPIVEEKTNWSRRYKLNVEKIATGDVNKIAEVVRDLSQRDDDEHG 151

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A N +  EIA    I + EA  L++VNL         EK  ++  ++AA
Sbjct: 152 LSAGEKRMLSKARNILTSEIALSEKIDDEEAQRLLDVNLGYQDPEPGDEKHHAQAPEEAA 211


>gi|259505930|ref|ZP_05748832.1| transcription factor [Corynebacterium efficiens YS-314]
 gi|259166411|gb|EEW50965.1| transcription factor [Corynebacterium efficiens YS-314]
          Length = 198

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 89/174 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG   IT ++++E+ G  +++ V+  ++  + ++VP   A  +G+R +
Sbjct: 2   DFKVGDTVVYPHHGAAMITALEQRELNGETMDYLVLKINQSDLVVRVPAKNAELVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +++   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGEEGLQKVFSVLRETDVEEAGNWSRRYKANQERLASGDVNKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDK 186
             E+++   A   +V E+A   ++ E +A   +     + +        ++++K
Sbjct: 122 AGEKRMLAKARQVLVGELALAETVDEAKADAFLAEVDETIARHRADLLGDDEEK 175


>gi|269957734|ref|YP_003327523.1| CarD family transcriptional regulator [Xylanimonas cellulosilytica
           DSM 15894]
 gi|269306415|gb|ACZ31965.1| transcriptional regulator, CarD family [Xylanimonas cellulosilytica
           DSM 15894]
          Length = 160

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 83/158 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I EIK + + G +  +  +   +  + ++VP      +G+R + 
Sbjct: 3   FEVGETVVYPHHGAALIEEIKVRTIRGEEKMYLKLKVAQGDLTIEVPAENVDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++R  +++R     + T WSRR +    K+ SGD+I +AEVVRDL R D+    S 
Sbjct: 63  DQQGLDRVFEVLRAPYTEEPTNWSRRYKANLEKLASGDVIKVAEVVRDLSRRDADRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E +A  +++  L+S
Sbjct: 123 GEKRMLSKARQILVSELALAEHTEEDKAEAILDEVLAS 160


>gi|225022144|ref|ZP_03711336.1| hypothetical protein CORMATOL_02177 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945077|gb|EEG26286.1| hypothetical protein CORMATOL_02177 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 235

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/156 (28%), Positives = 77/156 (49%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG   I  I+++E+ G  LE+ V+   +  + ++VP   A  +G+R +
Sbjct: 41  EFKVGDTVVYPHHGAAVIEAIEQREMGGETLEYLVLQIHQSDLVVRVPSKNAETVGVRDV 100

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                + +    +R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 101 VGEAGLRKVFGFLRETDVEEAGNWSRRFKANQERLASGDVNKVAEVVRDLWRRDQGKGLS 160

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
             E+++   A   +V E+A      E +A  L+   
Sbjct: 161 AGEKRMLAKARQVLVGELALAEIKDEAKANELLAEV 196


>gi|239832849|ref|ZP_04681178.1| transcriptional regulator [Ochrobactrum intermedium LMG 3301]
 gi|239825116|gb|EEQ96684.1| transcriptional regulator [Ochrobactrum intermedium LMG 3301]
          Length = 209

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 124/176 (70%), Positives = 146/176 (82%), Gaps = 1/176 (0%)

Query: 1   MTFQQKRDAMRQG-FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           M+ QQK+  + +G F+ GE IVYPAHGVG I  I+EQEVAG KLE FVI F+KDKM LKV
Sbjct: 17  MSSQQKKSPVARGGFKAGEAIVYPAHGVGQIVTIEEQEVAGHKLELFVIDFEKDKMRLKV 76

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV KA  IGMRKLSE  +VERALK+V+G+ARVKRTMWSRRAQEYDAKINSGDLI+I+EVV
Sbjct: 77  PVAKAASIGMRKLSETDYVERALKVVQGRARVKRTMWSRRAQEYDAKINSGDLISISEVV 136

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSK 175
           RDL R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ LIE NL+    +
Sbjct: 137 RDLFRAENQPEQSYSERQLYEAALDRMAREIAAVNKLSETEAVRLIEANLAKGPKR 192


>gi|254486669|ref|ZP_05099874.1| transcriptional regulator, CarD family [Roseobacter sp. GAI101]
 gi|214043538|gb|EEB84176.1| transcriptional regulator, CarD family [Roseobacter sp. GAI101]
          Length = 171

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 102/172 (59%), Positives = 124/172 (72%), Gaps = 5/172 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M+  +K       FR  E +VYPAHGVG I  ++EQE+AG+ LE FVIAF+KDKM L+VP
Sbjct: 1   MSKSKK-----LDFRPNEFVVYPAHGVGQIVSVEEQEIAGISLELFVIAFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA +IGMR LS    +  A+K ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 56  THKATEIGMRSLSSPDTITHAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV    E  A   +   L S+
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVAGGDELAAAKQVGDVLESR 167


>gi|145296658|ref|YP_001139479.1| hypothetical protein cgR_2565 [Corynebacterium glutamicum R]
 gi|140846578|dbj|BAF55577.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 198

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 87/174 (50%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG   I+ ++++E+ G  +++ V+  +   + ++VP   A  +G+R +
Sbjct: 2   EFKVGDTVVYPHHGAAIISALEQREMNGETVDYLVLQINHSDLVVRVPAKNAELVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +++   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGEEGLQKVFSVLREIDVEEAGNWSRRYKANQERLASGDVNKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDK 186
             E+++   A   +V E+A   ++ + +A   +     + +        + ++K
Sbjct: 122 AGEKRMLSKARQVLVGELALAETVDDVKADAFLSQVDETIARHRADLLGDEEEK 175


>gi|323359180|ref|YP_004225576.1| CarD family transcriptional regulator [Microbacterium testaceum
           StLB037]
 gi|323275551|dbj|BAJ75696.1| transcriptional regulator, similar to M. xanthus CarD
           [Microbacterium testaceum StLB037]
          Length = 160

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 81/158 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG  TI E+KE+ + G   ++  +   +  + ++VP      +G+R + 
Sbjct: 3   FEVGETVVYPHHGAATIIEVKERVIKGETKKYLKLNVTQGDLVIEVPADNVDLVGVRDVI 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R   ++R     + T WSRR +    K+ SGD+I ++EVVRDL R D     S 
Sbjct: 63  GKEGLDRVFDVLRAPFTEEPTNWSRRYKANLEKLASGDVIKVSEVVRDLWRRDQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E  A  +++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAEKTDEDRASVVLDEVLAS 160


>gi|169830398|ref|YP_001716380.1| CarD family transcriptional regulator [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637242|gb|ACA58748.1| transcriptional regulator, CarD family [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 158

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 44/158 (27%), Positives = 86/158 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG G I  I+E+E+ G + +++V+      M + VP     +IG+R++
Sbjct: 1   MFKIGDKVVYPMHGAGVIEAIEEKEILGERQQYYVLRLPVGNMKVMVPTANGPNIGLRQV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                V++   +++  +      W+RR +    KI SG++  +AEVVR+L R + +   S
Sbjct: 61  IGQEEVQKVFGILKDVSTQMPGNWNRRYRANLEKIKSGNIYEVAEVVRNLARREREKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             E+++ ESA   ++ E+     + E +A +++E   +
Sbjct: 121 SGEKRMLESARQILISELVLATEVEEDKARSMLEEMFA 158


>gi|89893187|ref|YP_516674.1| hypothetical protein DSY0441 [Desulfitobacterium hafniense Y51]
 gi|219666460|ref|YP_002456895.1| CarD family transcriptional regulator [Desulfitobacterium hafniense
           DCB-2]
 gi|89332635|dbj|BAE82230.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219536720|gb|ACL18459.1| transcriptional regulator, CarD family [Desulfitobacterium
           hafniense DCB-2]
          Length = 158

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/158 (28%), Positives = 84/158 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG G I  I+E+EV G   +++V+      M + +P+     +G+R +
Sbjct: 1   MFDIGDRVVYPMHGAGIIEAIEEREVLGESHQYYVMNIPVGNMKVYIPLKNVNQLGIRGV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
             +  V + LK++  ++ +    W+RR +    +I SGD+ ++AEVVR L + D +   S
Sbjct: 61  ISSEEVPQVLKILENESTLPALAWNRRYRANMDRIKSGDIYSVAEVVRSLSQRDREKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             E+++Y++A   +V E+     +   E    I+  L+
Sbjct: 121 TGEKKMYDNAYQILVSELILAEGVQADEMSERIKGLLA 158


>gi|154252146|ref|YP_001412970.1| CarD family transcriptional regulator [Parvibaculum lavamentivorans
           DS-1]
 gi|154156096|gb|ABS63313.1| transcriptional regulator, CarD family [Parvibaculum
           lavamentivorans DS-1]
          Length = 350

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 109/178 (61%), Positives = 139/178 (78%), Gaps = 1/178 (0%)

Query: 11  RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMR 70
           R  F+  E +VYPAHGVG I +I+EQEVAG KLE FVI FDK+KM L+VP  KA  +GMR
Sbjct: 173 RANFKAKEFVVYPAHGVGQILDIEEQEVAGHKLELFVINFDKEKMTLRVPTNKAGAVGMR 232

Query: 71  KLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
           KLS+A  V+ A++ +RG+AR+KRTMWSRRAQEY+AKINSGDLI+IAEVVRDL+R++ QPE
Sbjct: 233 KLSDAGVVDSAIETLRGRARIKRTMWSRRAQEYEAKINSGDLISIAEVVRDLYRSERQPE 292

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDKAA 188
           +SYSERQLYE+AL+RM RE+AAV  I E  AI  +E  L   ++KT+K+   ++   A
Sbjct: 293 QSYSERQLYEAALDRMAREVAAVERIGEDAAIERVEQAL-QGAAKTDKAPKSDEASEA 349


>gi|167648071|ref|YP_001685734.1| CarD family transcriptional regulator [Caulobacter sp. K31]
 gi|167350501|gb|ABZ73236.1| transcriptional regulator, CarD family [Caulobacter sp. K31]
          Length = 170

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 97/162 (59%), Positives = 126/162 (77%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+H+VYPAHGVG+I  ++ QEVAGM LE ++I FD +KM L+VP  KA   G+R L
Sbjct: 7   EFSVGDHVVYPAHGVGSIQGVETQEVAGMSLEVYIITFDHEKMTLRVPTKKAKTAGLRPL 66

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +E + V +AL  ++G+ARVKRTMWSRRAQEY+AKINSGDLI+IAEVVRDLHR ++QPE+S
Sbjct: 67  AEGNVVSQALTTLKGRARVKRTMWSRRAQEYEAKINSGDLISIAEVVRDLHRAENQPEQS 126

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           YSERQLYESAL+RM RE+AA+  I    AI ++  +L   ++
Sbjct: 127 YSERQLYESALDRMAREVAAIERIDREAAIGILTKSLVKTAA 168


>gi|147676622|ref|YP_001210837.1| transcriptional regulator [Pelotomaculum thermopropionicum SI]
 gi|146272719|dbj|BAF58468.1| transcriptional regulator [Pelotomaculum thermopropionicum SI]
          Length = 158

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/158 (29%), Positives = 88/158 (55%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG G I  I+E+EV G K +++++      M + +P+    ++G+R +
Sbjct: 1   MFKIGDKVVYPMHGAGVIEAIEEKEVLGEKRQYYILRLPVGDMKVMIPITSGEEVGLRGV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   V+R   ++R ++      W+RR +    KI SG++  +AEVVR+L + D +   S
Sbjct: 61  IDREGVQRVFHILRQQSSAMSPNWNRRYRANLEKIKSGNIYEVAEVVRNLVKRDREKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             ER++ ESA   ++ E+     + E +A +L++   +
Sbjct: 121 SGERKMLESARQILLSELVLATELEEEKAQSLLDGAFA 158


>gi|240851257|ref|YP_002972660.1| transcriptional regulator, CarD family [Bartonella grahamii as4aup]
 gi|240268380|gb|ACS51968.1| transcriptional regulator, CarD family [Bartonella grahamii as4aup]
          Length = 194

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 120/188 (63%), Positives = 147/188 (78%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  Q    +  + F T E+IVYP HGVG I  I++QEVAG KL+ FVI F KDKM +KVP
Sbjct: 1   MASQHGTSSKTKEFATSEYIVYPTHGVGQIIAIEDQEVAGHKLKLFVIHFAKDKMDVKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           + KA+ +GMRKLS +  VERALK++RGKARVKRTMWSRRAQEYDAKINSGDLI IAEVVR
Sbjct: 61  IAKALSVGMRKLSASDSVERALKVLRGKARVKRTMWSRRAQEYDAKINSGDLICIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL R++ QPE+SYSERQLY +AL RM REIA +NS+SE EAINLIE++LS+K  +  K+ 
Sbjct: 121 DLFRSNLQPEQSYSERQLYTAALERMAREIAVINSLSETEAINLIEMHLSNKPKREFKTE 180

Query: 181 SENQDKAA 188
            E  D+++
Sbjct: 181 REETDESS 188


>gi|85375450|ref|YP_459512.1| transcriptional regulator [Erythrobacter litoralis HTCC2594]
 gi|84788533|gb|ABC64715.1| transcriptional regulator [Erythrobacter litoralis HTCC2594]
          Length = 178

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 84/176 (47%), Positives = 123/176 (69%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            A    F  G+++VYP HGVG + E++ +E+AGM+LE +V+ F+K++M L+VP  K   I
Sbjct: 2   AAKALAFDVGDYVVYPKHGVGRVIELQNEEIAGMQLELYVLRFEKERMTLRVPTNKVESI 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMRKLS    ++ A++ ++GK +VKRTMWSRRAQEY+AKINSG+++ IAEV RDL R D 
Sbjct: 62  GMRKLSSDKTLKEAMETLKGKPKVKRTMWSRRAQEYEAKINSGEIVLIAEVTRDLFRPDD 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSEN 183
           QPE+SYSERQ++E+A +R+ RE+AA+    E  A+  I   L   + +   +  E+
Sbjct: 122 QPEQSYSERQIFEAASSRLARELAAMEKTDEATALEKILDVLREHAPQYYNNEEED 177


>gi|319442432|ref|ZP_07991588.1| putative transcription factor [Corynebacterium variabile DSM 44702]
          Length = 194

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/153 (26%), Positives = 78/153 (50%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG   +  I+++E  G  +++ V+   +  + +KVP   A  +G+R +
Sbjct: 2   EFNIGDVVVYPHHGAAEVKGIEQREFKGQSVDYLVLRILQGDLLVKVPAANAELVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +++   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGEEGLQKVFSVLRETDVEEAGNWSRRYKANQERLASGDVNRVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLI 165
             E+++   A   +V E+A    + + ++  +I
Sbjct: 122 AGEKRMLAKARQVLVGELALAEGVDDKKSDEVI 154


>gi|294851010|ref|ZP_06791686.1| CarD family transcriptional regulator [Brucella sp. NVSL 07-0026]
 gi|294821653|gb|EFG38649.1| CarD family transcriptional regulator [Brucella sp. NVSL 07-0026]
          Length = 194

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 128/188 (68%), Positives = 152/188 (80%), Gaps = 2/188 (1%)

Query: 1   MTFQQKRDAMRQG-FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           M+ QQK+  + +G F+ GE IVYPAHGVG I  I+EQEVAG KLE FVI F+KDKM LKV
Sbjct: 4   MSSQQKKSPVARGGFKAGEAIVYPAHGVGQIVTIEEQEVAGHKLELFVIDFEKDKMRLKV 63

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV KA  IGMRKLSE  +VERALK+V+G+ARVKRTMW RRAQEYDAKINSGDLI+I+EVV
Sbjct: 64  PVAKAASIGMRKLSETDYVERALKVVQGRARVKRTMWLRRAQEYDAKINSGDLISISEVV 123

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           RDL+R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ LIEVNL+    K  K+
Sbjct: 124 RDLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKLSETEAVRLIEVNLAKG-PKRGKA 182

Query: 180 TSENQDKA 187
            +E  D  
Sbjct: 183 EAELDDDE 190


>gi|308176321|ref|YP_003915727.1| CarD transcriptional regulator-like protein [Arthrobacter
           arilaitensis Re117]
 gi|307743784|emb|CBT74756.1| CarD transcriptional regulator-like protein [Arthrobacter
           arilaitensis Re117]
          Length = 161

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 84/159 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I EIK +++ G +  +  +   +  + ++VP      +G+R + 
Sbjct: 3   FEVGETVVYPHHGAAMIEEIKMRKIKGEEKMYLKLKVAQGDLTIEVPAENVDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++    ++R +   + T WSRR +    K+ SGD+I +AEVVRDL R ++    S 
Sbjct: 63  GQEGLDHVFDVLRAEFTEEPTNWSRRYKANVEKLASGDVIKVAEVVRDLWRRENDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            E+++   A   ++ E+A    + E +A +L++  L+S 
Sbjct: 123 GEKRMLAKARQVLISELALAKDLDEAKAESLLDEVLASA 161


>gi|85709786|ref|ZP_01040851.1| transcriptional regulator [Erythrobacter sp. NAP1]
 gi|85688496|gb|EAQ28500.1| transcriptional regulator [Erythrobacter sp. NAP1]
          Length = 178

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 84/169 (49%), Positives = 121/169 (71%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            +    F  G+++VYP HGVG + E++ +E+AGM+LE +V+ F+K++M L+VPV K   I
Sbjct: 2   ASNAPAFTVGDYVVYPKHGVGRVIELQSEEIAGMQLELYVLRFEKERMTLRVPVNKVESI 61

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMRKLS    ++ A+  ++GK +VKRTMWSRRAQEY+AKINSG+++ IAEV RDL R D 
Sbjct: 62  GMRKLSSDKTLKEAMDTLKGKPKVKRTMWSRRAQEYEAKINSGEIVLIAEVTRDLFRPDD 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKT 176
           QPE+SYSERQ++E+A +R+ RE+AA+    EP A+  I   L   + + 
Sbjct: 122 QPEQSYSERQIFEAASSRLARELAAMEETDEPTALEKILEVLREHAPQY 170


>gi|323703787|ref|ZP_08115425.1| transcriptional regulator, CarD family [Desulfotomaculum
           nigrificans DSM 574]
 gi|323531256|gb|EGB21157.1| transcriptional regulator, CarD family [Desulfotomaculum
           nigrificans DSM 574]
          Length = 158

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 91/158 (57%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG G I  I+E+EV G K +++++      M + +P+  + ++G+R++
Sbjct: 1   MFKIGDKVVYPMHGAGVIEAIEEKEVLGEKRKYYILRLPIGDMKVMIPINNSEEVGLREI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                V++ + +++GK  V  T W+RR +    KI SGD+  +AEVVR+L   D +   S
Sbjct: 61  IAPDEVKQVMGVLQGKTSVMSTNWNRRYRANLEKIKSGDIYEVAEVVRNLLTRDKEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             ER++ E+A   ++ E+     + E +A ++I+   +
Sbjct: 121 SGERKMLENARQILISELVLATELEEDKARSMIDGVFA 158


>gi|255262370|ref|ZP_05341712.1| transcriptional regulator, CarD family [Thalassiobium sp. R2A62]
 gi|255104705|gb|EET47379.1| transcriptional regulator, CarD family [Thalassiobium sp. R2A62]
          Length = 171

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 102/174 (58%), Positives = 127/174 (72%), Gaps = 5/174 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M+ ++K     + F   + +VYPAHGVG +  I+EQEVAG +LE FVIAF+KDKM L+VP
Sbjct: 1   MSKKKK-----RDFEPNDFVVYPAHGVGKVVSIEEQEVAGFELELFVIAFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KAI++GMR LS    V  A+K ++GKA+VK+ MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 56  THKAIEVGMRSLSTPDVVNHAMKTLKGKAKVKKAMWSRRAQEYEQKINSGDLIAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           DLHR D Q E+SYSERQLYE+AL R+ REIAA  S  E  A   I   L S+++
Sbjct: 116 DLHRADDQREQSYSERQLYEAALERLTREIAATGSGDEAIAAQEITDVLQSRAA 169


>gi|163797039|ref|ZP_02190995.1| Transcriptional regulator [alpha proteobacterium BAL199]
 gi|159177786|gb|EDP62337.1| Transcriptional regulator [alpha proteobacterium BAL199]
          Length = 166

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 82/172 (47%), Positives = 123/172 (71%), Gaps = 6/172 (3%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT +         F+TG+ +VYP HGVG I   + Q VAG +L+  VI F++D+M L++P
Sbjct: 1   MTKK------SSEFKTGDFVVYPTHGVGLIKGTETQIVAGTELDLLVIDFEQDRMTLRIP 54

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           VGKA   G+R+LS    ++ AL+ ++G+A+V+RTMWSRRAQEY+AKINSGD ++IAEVVR
Sbjct: 55  VGKARTSGLRRLSSRKQMDVALQKLKGRAKVRRTMWSRRAQEYEAKINSGDPVSIAEVVR 114

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           DL R+ +Q ++SYSERQ+Y++A++R+ RE A +  I E  A++ +E  + + 
Sbjct: 115 DLRRSSNQADQSYSERQMYQAAIDRLAREFAKIEQIDEVTAVDRLEKLMDAA 166


>gi|258513613|ref|YP_003189835.1| transcriptional regulator, CarD family [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257777318|gb|ACV61212.1| transcriptional regulator, CarD family [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 158

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 45/158 (28%), Positives = 86/158 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG G I  I+E+EV G    ++++      M + +P+    D+G+R++
Sbjct: 1   MFKIGDKVVYPMHGAGVIEAIEEKEVLGEIKHYYILRLPIGNMKVMIPIDHGRDVGLRQV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                V+  L+++  K+      W+RR +    KI SG++  +AEVVR+L + D +   S
Sbjct: 61  ITRDDVQMVLRILSDKSTSMPPNWNRRYRANLEKIKSGNIYEVAEVVRNLIKRDKEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             ER++ E+A   ++ E+     + E +A +L++   +
Sbjct: 121 SGERKMLENARQILISELVLATELEEDKAQSLVDGVFA 158


>gi|83955682|ref|ZP_00964262.1| transcriptional regulator, CarD family protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83839976|gb|EAP79152.1| transcriptional regulator, CarD family protein [Sulfitobacter sp.
           NAS-14.1]
          Length = 171

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 103/172 (59%), Positives = 124/172 (72%), Gaps = 5/172 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M+  +K       FR  E +VYPAHGVG I  ++EQEVAG+ LE FVIAF+KDKM L+VP
Sbjct: 1   MSKSKK-----LDFRPNEFVVYPAHGVGQIISVEEQEVAGISLELFVIAFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA +IGMR LS    +  A+K ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 56  THKATEIGMRALSSPDVISHAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV    E  A   +   L S+
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVAGGDELAASKQVGDVLESR 167


>gi|114799783|ref|YP_762092.1| CarD family transcriptional regulator [Hyphomonas neptunium ATCC
           15444]
 gi|114739957|gb|ABI78082.1| transcriptional regulator, CarD family [Hyphomonas neptunium ATCC
           15444]
          Length = 174

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 101/160 (63%), Positives = 126/160 (78%)

Query: 4   QQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGK 63
            +K +A    F  G+ +VYPAHGVG IT I+ Q VAGM+LE +V+AFD+DKM L+VP  +
Sbjct: 2   AKKAEARTHAFEVGQSVVYPAHGVGKITGIESQTVAGMQLEVYVVAFDQDKMILRVPTNR 61

Query: 64  AIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLH 123
           A   GMR L+ +  V+ ALK + GKAR+KRTMWSRRAQEY+AKINSGDLI+IAEVVRDLH
Sbjct: 62  AEASGMRALAGSKLVDDALKTLGGKARIKRTMWSRRAQEYEAKINSGDLISIAEVVRDLH 121

Query: 124 RTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAIN 163
           R D QPE+SYSERQLYESAL+RM RE+AAV +I + +A+ 
Sbjct: 122 RGDDQPEQSYSERQLYESALDRMARELAAVENIDKGKAME 161


>gi|319409358|emb|CBI83002.1| transcriptional factor [Bartonella schoenbuchensis R1]
          Length = 194

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 116/188 (61%), Positives = 146/188 (77%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  Q+K+ +  +GF T E+IVYP HGVG I  I+EQEVAG KL+ FVI F KDKM +KVP
Sbjct: 1   MASQRKKTSSVKGFSTSEYIVYPTHGVGQIIAIEEQEVAGHKLKLFVIHFAKDKMDVKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA+ IGMRKLSE+  VERALK ++GKARVKR MWSRRAQEYD KINSG+L+ IAEVVR
Sbjct: 61  VAKALSIGMRKLSESDLVERALKTLQGKARVKRAMWSRRAQEYDTKINSGNLVFIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL R++ Q E+SYSERQLY +AL+RM REIA +N++SE EAINLIE +L+ +S +  K+ 
Sbjct: 121 DLFRSELQSEQSYSERQLYAAALDRMAREIAIINNLSETEAINLIETHLTKESKRKFKAG 180

Query: 181 SENQDKAA 188
            + +   +
Sbjct: 181 MDEEKDDS 188


>gi|320095399|ref|ZP_08027078.1| CarD family transcriptional regulator [Actinomyces sp. oral taxon
           178 str. F0338]
 gi|319977670|gb|EFW09334.1| CarD family transcriptional regulator [Actinomyces sp. oral taxon
           178 str. F0338]
          Length = 171

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 45/161 (27%), Positives = 81/161 (50%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG  TI EI  + + G +  +  +  ++  + ++VP      +G+R +
Sbjct: 2   SFEIGQTVVYPHHGAATIEEITTRSIRGAEKTYLKLRVNQGDLTIEVPADNVDLVGVRDI 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +E  L ++R     + T WSRR +    KI +GD++ +AEVVRDL R D   + S
Sbjct: 62  VDEDGLEEVLSVLRAPYVEEPTNWSRRFKANQEKIATGDIVKVAEVVRDLTRRDDLKKLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
             E+++   A   +  E+A    I + +A   ++  L+   
Sbjct: 122 TGEKRMLTKARGILTSELALARGIDKADAAARLDGILAEGR 162


>gi|117927289|ref|YP_871840.1| CarD family transcriptional regulator [Acidothermus cellulolyticus
           11B]
 gi|117647752|gb|ABK51854.1| transcriptional regulator, CarD family [Acidothermus cellulolyticus
           11B]
          Length = 160

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 82/158 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I  I+ + + G +  + V+   +  + ++VP   A  +G+R + 
Sbjct: 3   FKVGETVVYPHHGAALIEAIETRVINGQEKTYLVLKVAQGDLTVRVPAENAEFVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+  +AEVVRDL R D     S 
Sbjct: 63  SQDGLDRVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDRDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A     +E +A  +++  L S
Sbjct: 123 GEKRMLAKARQILVSELALAEGTNEDKAEAILDEVLGS 160


>gi|227876780|ref|ZP_03994889.1| transcription factor CarD [Mobiluncus mulieris ATCC 35243]
 gi|269976308|ref|ZP_06183304.1| CarD family transcriptional regulator [Mobiluncus mulieris 28-1]
 gi|306817728|ref|ZP_07451470.1| CarD family transcriptional regulator [Mobiluncus mulieris ATCC
           35239]
 gi|307701599|ref|ZP_07638616.1| CarD-like protein [Mobiluncus mulieris FB024-16]
 gi|227842677|gb|EEJ52877.1| transcription factor CarD [Mobiluncus mulieris ATCC 35243]
 gi|269935637|gb|EEZ92175.1| CarD family transcriptional regulator [Mobiluncus mulieris 28-1]
 gi|304649542|gb|EFM46825.1| CarD family transcriptional regulator [Mobiluncus mulieris ATCC
           35239]
 gi|307613278|gb|EFN92530.1| CarD-like protein [Mobiluncus mulieris FB024-16]
          Length = 160

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 85/158 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I EI  + + G++ E+  +   +  + +++P      +G+R + 
Sbjct: 3   FTVGETVVYPHHGAAVIEEITTRVIGGVEREYLKLRVAQADLTIQIPSENVEMVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +E   +++R     + + WSRR +    KI +GD++ +AEVVRDL R DS+   S 
Sbjct: 63  DKEGLEHVFEVLRTTKTEEPSNWSRRYKANVEKIATGDVVKVAEVVRDLSRRDSKKGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A     +E +A N ++  L+S
Sbjct: 123 GEKRMLSKARQILVSELALAEKTNEEDASNRLDEVLAS 160


>gi|296131792|ref|YP_003639039.1| transcriptional regulator, CarD family [Thermincola sp. JR]
 gi|296030370|gb|ADG81138.1| transcriptional regulator, CarD family [Thermincola potens JR]
          Length = 158

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 46/158 (29%), Positives = 84/158 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG G I  I+E+EV G    ++V+      M + +P     D+G+R++
Sbjct: 1   MFNIGDKVVYPMHGAGIIEAIEEKEVLGEVRSYYVMRLPIGDMKVMIPTSNVKDLGLRQV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   V+R L ++  K  V    W++R +    KI SG++  +AEVVR+L R D +   S
Sbjct: 61  IDEEGVQRVLNILSEKDTVMSANWNKRYRTNMEKIKSGNIFEVAEVVRNLMRRDQEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             ER++ E+A   ++ E+     + E +  ++++   +
Sbjct: 121 TGERKMLENARQILISELVLARGVKEEKVQSMLDEVFA 158


>gi|119718259|ref|YP_925224.1| CarD family transcriptional regulator [Nocardioides sp. JS614]
 gi|119538920|gb|ABL83537.1| transcriptional regulator, CarD family [Nocardioides sp. JS614]
          Length = 161

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 84/159 (52%), Gaps = 1/159 (0%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFV-IAFDKDKMCLKVPVGKAIDIGMRKL 72
           F  GE +VYP HG   I +I+ +++ G   ++ V     +  + ++VP      +G+R +
Sbjct: 3   FTVGETVVYPNHGAAVIEDIEMRKIKGEDRQYLVLRIVAQQDLVVRVPACNLDLVGVRDV 62

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++R   ++R     + T WSRR +    K++SGD++ +AEVVRDL R +     S
Sbjct: 63  VDKEGLDRVFDVLRAAHVEEPTNWSRRYKANLEKLHSGDVMKVAEVVRDLWRRERDRGLS 122

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E+++   A   +V E+A     +E +A  L++  L+S
Sbjct: 123 AGEKRMLAKARQILVSELALAEHTNEDKAEALLDEVLAS 161


>gi|213965110|ref|ZP_03393308.1| transcriptional regulator, CarD family protein [Corynebacterium
           amycolatum SK46]
 gi|213952224|gb|EEB63608.1| transcriptional regulator, CarD family protein [Corynebacterium
           amycolatum SK46]
          Length = 191

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 86/176 (48%), Gaps = 4/176 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG   I  I E+E+ G  +++ V+   +  + ++VP   A  +G+R +
Sbjct: 2   EFSIGDTVVYPHHGAAKIENIIERELNGETVQYLVLQILQSDLNIQVPAKNAELVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                + +   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGEEGLLKVFSVLRETDVEEAGNWSRRYKANQERLGSGDINKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDKAA 188
             E+++   A   +V E+A  + + E +    +E   +   +  E+  +  Q+ AA
Sbjct: 122 AGEKRMLSKARQVLVGELALADGVDEAK----VEEVFARVDATIERHRALAQEGAA 173


>gi|300780458|ref|ZP_07090314.1| CarD family transcriptional regulator [Corynebacterium genitalium
           ATCC 33030]
 gi|300534568|gb|EFK55627.1| CarD family transcriptional regulator [Corynebacterium genitalium
           ATCC 33030]
          Length = 197

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 48/166 (28%), Positives = 84/166 (50%), Gaps = 3/166 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ GE +VYP HG   I +I+++E+ G  L+F V+   +  + ++VPV  A  +G+R +
Sbjct: 2   DFKVGEVVVYPHHGAARIADIEQREMGGETLDFLVLNILQSDLSVRVPVKNAELVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                + +   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VNEDGLRKVFSVLRETDVEEAGNWSRRYKANQERLASGDINKVAEVVRDLWRRDQGRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEA---INLIEVNLSSKSSK 175
             E+++   A   +V E+A    I E +A      I+  ++    +
Sbjct: 122 AGEKRMLGKARQILVGELALAEPIDEAKADDMEKEIQSIIARHVEQ 167


>gi|153008468|ref|YP_001369683.1| CarD family transcriptional regulator [Ochrobactrum anthropi ATCC
           49188]
 gi|151560356|gb|ABS13854.1| transcriptional regulator, CarD family [Ochrobactrum anthropi ATCC
           49188]
          Length = 193

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 124/176 (70%), Positives = 146/176 (82%), Gaps = 1/176 (0%)

Query: 1   MTFQQKRDAMRQG-FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           M+ QQK+  + +G F+ GE IVYPAHGVG I  I+EQEVAG KLE FVI F+KDKM LKV
Sbjct: 1   MSSQQKKSPVARGGFKAGEAIVYPAHGVGQIVTIEEQEVAGHKLELFVIDFEKDKMRLKV 60

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV KA  IGMRKLSE  +VERALK+V+G+ARVKRTMWSRRAQEYDAKINSGDLI+I+EVV
Sbjct: 61  PVAKAASIGMRKLSETDYVERALKVVQGRARVKRTMWSRRAQEYDAKINSGDLISISEVV 120

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSK 175
           RDL R ++QPE+SYSERQLYE+AL+RM REIAAVN +SE EA+ LIE NL+    +
Sbjct: 121 RDLFRAENQPEQSYSERQLYEAALDRMAREIAAVNKLSETEAVRLIEANLAKGPKR 176


>gi|326383079|ref|ZP_08204768.1| transcription factor CarD [Gordonia neofelifaecis NRRL B-59395]
 gi|326198215|gb|EGD55400.1| transcription factor CarD [Gordonia neofelifaecis NRRL B-59395]
          Length = 162

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 41/160 (25%), Positives = 87/160 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP HG   + +I  + + G ++E+ V+      M +++P  K   +G+R + 
Sbjct: 3   FKVGDTVVYPHHGAARVEDIVIRTIKGEEIEYLVLKVADGDMTVQIPSSKLEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++  +++R     + T W+RR +    K+ SGD+I +AE+VRDL R +     S 
Sbjct: 63  GQEGLDQVFQVLRAPHTEEPTNWARRFKANQEKLISGDIIKVAEIVRDLWRREQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            E+++   A   +V E++     ++ +A ++++  L++ S
Sbjct: 123 GEKRMLTRARRVLVDELSLAQHTNDEKADSMLDEILAAAS 162


>gi|302870278|ref|YP_003838915.1| transcription factor CarD [Micromonospora aurantiaca ATCC 27029]
 gi|315503446|ref|YP_004082333.1| transcriptional regulator, card family [Micromonospora sp. L5]
 gi|302573137|gb|ADL49339.1| transcription factor CarD [Micromonospora aurantiaca ATCC 27029]
 gi|315410065|gb|ADU08182.1| transcriptional regulator, CarD family [Micromonospora sp. L5]
          Length = 161

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 45/156 (28%), Positives = 81/156 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I  I+ + + G   E+ V+   +  + ++VP   A  +G+R++ 
Sbjct: 3   FSVGETVVYPHHGAALIEAIETRVIKGEPREYLVLRVAQGDLTVRVPAENAEIVGVREVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               + +   ++R     + T WSRR +    K+ SG+ + +AEVVRDL R + +   S 
Sbjct: 63  GEEGLGKVFDVLRAPHTEEPTNWSRRYKANLEKLASGNPLKVAEVVRDLWRRERERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            E+++   A + +V E+A     ++ EA  L++  L
Sbjct: 123 GEKRMLAKARDILVGEVALAEKSTKDEAETLLDKVL 158


>gi|295691061|ref|YP_003594754.1| CarD family transcriptional regulator [Caulobacter segnis ATCC
           21756]
 gi|295432964|gb|ADG12136.1| transcriptional regulator, CarD family [Caulobacter segnis ATCC
           21756]
          Length = 167

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 99/161 (61%), Positives = 123/161 (76%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+H+VYPAHGVG I  I+ QEVAGM LE +VI FD +KM L+VP  KA   G+R L
Sbjct: 7   EFSVGDHVVYPAHGVGNIQAIETQEVAGMSLEVYVITFDHEKMTLRVPTKKAKTAGLRPL 66

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +E   V +AL  ++G+ARVKRTMWSRRAQEY+AKINSGDLI+IAEVVRDLHR ++QPE+S
Sbjct: 67  AEGGTVSQALTTLKGRARVKRTMWSRRAQEYEAKINSGDLISIAEVVRDLHRAENQPEQS 126

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           YSERQLYESAL+RM RE+AA+  I    AI ++  +L   +
Sbjct: 127 YSERQLYESALDRMAREVAAIERIDREAAIGILTKSLVKAA 167


>gi|68535372|ref|YP_250077.1| putative transcription factor [Corynebacterium jeikeium K411]
 gi|68262971|emb|CAI36459.1| putative transcription factor [Corynebacterium jeikeium K411]
          Length = 196

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 42/165 (25%), Positives = 80/165 (48%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG   I  I+++E  G  +++ V+  ++  + ++VP   A  +G+R +
Sbjct: 2   EFAVGDTVVYPHHGAAVIEGIEQREFKGETVDYLVLRINQGDLSVRVPAANAEKVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                + +   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGEEGLRKVFSVLRETDVEEAGNWSRRYKANQERLTSGDVNKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTE 177
             E+++   A   +V E+A    + + +   L+    ++     E
Sbjct: 122 AGEKRMLAKARQILVGELALAEGVDDKKTDTLLAEMQAAIKRHRE 166


>gi|217977551|ref|YP_002361698.1| transcriptional regulator, CarD family [Methylocella silvestris
           BL2]
 gi|217502927|gb|ACK50336.1| transcriptional regulator, CarD family [Methylocella silvestris
           BL2]
          Length = 456

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 109/179 (60%), Positives = 133/179 (74%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           + + GF+  E+IVYPAHGVG I  I+EQEVAG KLE FVI+F KDKM LKVP  K   +G
Sbjct: 270 SRQSGFKPNEYIVYPAHGVGQIVAIEEQEVAGFKLELFVISFVKDKMILKVPTPKVTSVG 329

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           MRKL+EA  V R+L  + G+AR+KRTMWSRRAQEY+AKINSGDLIAIAEVVRDL+R+DSQ
Sbjct: 330 MRKLAEADVVRRSLDTLAGRARIKRTMWSRRAQEYEAKINSGDLIAIAEVVRDLYRSDSQ 389

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDKA 187
           PE+SYSERQLYE+AL+RM RE+  V  ++E EA+  IE  L     +  K+     D  
Sbjct: 390 PEQSYSERQLYEAALDRMAREVVIVEKLTETEALKAIEAQLQKGPRRGGKAEEIEVDDT 448


>gi|297572193|ref|YP_003697967.1| CarD family transcripitonal regulator [Arcanobacterium haemolyticum
           DSM 20595]
 gi|296932540|gb|ADH93348.1| transcriptional regulator, CarD family [Arcanobacterium
           haemolyticum DSM 20595]
          Length = 181

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 53/176 (30%), Positives = 88/176 (50%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ GE +VYP HG   I +I E+ + G K  +  +   +  M ++VP      +G+R +
Sbjct: 2   SFKVGETVVYPHHGAAYIEDISEKMMRGEKRLYLTLRIIQGDMVIQVPADSIEQVGLRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           S    +ER   ++R +   + + WSRR +    K+ SGD+  +AEVVRDL R +S    S
Sbjct: 62  SNDEQLERVFAVLREENVEEPSNWSRRYKANGEKLTSGDVNKVAEVVRDLTRRNSDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDKAA 188
             E+++   A   +  E+A    IS+ EA  L+   L   +   + S S    ++A
Sbjct: 122 AGEKRMLAQARGILGSEVALGRGISDEEAAELLNEILGEFTPSPDSSESAGTPESA 177


>gi|320532511|ref|ZP_08033328.1| CarD-like transcriptional regulator [Actinomyces sp. oral taxon 171
           str. F0337]
 gi|320135273|gb|EFW27404.1| CarD-like transcriptional regulator [Actinomyces sp. oral taxon 171
           str. F0337]
          Length = 160

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 83/158 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           +  GE +VYP HG   I +I++++V G +  +  +   +  + + VP      IG+R + 
Sbjct: 3   YEVGETVVYPHHGAARIIDIRQRKVRGEEKTYLQLEVAQGDLTILVPAESVELIGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +E+  +++R     + T WSRR +    KI SGD+I +AEVVRDL R D+      
Sbjct: 63  DETGLEKVFEVLRAPLTEEPTNWSRRFKANQEKIASGDVIKVAEVVRDLSRRDTDRGLPA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E EA + ++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAQKTPEEEAESRLDEVLAS 160


>gi|170750107|ref|YP_001756367.1| CarD family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656629|gb|ACB25684.1| transcriptional regulator, CarD family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 201

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 112/177 (63%), Positives = 147/177 (83%), Gaps = 1/177 (0%)

Query: 11  RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMR 70
           RQGF+TGE +VYPAHGVG IT I+EQE+AG KLE FV++F+KDKM L+VP  KA  +GMR
Sbjct: 12  RQGFKTGEAVVYPAHGVGRITAIEEQEIAGYKLELFVVSFEKDKMVLRVPTAKANSVGMR 71

Query: 71  KLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
           KL+E   V++AL L+ G+AR+KRTMWSRRAQEY+AKINSGDL+A+ EVVRDL R+++QPE
Sbjct: 72  KLAEPELVKKALDLLTGRARIKRTMWSRRAQEYEAKINSGDLLAVTEVVRDLFRSEAQPE 131

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDKA 187
           +SYSERQLYE+AL+R+VREI++VN I+E EA+ LIE +L+    +  KS +E + +A
Sbjct: 132 QSYSERQLYEAALDRIVREISSVNRITETEALKLIEQSLAKS-PRRAKSEAEPEAEA 187


>gi|260578403|ref|ZP_05846317.1| transcription factor [Corynebacterium jeikeium ATCC 43734]
 gi|258603425|gb|EEW16688.1| transcription factor [Corynebacterium jeikeium ATCC 43734]
          Length = 196

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 42/165 (25%), Positives = 80/165 (48%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG   I  I+++E  G  +++ V+  ++  + ++VP   A  +G+R +
Sbjct: 2   EFAVGDTVVYPHHGAAVIEGIEQREFKGETVDYLVLRINQGDLSVRVPAANAEKVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                + +   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGEEGLRKVFSVLRETDVEEAGNWSRRYKANQERLTSGDVNKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTE 177
             E+++   A   +V E+A    + + +   L+    ++     E
Sbjct: 122 AGEKRMLAKARQILVGELALAEGVDDKKTDALLADMQAAIKRHRE 166


>gi|103485742|ref|YP_615303.1| CarD family transcriptional regulator [Sphingopyxis alaskensis
           RB2256]
 gi|98975819|gb|ABF51970.1| transcriptional regulator, CarD family [Sphingopyxis alaskensis
           RB2256]
          Length = 175

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 85/161 (52%), Positives = 119/161 (73%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  G+++VYP HGVG + E+++ E+AGM+LE +V+ F+K+KM L+VP  KA  +GMRKLS
Sbjct: 8   FEVGDYVVYPKHGVGRVIELQKSEIAGMQLELYVLRFEKEKMTLRVPTNKAEGVGMRKLS 67

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++ AL+++  K +VKRTMWSRRAQEY+AKINSGDL++IAEV RDL R D QPE+SY
Sbjct: 68  SDKTLKEALQVLTTKPKVKRTMWSRRAQEYEAKINSGDLVSIAEVTRDLFRADDQPEQSY 127

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           SERQ++E+A +R+ RE+AA+    E  A   I   L+  + 
Sbjct: 128 SERQIFEAASSRLARELAAMEESDEKTAQAKILQILNEHAP 168


>gi|329946263|ref|ZP_08293857.1| CarD-like protein [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328527555|gb|EGF54550.1| CarD-like protein [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 160

 Score =  134 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 84/158 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           +  GE +VYP HG   I +I++++V G +  +  +   +  + + VP      IG+R + 
Sbjct: 3   YEVGETVVYPHHGAARIIDIRQRKVRGEEKTYLQLEVAQGDLTILVPAESVELIGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +E+  +++R     + T WSRR +    KI SGD+I +AEVVRDL R D+    S 
Sbjct: 63  DETGLEKVFEVLRAPLTEEPTNWSRRFKANQEKIASGDVIKVAEVVRDLSRRDTDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E EA + ++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAQKTPEDEAESRLDEVLAS 160


>gi|83591419|ref|YP_425171.1| CarD family transcriptional regulator [Rhodospirillum rubrum ATCC
           11170]
 gi|83574333|gb|ABC20884.1| transcriptional regulator, CarD family [Rhodospirillum rubrum ATCC
           11170]
          Length = 165

 Score =  134 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 85/164 (51%), Positives = 118/164 (71%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           + +  + TG+ +VYP HGVG + +I++Q + G  LE  VI F++++M L++P+ K  + G
Sbjct: 2   SNQLQYETGDFVVYPTHGVGQVLDIEKQVIGGYDLELLVIGFERERMKLRIPMPKVRESG 61

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           +R+LS    +E AL  +RGKARVKRTMWSRRAQEY+AKINSGD ++IAEVVRDLHR  +Q
Sbjct: 62  LRRLSTKKVMESALVTLRGKARVKRTMWSRRAQEYEAKINSGDPVSIAEVVRDLHRNATQ 121

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           PE+SYSERQ+YE AL R+  E+AA+  I    A   +E  LS+ 
Sbjct: 122 PEQSYSERQIYELALERLTCELAAIEDIDASTATQKVEKLLSAA 165


>gi|325066494|ref|ZP_08125167.1| CarD family transcriptional regulator [Actinomyces oris K20]
 gi|326772504|ref|ZP_08231788.1| transcriptional regulator, CarD family [Actinomyces viscosus C505]
 gi|326637136|gb|EGE38038.1| transcriptional regulator, CarD family [Actinomyces viscosus C505]
          Length = 160

 Score =  134 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 84/158 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           +  GE +VYP HG   I +I++++V G +  +  +   +  + + VP      IG+R + 
Sbjct: 3   YEVGETVVYPHHGAARIIDIRQRKVRGEEKTYLQLEVAQGDLTILVPAESVELIGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +E+  +++R     + T WSRR +    KI SGD+I +AEVVRDL R D+    S 
Sbjct: 63  DETGLEKVFEVLRAPLTEEPTNWSRRFKANQEKIASGDVIKVAEVVRDLSRRDTDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E EA + ++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAQKTPEEEAESRLDEVLAS 160


>gi|319899401|ref|YP_004159498.1| transcriptional factor [Bartonella clarridgeiae 73]
 gi|319403369|emb|CBI76928.1| transcriptional factor [Bartonella clarridgeiae 73]
          Length = 191

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 114/187 (60%), Positives = 140/187 (74%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M   +   +  + F T E+IVYP HGVG I  I+EQEVAG KL+ FVI F KDKM +KVP
Sbjct: 1   MASPRNTSSSAKDFLTSEYIVYPTHGVGQIMAIEEQEVAGHKLKLFVIHFAKDKMDVKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           + KA+ IGMRKLS    V RA K+++G+AR+KRTMWSRRAQEYD KINSGD+I+IAEV+R
Sbjct: 61  IAKALSIGMRKLSTVDSVNRAFKILQGRARIKRTMWSRRAQEYDTKINSGDIISIAEVIR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL R+D QPE+SYSERQLY  AL+RM REIA VNS++E EAINLIE +L+ KS    KS 
Sbjct: 121 DLFRSDLQPEQSYSERQLYAIALDRMAREIAVVNSLTETEAINLIEKHLTKKSKSEFKSE 180

Query: 181 SENQDKA 187
            +  + A
Sbjct: 181 IDEGNNA 187


>gi|260881580|ref|ZP_05404736.2| transcriptional regulator, CarD family [Mitsuokella multacida DSM
           20544]
 gi|260848409|gb|EEX68416.1| transcriptional regulator, CarD family [Mitsuokella multacida DSM
           20544]
          Length = 166

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 40/160 (25%), Positives = 76/160 (47%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
            + G+ +VYP HG G I+ I+  EV G    ++V+      M + +P   A ++G+R + 
Sbjct: 4   LQIGDKVVYPMHGAGVISGIENCEVLGEGKSYYVLEMPLGNMKVMIPTDNADNVGLRDVI 63

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               V+   +++  +    +  W++R      ++ SGD+  +A V R+L   D +   S 
Sbjct: 64  PQQKVDEVREVLEEEPEKPKGSWNKRFHANLDRMKSGDICDVAAVARNLILQDRRRHISS 123

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            ER+L + A   +V E+      +  E  N +   LS+ +
Sbjct: 124 GERRLLDLAKQILVSELVYACDKTPKEVENWLTSVLSANA 163


>gi|209965508|ref|YP_002298423.1| CarD-like transcriptional regulator protein, putative
           [Rhodospirillum centenum SW]
 gi|209958974|gb|ACI99610.1| CarD-like transcriptional regulator protein, putative
           [Rhodospirillum centenum SW]
          Length = 166

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 81/165 (49%), Positives = 114/165 (69%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           +    F  G+H+VYPAHGVG I  I+   +A   +  + I F+K++M LKVPV KA   G
Sbjct: 2   SENLEFAAGDHVVYPAHGVGKIIGIETHSIAEQTVTLYAIQFEKERMTLKVPVAKARAAG 61

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           +R+LS    ++ AL+ ++G +R+KR MWSRRAQEY+AKINSGD ++IAEVVRDL+R + Q
Sbjct: 62  LRRLSSKDRIKAALETLQGPSRIKRIMWSRRAQEYEAKINSGDPVSIAEVVRDLYRGEDQ 121

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            ++SYSERQ+Y +AL R+ RE+A V  I E +A   +E  LS  +
Sbjct: 122 SDQSYSERQIYHAALERLARELAVVEKIDERKATERLEAVLSKAA 166


>gi|170783048|ref|YP_001711382.1| putative transcription factor regulator [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169157618|emb|CAQ02816.1| putative transcription factor regulator [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 160

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 83/158 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG  TI E+K++ + G++  +  +  ++  + ++VP      +G+R + 
Sbjct: 3   FEVGETVVYPHHGAATIIEVKKRVIRGVEKLYLKLDVNQGGLQIEVPAENVDMVGVRDVI 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               VE    ++R +   + T WSRR +    K+ SGD++ +AEVVRDL R +     S 
Sbjct: 63  GREGVESVFAVLRAEFTEEPTNWSRRYKANLEKLASGDVLKVAEVVRDLWRRNQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+ + + A   +V E+A      E  A  L++  L+S
Sbjct: 123 GEKSMLQKARGILVGELALAEKTDEEHASTLLDEVLAS 160


>gi|71083129|ref|YP_265848.1| hypothetical protein SAR11_0423 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062242|gb|AAZ21245.1| hypothetical protein SAR11_0423 [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 299

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 67/182 (36%), Positives = 111/182 (60%), Gaps = 3/182 (1%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K++  ++ ++  +++VYP HGVG ITE K+  + G+ +E +V+ F+KDK    VPV K 
Sbjct: 100 KKQETEKREYKVKDYVVYPKHGVGQITEFKKINIGGIDVETYVLKFEKDKANGMVPVNK- 158

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
               +R L+  + V + + +++ K ++KR+MWSRRAQEY+AKI+SG +  +AEVVRDL++
Sbjct: 159 -QSHLRPLATINQVNKCISILKSKPKIKRSMWSRRAQEYEAKISSGKIYELAEVVRDLNK 217

Query: 125 TDS-QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSEN 183
            D    ++SYSERQL+E A  R++ E   V  IS  +    ++  L        K+ +  
Sbjct: 218 GDDLMVDQSYSERQLFEKAYERILSEFQIVMGISLEDTQKKLDKALKRNLEGQAKAVAAP 277

Query: 184 QD 185
             
Sbjct: 278 TK 279


>gi|305680364|ref|ZP_07403172.1| CarD-like protein [Corynebacterium matruchotii ATCC 14266]
 gi|305659895|gb|EFM49394.1| CarD-like protein [Corynebacterium matruchotii ATCC 14266]
          Length = 196

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 45/156 (28%), Positives = 77/156 (49%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG   I  I+++E+ G  LE+ V+   +  + ++VP   A  +G+R +
Sbjct: 2   EFKVGDTVVYPHHGAAVIEAIEQREMGGETLEYLVLQIHQSDLVVRVPSKNAETVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                + +    +R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGEAGLRKVFGFLRETDVEEAGNWSRRFKANQERLASGDVNKVAEVVRDLWRRDQGKGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
             E+++   A   +V E+A      E +A  L+   
Sbjct: 122 AGEKRMLAKARQVLVGELALAEIKDEAKANELLAEV 157


>gi|225181295|ref|ZP_03734740.1| transcriptional regulator, CarD family [Dethiobacter alkaliphilus
           AHT 1]
 gi|225168075|gb|EEG76881.1| transcriptional regulator, CarD family [Dethiobacter alkaliphilus
           AHT 1]
          Length = 164

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 46/160 (28%), Positives = 82/160 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG G I  I+E+E+ G +  ++++      M + +P+     IG+R++
Sbjct: 1   MFNIGDKVVYPMHGAGVIEAIEEKEILGARKRYYIMNIPIGDMKVMIPMDNVDQIGLREV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            + H VE+ L ++R       T W+RR +    KI SGD+  +AEVVR+L   + +   S
Sbjct: 61  IDTHGVEQVLTILRDNHSKMSTNWNRRYRANMEKIKSGDIFQVAEVVRNLMLREREKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
             ER++ +SA   +V E+    + S  +   ++       
Sbjct: 121 TGERKMLDSAKQILVSELVLAQNTSAQDVDEILNQFFDEG 160


>gi|328908150|gb|EGG27909.1| putative transcriptional regulator [Propionibacterium sp. P08]
          Length = 161

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/159 (26%), Positives = 86/159 (54%), Gaps = 1/159 (0%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD-KDKMCLKVPVGKAIDIGMRKL 72
           F  GE +VYP HG   I +I+ + + G +  + V+    ++ + ++VP      +G+R +
Sbjct: 3   FNVGETVVYPNHGAAVIEDIETRTIKGEEKLYLVLRILGQNDLVVRVPASNLDLVGVRDV 62

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +E+  +++R     + + WSRR +    K++SG+++ +AEVVRDL R +     S
Sbjct: 63  VDDEGLEKVFEILRKTNVEEPSNWSRRYKANLEKLHSGNVLKVAEVVRDLWRRERDRGLS 122

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E+++   A   +V E+A    + + +A  +++  L+S
Sbjct: 123 AGEKRMLSKARQILVSELALAKRVEDDQAEEMLDEVLAS 161


>gi|184201518|ref|YP_001855725.1| hypothetical protein KRH_18720 [Kocuria rhizophila DC2201]
 gi|183581748|dbj|BAG30219.1| hypothetical protein [Kocuria rhizophila DC2201]
          Length = 161

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 47/159 (29%), Positives = 83/159 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG  TI EIK + V G +  +  +   +  + ++VP      +G+R + 
Sbjct: 3   FEVGETVVYPHHGAATIEEIKTRTVKGEEKMYLRLKVTQGDLMIEVPAENVDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +++ + +++ +   + + WSRR +    K+ SGD++ +AEVVRDL R D     S 
Sbjct: 63  DEDGLKQVIAVLQAQDAEEASNWSRRYKANLEKLASGDVLKVAEVVRDLWRRDRGKGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            E+++   A   +  E+A    I E EA   ++  LS+ 
Sbjct: 123 GEKRMLTKARQILTSELALAKKIDEEEAEKRLDDILSAA 161


>gi|49474702|ref|YP_032744.1| transcriptional factor regulator [Bartonella quintana str.
           Toulouse]
 gi|49240206|emb|CAF26674.1| transcriptional factor regulator [Bartonella quintana str.
           Toulouse]
          Length = 194

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 120/187 (64%), Positives = 144/187 (77%), Gaps = 1/187 (0%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  Q +  +  +GF T E+IVYP HGVG I  I++QEVAG KL+ FVI F KDKM +KVP
Sbjct: 1   MASQHRTSSNAKGFATSEYIVYPTHGVGQIIAIEDQEVAGHKLKLFVIHFAKDKMDVKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           + KAI +GMRKLS    VERALK++ GKARVKRTMWSRRAQEYDAKINSGDLI IAEVVR
Sbjct: 61  IAKAISVGMRKLSAVDSVERALKILHGKARVKRTMWSRRAQEYDAKINSGDLICIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL R++ QPE+SYSERQLY +AL+RM REIA +NS+SE EA+NLIE++L S   K E  T
Sbjct: 121 DLFRSNLQPEQSYSERQLYTAALDRMAREIAVINSLSETEAVNLIEMHL-SNKPKCEFKT 179

Query: 181 SENQDKA 187
             ++  A
Sbjct: 180 KSDETNA 186


>gi|15603905|ref|NP_220420.1| hypothetical protein RP026 [Rickettsia prowazekii str. Madrid E]
 gi|3860596|emb|CAA14497.1| unknown [Rickettsia prowazekii]
          Length = 201

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 77/172 (44%), Positives = 114/172 (66%), Gaps = 1/172 (0%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +T  + +   +  F+ G+ IVYPAHGVG IT I+   +A  +++ +VI+F +DKM LKVP
Sbjct: 28  ITQSEHKTEQKSEFKIGQRIVYPAHGVGEITNIEYHTIADTEIKVYVISFSQDKMTLKVP 87

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V +A  +G+R ++    ++     ++GK +    MWSRRAQEY+ KINSG+++AIAEV+R
Sbjct: 88  VNRAAVVGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEYEGKINSGNIVAIAEVLR 147

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           DLH  +   ++SYSER LYESALNR+  E+A + +I   EAIN +   L  K
Sbjct: 148 DLH-KNVDNDRSYSERTLYESALNRLAGELAILENIDPTEAINKLVEVLREK 198


>gi|254455735|ref|ZP_05069164.1| CarD-like transcriptional regulator family protein [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082737|gb|EDZ60163.1| CarD-like transcriptional regulator family protein [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 279

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 66/184 (35%), Positives = 112/184 (60%), Gaps = 3/184 (1%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K++  ++ ++  +H+VYP HGVG I+E K+  + G+ +E +VI F+KDK    VPV K 
Sbjct: 79  KKQETEKREYKIKDHVVYPKHGVGQISEFKKINIGGIDVETYVIKFEKDKANGMVPVNK- 137

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
               +R L+  + V + + +++ K ++KR+MWSRRAQEY+AKI+SG +  +AEVVRDL++
Sbjct: 138 -QSHLRPLATINQVNKCISILKSKPKIKRSMWSRRAQEYEAKISSGKIYELAEVVRDLNK 196

Query: 125 TDS-QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSEN 183
            D    ++SYSERQL+E A  R++ E   V ++S  +    ++  L        +  +  
Sbjct: 197 GDDLMVDQSYSERQLFEKAYERILSEFQIVLNMSLEDTQKKLDKALKRNLGGQTQPVASP 256

Query: 184 QDKA 187
              +
Sbjct: 257 PKAS 260


>gi|188584806|ref|YP_001916351.1| transcriptional regulator, CarD family [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179349493|gb|ACB83763.1| transcriptional regulator, CarD family [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 161

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 85/157 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG G I  ++E+EV G K  ++++      M + +P  +   IG+R++
Sbjct: 1   MFKKGDKVVYPMHGAGVIEGVEEREVLGKKHMYYIMKIPVGDMKVMIPKERVDAIGLREI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            + + V++ L +++ +       W++R +    KI SGD+  +AEV+R+L   D +   S
Sbjct: 61  VDKNSVKKVLAILKAEETNVNHNWNQRYRANLEKIRSGDIYQVAEVIRNLVFLDDEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
             E+++ E+A   +V E+     I E +A  +I   L
Sbjct: 121 TGEKKMLENAKQILVSELVLAKDIEEEQAHEIINDTL 157


>gi|238061419|ref|ZP_04606128.1| CarD family transcriptional regulator [Micromonospora sp. ATCC
           39149]
 gi|330470463|ref|YP_004408206.1| transcriptional regulator, card family protein [Verrucosispora
           maris AB-18-032]
 gi|237883230|gb|EEP72058.1| CarD family transcriptional regulator [Micromonospora sp. ATCC
           39149]
 gi|328813434|gb|AEB47606.1| transcriptional regulator, card family protein [Verrucosispora
           maris AB-18-032]
          Length = 161

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/156 (28%), Positives = 81/156 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I  I+ + + G   ++ V+   +  + ++VP   A  +G+R++ 
Sbjct: 3   FSVGETVVYPHHGAALIEAIETRVIKGEPKQYLVLRVAQGDLTVRVPAENAEIVGVREVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               + +   ++R     + T WSRR +    K+ SG+ + +AEVVRDL R + +   S 
Sbjct: 63  GEEGLGKVFDVLRAPHTEEPTNWSRRYKANLEKLASGNPLKVAEVVRDLWRRERERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            E+++   A + +V E+A     ++ EA  L++  L
Sbjct: 123 GEKRMLAKARDILVGEVALAEKSTKDEAETLLDKVL 158


>gi|260887702|ref|ZP_05898965.1| transcriptional regulator, CarD family [Selenomonas sputigena ATCC
           35185]
 gi|260862582|gb|EEX77082.1| transcriptional regulator, CarD family [Selenomonas sputigena ATCC
           35185]
          Length = 175

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/159 (25%), Positives = 74/159 (46%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
            + G+ +VYP HG G I+ I++ EV G    ++V+      M + +P     ++G+R + 
Sbjct: 14  LQVGDTVVYPMHGAGVISGIEDCEVLGEGKSYYVLQMPLGNMKVMIPTDNVDNMGLRDVI 73

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               VE    +++         W++R      ++ SGD+  +A V R+L   D   + S 
Sbjct: 74  PETQVEEVKDILQMAPERATGSWNKRFHANLERMKSGDICDVAAVARNLVLQDRLRKISS 133

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            ER+L + A   +V E+    S S  E  + ++  L+  
Sbjct: 134 GERRLLDLARQIIVSELVYACSKSPEEVKSWMDGILAEN 172


>gi|297627026|ref|YP_003688789.1| CarD family transcriptional regulator [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
 gi|296922791|emb|CBL57369.1| transcriptional regulator CarD [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
          Length = 161

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/159 (27%), Positives = 83/159 (52%), Gaps = 1/159 (0%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD-KDKMCLKVPVGKAIDIGMRKL 72
           F  GE +VYP HG   I + + +++ G    + V+    +  + ++VP      +G+R +
Sbjct: 3   FTVGETVVYPNHGAAVIEDTETRKIKGEDTLYLVLRILGQTDLVVRVPACNLDLVGVRDV 62

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +E+   ++R     + T WSRR +    K++SGD++ ++EVVRDL R + +   S
Sbjct: 63  VDEEGLEKVFSVLRAPHTEEPTNWSRRYKANLEKLHSGDVMKVSEVVRDLWRREKERGLS 122

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E+++   A   +V E+A    + E  A  +++  L+S
Sbjct: 123 AGEKRMLAKARQILVSELALAEKVEEERAEVMLDEVLAS 161


>gi|86137857|ref|ZP_01056433.1| transcriptional regulator, CarD family protein [Roseobacter sp.
           MED193]
 gi|85825449|gb|EAQ45648.1| transcriptional regulator, CarD family protein [Roseobacter sp.
           MED193]
          Length = 170

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 103/172 (59%), Positives = 126/172 (73%), Gaps = 5/172 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT  +K       FR  E++VYPAHGVG I  ++EQEVAG  LE FVI F+KDKM L+VP
Sbjct: 1   MTKSKK-----LAFRPDEYVVYPAHGVGQIISVEEQEVAGFALELFVITFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KAI++GMR LS    + +A+K ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVR
Sbjct: 56  TNKAIEVGMRSLSSPDVIAQAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           DLHRTD Q E+SYSERQLYE+AL R+ RE+AAV    E  A   +   L+S+
Sbjct: 116 DLHRTDDQREQSYSERQLYEAALERLTREVAAVAGGDEILAAKQVGDVLTSR 167


>gi|282853418|ref|ZP_06262755.1| CarD-like protein [Propionibacterium acnes J139]
 gi|282582871|gb|EFB88251.1| CarD-like protein [Propionibacterium acnes J139]
          Length = 161

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/159 (26%), Positives = 85/159 (53%), Gaps = 1/159 (0%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD-KDKMCLKVPVGKAIDIGMRKL 72
           F  GE +VYP HG   I +I+ + + G +  + V+    ++ + ++VP      +G+R +
Sbjct: 3   FNVGETVVYPNHGAAVIEDIETRTIKGEEKLYLVLRVLGQNDLVVRVPASNLDLVGVRDV 62

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +E   +++R     + + WSRR +    K++SG+++ +AEVVRDL R +     S
Sbjct: 63  VDDEGLENVFEVLRKTNVEEPSNWSRRYKANLEKLHSGNVLKVAEVVRDLWRRERDRGLS 122

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E+++   A   +V E+A    +++  A  +++  L+S
Sbjct: 123 AGEKRMLSKARQILVSELALAKKVADDRAEEMLDEVLAS 161


>gi|50841843|ref|YP_055070.1| putative transcriptional regulator [Propionibacterium acnes
           KPA171202]
 gi|289424334|ref|ZP_06426117.1| CarD-like protein [Propionibacterium acnes SK187]
 gi|289428813|ref|ZP_06430493.1| CarD-like protein [Propionibacterium acnes J165]
 gi|295129919|ref|YP_003580582.1| CarD-like protein [Propionibacterium acnes SK137]
 gi|50839445|gb|AAT82112.1| putative transcriptional regulator [Propionibacterium acnes
           KPA171202]
 gi|289155031|gb|EFD03713.1| CarD-like protein [Propionibacterium acnes SK187]
 gi|289157814|gb|EFD06037.1| CarD-like protein [Propionibacterium acnes J165]
 gi|291375973|gb|ADD99827.1| CarD-like protein [Propionibacterium acnes SK137]
 gi|313765551|gb|EFS36915.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL013PA1]
 gi|313772900|gb|EFS38866.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL074PA1]
 gi|313793078|gb|EFS41145.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL110PA1]
 gi|313802474|gb|EFS43696.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL110PA2]
 gi|313806489|gb|EFS44996.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL087PA2]
 gi|313811040|gb|EFS48754.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL083PA1]
 gi|313814459|gb|EFS52173.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL025PA1]
 gi|313815048|gb|EFS52762.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL059PA1]
 gi|313817358|gb|EFS55072.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL046PA2]
 gi|313821898|gb|EFS59612.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL036PA1]
 gi|313824206|gb|EFS61920.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL036PA2]
 gi|313826574|gb|EFS64288.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL063PA1]
 gi|313828758|gb|EFS66472.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL063PA2]
 gi|313831803|gb|EFS69517.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL007PA1]
 gi|313834653|gb|EFS72367.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL056PA1]
 gi|313840116|gb|EFS77830.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL086PA1]
 gi|314915809|gb|EFS79640.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL005PA4]
 gi|314917081|gb|EFS80912.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL050PA1]
 gi|314921357|gb|EFS85188.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL050PA3]
 gi|314922287|gb|EFS86118.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL001PA1]
 gi|314926712|gb|EFS90543.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL036PA3]
 gi|314931320|gb|EFS95151.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL067PA1]
 gi|314954856|gb|EFS99262.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL027PA1]
 gi|314958792|gb|EFT02894.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL002PA1]
 gi|314961081|gb|EFT05182.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL002PA2]
 gi|314964491|gb|EFT08591.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL082PA1]
 gi|314965395|gb|EFT09494.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL082PA2]
 gi|314969590|gb|EFT13688.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL037PA1]
 gi|314974656|gb|EFT18751.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL053PA1]
 gi|314977148|gb|EFT21243.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL045PA1]
 gi|314980436|gb|EFT24530.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL072PA2]
 gi|314982506|gb|EFT26599.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL110PA3]
 gi|314985754|gb|EFT29846.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL005PA1]
 gi|314987277|gb|EFT31368.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL005PA2]
 gi|314989179|gb|EFT33270.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL005PA3]
 gi|315078494|gb|EFT50525.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL053PA2]
 gi|315082043|gb|EFT54019.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL078PA1]
 gi|315082817|gb|EFT54793.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL027PA2]
 gi|315086173|gb|EFT58149.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL002PA3]
 gi|315087758|gb|EFT59734.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL072PA1]
 gi|315091050|gb|EFT63026.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL110PA4]
 gi|315094138|gb|EFT66114.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL060PA1]
 gi|315097488|gb|EFT69464.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL038PA1]
 gi|315099939|gb|EFT71915.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL059PA2]
 gi|315101748|gb|EFT73724.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL046PA1]
 gi|315104787|gb|EFT76763.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL050PA2]
 gi|315106406|gb|EFT78382.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL030PA1]
 gi|315110296|gb|EFT82272.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL030PA2]
 gi|327329340|gb|EGE71100.1| transcriptional regulator, CarD family [Propionibacterium acnes
           HL103PA1]
 gi|327331426|gb|EGE73165.1| transcriptional regulator, CarD family [Propionibacterium acnes
           HL096PA2]
 gi|327333413|gb|EGE75133.1| transcriptional regulator, CarD family [Propionibacterium acnes
           HL096PA3]
 gi|327334936|gb|EGE76647.1| transcriptional regulator, CarD family [Propionibacterium acnes
           HL097PA1]
 gi|327445569|gb|EGE92223.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL013PA2]
 gi|327447189|gb|EGE93843.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL043PA1]
 gi|327449777|gb|EGE96431.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL043PA2]
 gi|327454626|gb|EGF01281.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL087PA3]
 gi|327456698|gb|EGF03353.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL083PA2]
 gi|327457026|gb|EGF03681.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL092PA1]
 gi|328755681|gb|EGF69297.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL087PA1]
 gi|328756461|gb|EGF70077.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL025PA2]
 gi|328758809|gb|EGF72425.1| CarD-like transcriptional regulator [Propionibacterium acnes
           HL020PA1]
 gi|328761841|gb|EGF75353.1| transcriptional regulator, CarD family [Propionibacterium acnes
           HL099PA1]
 gi|332674759|gb|AEE71575.1| putative transcriptional regulator [Propionibacterium acnes 266]
          Length = 161

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/159 (26%), Positives = 85/159 (53%), Gaps = 1/159 (0%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD-KDKMCLKVPVGKAIDIGMRKL 72
           F  GE +VYP HG   I +I+ + + G +  + V+    ++ + ++VP      +G+R +
Sbjct: 3   FNVGETVVYPNHGAAVIEDIETRTIKGEEKLYLVLRILGQNDLVVRVPASNLDLVGVRDV 62

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +E   +++R     + + WSRR +    K++SG+++ +AEVVRDL R +     S
Sbjct: 63  VDDEGLENVFEVLRKTNVEEPSNWSRRYKANLEKLHSGNVLKVAEVVRDLWRRERDRGLS 122

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E+++   A   +V E+A    +++  A  +++  L+S
Sbjct: 123 AGEKRMLSKARQILVSELALAKKVADDRAEEMLDEVLAS 161


>gi|148273673|ref|YP_001223234.1| CarD family transcriptional regulator [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|147831603|emb|CAN02571.1| putative transcriptional regulator, CarD family [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
          Length = 160

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 82/158 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG  TI E+K++ + G +  +  +  ++  + ++VP      +G+R + 
Sbjct: 3   FEVGETVVYPHHGAATIIEVKKRVIRGEEKLYLKLDVNQGGLQIEVPAENVDMVGVRDVI 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               VE    ++R +   + T WSRR +    K+ SGD++ +AEVVRDL R +     S 
Sbjct: 63  GREGVESVFAVLRAEFTEEPTNWSRRYKANLEKLASGDVLKVAEVVRDLWRRNQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+ + + A   +V E+A      E  A  L++  L+S
Sbjct: 123 GEKSMLQKARGILVGELALAEKTDEEHASTLLDEVLAS 160


>gi|116751073|ref|YP_847760.1| CarD family transcriptional regulator [Syntrophobacter fumaroxidans
           MPOB]
 gi|116700137|gb|ABK19325.1| transcriptional regulator, CarD family [Syntrophobacter
           fumaroxidans MPOB]
          Length = 159

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 85/159 (53%), Gaps = 1/159 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+  VYPAHGVG I  ++ + + G K +F+++    + M + +PV  A  +G+R L
Sbjct: 1   MFKIGDLAVYPAHGVGKIESVETKSIGGKKQDFYIMRILDNDMKIMIPVPNAHTVGLRGL 60

Query: 73  SEAHFVERALKLVRGKARVKR-TMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                + +   +++ +        W+RR +EY  KI +G +  +AEV+RDL       E 
Sbjct: 61  IGLEDISKVYDILQKREVSVNGGTWNRRYREYMEKIKTGSIYELAEVLRDLTVLKGDKEL 120

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           S+ ER++ ++A   +++E++ V  ISE E    I   L 
Sbjct: 121 SFGERKMLDTARTLLLKELSIVQDISEEEVDKGIRDMLQ 159


>gi|332800107|ref|YP_004461606.1| CarD family transcriptional regulator [Tepidanaerobacter sp. Re1]
 gi|332697842|gb|AEE92299.1| transcriptional regulator, CarD family [Tepidanaerobacter sp. Re1]
          Length = 158

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/157 (31%), Positives = 86/157 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG G I  I+E+E+ G K +++++      M + +P+    DIG+R++
Sbjct: 1   MFNIGDKVVYPMHGAGVIEAIEEKEILGEKQKYYIMRMPIGDMKVMIPLNNIEDIGVRQV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +     ++RG+     + W+RR +    KI SG++  +AEVVR+L   D +   S
Sbjct: 61  VGDEEISEVFNILRGEKSKMSSNWNRRYRANMDKIRSGNIFQVAEVVRNLSLRDKEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
             ER++ E+A + +V EI    +I E EA+ +IE   
Sbjct: 121 TGERKMLENAKHILVSEIVLSKNIQEDEALQMIENAF 157


>gi|227547934|ref|ZP_03977983.1| CarD family transcriptional regulator [Corynebacterium
           lipophiloflavum DSM 44291]
 gi|227079945|gb|EEI17908.1| CarD family transcriptional regulator [Corynebacterium
           lipophiloflavum DSM 44291]
          Length = 204

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 47/163 (28%), Positives = 83/163 (50%), Gaps = 3/163 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ GE +VYP HG   I +I+E+E+ G  L+F V+   +  + ++VPV  +  +G+R +
Sbjct: 2   EFKVGEVVVYPHHGAARIADIEEREMGGETLDFLVLKILQSDLEVRVPVKNSELVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                + +   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VNEAGLRKVFSVLRETDVEEAGNWSRRYKANQERLASGDINKVAEVVRDLWRRDQGKGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL---IEVNLSSK 172
             E+++   A   +V E+A    + E +A  +   I   +  +
Sbjct: 122 AGEKRMLGKARQILVGELALATPVDEAKAEEMESGINEIIQRQ 164


>gi|91762444|ref|ZP_01264409.1| hypothetical protein PU1002_04226 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718246|gb|EAS84896.1| hypothetical protein PU1002_04226 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 304

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 66/182 (36%), Positives = 111/182 (60%), Gaps = 3/182 (1%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           +K++  ++ ++  +++VYP HGVG ITE K+  + G+ +E +V+ F+KDK    VPV K 
Sbjct: 105 KKQETEKREYKVKDYVVYPKHGVGQITEFKKINIGGIDVETYVLKFEKDKANGMVPVNK- 163

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
               +R L+  + V + + +++ K ++KR+MWSRRAQEY+AKI+SG +  +AEVVRDL++
Sbjct: 164 -QSHLRPLATINQVNKCISILKSKPKIKRSMWSRRAQEYEAKISSGKIYELAEVVRDLNK 222

Query: 125 TDS-QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSEN 183
            D    ++SYSERQL+E A  R++ E   V  +S  +    ++  L        K+ +  
Sbjct: 223 GDDLMVDQSYSERQLFEKAYERILSEFQIVMGVSLEDTQKKLDKALKRNLEGQAKAVAAP 282

Query: 184 QD 185
             
Sbjct: 283 TK 284


>gi|239916921|ref|YP_002956479.1| transcriptional regulator, CarD family [Micrococcus luteus NCTC
           2665]
 gi|289706880|ref|ZP_06503221.1| CarD-like transcriptional regulator [Micrococcus luteus SK58]
 gi|239838128|gb|ACS29925.1| transcriptional regulator, CarD family [Micrococcus luteus NCTC
           2665]
 gi|289556430|gb|EFD49780.1| CarD-like transcriptional regulator [Micrococcus luteus SK58]
          Length = 160

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/157 (30%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I EIK + + G +  +  +   +  + ++VP      +G+R + 
Sbjct: 3   FEVGETVVYPHHGAARIEEIKMRTIKGEEKMYLKLKVAQGDLTIEVPAENVDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +A  +E  ++++R +   + T WSRR +    K+ SGD+  +AEVVRDL R D     S 
Sbjct: 63  DAEGLEHVMEVLRAEHVEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            E+++   A   +V E+A    ++E EA   ++  L 
Sbjct: 123 GEKRMLSKARQVLVSELALAKKVTEEEAEGRLDKVLE 159


>gi|145596771|ref|YP_001161068.1| transcription factor CarD [Salinispora tropica CNB-440]
 gi|159040183|ref|YP_001539436.1| CarD family transcriptional regulator [Salinispora arenicola
           CNS-205]
 gi|145306108|gb|ABP56690.1| transcriptional regulator, CarD family [Salinispora tropica
           CNB-440]
 gi|157919018|gb|ABW00446.1| transcriptional regulator, CarD family [Salinispora arenicola
           CNS-205]
          Length = 161

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/156 (28%), Positives = 82/156 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I  I+ + + G + ++ V+   +  + ++VP   A  +G+R++ 
Sbjct: 3   FSVGETVVYPHHGAALIEAIETRVIKGEEKQYLVLRVAQGDLTVRVPAENAEIVGVREVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               + +   ++R     + T WSRR +    K+ SG+ + +AEVVRDL R + +   S 
Sbjct: 63  GEEGLGKVFDVLRAPHTEEPTNWSRRYKANLEKLASGNPLKVAEVVRDLWRRERERGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            E+++   A + +V E+A     ++ EA  L++  L
Sbjct: 123 GEKRMLAKARDILVGEVALAEKSTKDEAETLLDKVL 158


>gi|310815308|ref|YP_003963272.1| transcriptional regulator, CarD family protein [Ketogulonicigenium
           vulgare Y25]
 gi|308754043|gb|ADO41972.1| transcriptional regulator, CarD family protein [Ketogulonicigenium
           vulgare Y25]
          Length = 169

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 105/169 (62%), Positives = 123/169 (72%), Gaps = 5/169 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M+  +K       F   ++IVYPAHGVG I  I+EQEVAG KLE FVIAF+KDKM L+VP
Sbjct: 1   MSKSKK-----PEFHPNDYIVYPAHGVGQILSIEEQEVAGFKLELFVIAFEKDKMTLRVP 55

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KAI+IGMR L+ +  V+ ALK ++GKA+VK+ MWSRRAQEYD KINSGDLIAIAEVVR
Sbjct: 56  TNKAIEIGMRALASSDVVDHALKTLKGKAKVKKAMWSRRAQEYDEKINSGDLIAIAEVVR 115

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
           DLHR D Q E+SYSERQLYE AL R+ RE+AAVN   E      I   L
Sbjct: 116 DLHRADDQREQSYSERQLYERALERLTRELAAVNGKDEVSMAREIGTLL 164


>gi|294786789|ref|ZP_06752043.1| transcriptional regulator, CarD family [Parascardovia denticolens
           F0305]
 gi|294485622|gb|EFG33256.1| transcriptional regulator, CarD family [Parascardovia denticolens
           F0305]
          Length = 230

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 89/180 (49%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
            ++ G+ +VYP HG   I EI E+ + G+   +  +       + + VP      +G+R+
Sbjct: 2   EYKVGDTVVYPRHGAARIEEITERTLRGVTRIYLRLTVLSSDGLEISVPADAVDKVGVRE 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE- 130
           +     V +  +++R     ++T WSRR +    KI +GD+  IAEVVRDL + D     
Sbjct: 62  VVNGVAVAKVFEILRTPIVEEKTNWSRRYKLNVEKIATGDVNKIAEVVRDLSQRDDDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A N +  EIA    I + EA  L++VNL         EK  ++  ++AA
Sbjct: 122 LSAGEKRMLSKARNILTSEIALSEKIDDEEAQRLLDVNLGYQDPEPGDEKHHAQAPEEAA 181


>gi|148262071|ref|YP_001236198.1| CarD family transcriptional regulator [Acidiphilium cryptum JF-5]
 gi|326405583|ref|YP_004285665.1| CarD family transcriptional regulator [Acidiphilium multivorum
           AIU301]
 gi|146403752|gb|ABQ32279.1| transcriptional regulator, CarD family [Acidiphilium cryptum JF-5]
 gi|325052445|dbj|BAJ82783.1| CarD family transcriptional regulator [Acidiphilium multivorum
           AIU301]
          Length = 266

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 85/166 (51%), Positives = 116/166 (69%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           Q+  A  + F+ G+H+VYP HGVG +  I  +E+AG KLE   I FD+++M L+VPV KA
Sbjct: 99  QRAIAKAETFKPGDHVVYPTHGVGKVERIAAEEIAGQKLELIHITFDENRMTLRVPVNKA 158

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
              G+RKLS     +  L  ++G+ARVKRTMWSRRAQEY+AKINSGD +AIAEVVRDLHR
Sbjct: 159 RTAGLRKLSSRKQFDEVLATLKGRARVKRTMWSRRAQEYEAKINSGDPMAIAEVVRDLHR 218

Query: 125 TDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
              QP++S+SERQ++E AL+R+  E  A+  + +  AI+ +   L 
Sbjct: 219 NAGQPDQSFSERQIFEQALDRLAAEYGALEGLDKQGAIDKLLDFLK 264


>gi|326332061|ref|ZP_08198346.1| transcriptional regulator, CarD family [Nocardioidaceae bacterium
           Broad-1]
 gi|325950199|gb|EGD42254.1| transcriptional regulator, CarD family [Nocardioidaceae bacterium
           Broad-1]
          Length = 161

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 86/159 (54%), Gaps = 1/159 (0%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFV-IAFDKDKMCLKVPVGKAIDIGMRKL 72
           F  GE +VYP HG   I +I+ + + G + ++ V     +  + ++VP      +G+R +
Sbjct: 3   FTVGETVVYPNHGAAVIEDIEMRTIKGEERQYLVLRIIAQQDLVVRVPANNLELVGVRDV 62

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++R  +++R +   + T WSRR +    K++SGD++ +AEVVRDL R +     S
Sbjct: 63  VDKDGLDRVFEVLRAEHVEEPTNWSRRYKANLEKLHSGDVMKVAEVVRDLWRRERDRGLS 122

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E+++   A   +V E+A     +E +A  L++  L+S
Sbjct: 123 AGEKRMLAKARQILVSELALCEHTNEDKAEVLLDEVLAS 161


>gi|300934651|ref|ZP_07149907.1| putative transcription factor [Corynebacterium resistens DSM 45100]
          Length = 199

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/155 (27%), Positives = 80/155 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG   I  I+++E  G K+++ V+  ++  + ++VP   A  +G+R +
Sbjct: 2   EFKVGDTVVYPHHGAAVIEGIEQREFKGEKVDYLVLRINQGDLSVRVPAANAEKVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                + +   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGEEGLRKVFSVLRETDVEEAGNWSRRYKANQERLTSGDVNKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEV 167
             E+++   A   +V E+A    + + +   L+E 
Sbjct: 122 AGEKRMLAKARQILVGELALAEGVDDKKTDALLEE 156


>gi|45656119|ref|YP_000205.1| CarD transcriptional regulator [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45599352|gb|AAS68842.1| transcriptional regulator (CarD family) [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 197

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 58/181 (32%), Positives = 96/181 (53%), Gaps = 1/181 (0%)

Query: 3   FQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
             +K+++     + G+++VYP HGVG I EI ++ + G K + +V+     KM + +PV 
Sbjct: 18  AAKKKNSEI-EHKVGDYVVYPIHGVGEILEISKKNILGKKKDCYVLEIQGSKMKVMIPVD 76

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
           KA  + +R + +   +++ + L++         W  R Q    KI SG +  + EV R+L
Sbjct: 77  KAEQVRIRPIIDKKEIKKVIALLKKDEVDTEEDWKIRYQNNLNKIKSGSIYEVGEVCRNL 136

Query: 123 HRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSE 182
            R  S  E S  ER+LYESA N +  E+A    +++ EA NL+   L+S  S +EK   E
Sbjct: 137 FRRASGKELSIMERKLYESAYNLVKMEVALSKGVTQEEAGNLVSDVLASTLSPSEKKAEE 196

Query: 183 N 183
            
Sbjct: 197 E 197


>gi|323138996|ref|ZP_08074056.1| transcriptional regulator, CarD family [Methylocystis sp. ATCC
           49242]
 gi|322395750|gb|EFX98291.1| transcriptional regulator, CarD family [Methylocystis sp. ATCC
           49242]
          Length = 485

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 103/169 (60%), Positives = 131/169 (77%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
            + GF+  E IVYPAHGVG I  ++ QEVAG  LE FV++F KDKM LKVP  K  ++GM
Sbjct: 299 QKHGFKQSEFIVYPAHGVGQIIGVEIQEVAGFSLELFVVSFIKDKMILKVPTSKVANVGM 358

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           RKL+E + V++AL  + G+AR+KRTMWSRRAQEY+AKINSGDL+ IAEVVRDL+R+D+QP
Sbjct: 359 RKLAEGNVVDKALATLSGRARIKRTMWSRRAQEYEAKINSGDLVTIAEVVRDLYRSDTQP 418

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEK 178
           E+SYSERQLYE+AL+RM REIAAV  + + EA+ LIE  L     + +K
Sbjct: 419 EQSYSERQLYEAALDRMAREIAAVRKLIDSEALKLIESFLQKGPRRGQK 467


>gi|163869173|ref|YP_001610425.1| transcriptional factor [Bartonella tribocorum CIP 105476]
 gi|161018872|emb|CAK02430.1| transcriptional factor [Bartonella tribocorum CIP 105476]
          Length = 194

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 119/188 (63%), Positives = 144/188 (76%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  Q    +  + F T E+IVYP HGVG I  I++QEVAG KL+ FVI F KDKM +KVP
Sbjct: 1   MASQHGTSSKTKEFATSEYIVYPTHGVGQIIAIEDQEVAGHKLKLFVIHFAKDKMDVKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           + KA+ +GMRKLS    VERALK++RGKARVKRTMWSRRAQEYDAKINSGDLI IAEVVR
Sbjct: 61  IAKALSVGMRKLSAGDSVERALKVLRGKARVKRTMWSRRAQEYDAKINSGDLICIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL R++ QPE+SYSERQLY +AL RM REIA +NS+SE EAINLIE++LS+K  +  K+ 
Sbjct: 121 DLFRSNLQPEQSYSERQLYTAALERMAREIAVINSLSETEAINLIEMHLSNKPKREFKTE 180

Query: 181 SENQDKAA 188
            E   + +
Sbjct: 181 REETVENS 188


>gi|227834038|ref|YP_002835745.1| putative transcription factor [Corynebacterium aurimucosum ATCC
           700975]
 gi|262183476|ref|ZP_06042897.1| putative transcription factor [Corynebacterium aurimucosum ATCC
           700975]
 gi|227455054|gb|ACP33807.1| putative transcription factor [Corynebacterium aurimucosum ATCC
           700975]
          Length = 194

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 46/156 (29%), Positives = 82/156 (52%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ GE +VYP HG   IT I+ +E+ G +LE+ V+  ++  + ++VP      +G+R +
Sbjct: 2   EFKVGEVVVYPHHGAAKITAIETREMGGEELEYLVLQINQSDLVVRVPSKNVEMVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +E+   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGKEGLEKVFSVLREVDVEEAGNWSRRYKANQERLASGDINKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
             E+++   A   +V E++    + E +A  ++E  
Sbjct: 122 AGEKRMLAKARQILVGELSLAKPVDEKKADTMMEEI 157


>gi|152977078|ref|YP_001376595.1| CarD family transcriptional regulator [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152025830|gb|ABS23600.1| transcriptional regulator, CarD family [Bacillus cytotoxicus NVH
           391-98]
          Length = 159

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 50/158 (31%), Positives = 85/158 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG G I  I+++EV G   ++ VI      M + +P+ K  D G+R +
Sbjct: 1   MFQIGDKIVYPMHGAGIIEAIEDKEVLGKTRQYCVIHMVISDMQVMIPMDKVQDSGIRYV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +  AL  V   A  K   W +R      K+ SGD +  AEVVRDL   + +   +
Sbjct: 61  VDQTTLNHALVDVHNGAPDKSLSWKQRYTLNMEKMKSGDFVDGAEVVRDLLHRNKERTLN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            SE+Q+ ++A   ++ E+A V ++SE +A + ++  ++
Sbjct: 121 ASEKQMLDNARRILISEVALVQNVSENQATDFLQNTIN 158


>gi|254461053|ref|ZP_05074469.1| transcriptional regulator, CarD family [Rhodobacterales bacterium
           HTCC2083]
 gi|206677642|gb|EDZ42129.1| transcriptional regulator, CarD family [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 172

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 103/165 (62%), Positives = 121/165 (73%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            +    FR  E +VYPAHGVG +  ++EQEVA +KLE +VIAF+KDKM L+VP  KAIDI
Sbjct: 3   KSKNLDFRVNEFVVYPAHGVGKVVSVEEQEVADVKLELYVIAFEKDKMTLRVPTHKAIDI 62

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           GMR LS    V  A+K ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVRDLHRTD 
Sbjct: 63  GMRSLSTGDEVAHAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVRDLHRTDD 122

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           Q E+SYSERQLYE+AL R+ REI AV    E  A   I   L S+
Sbjct: 123 QREQSYSERQLYEAALERLTREIGAVQGGDEDAAARQITDVLMSR 167


>gi|49476179|ref|YP_034220.1| transcriptional factor regulator [Bartonella henselae str.
           Houston-1]
 gi|49238987|emb|CAF28287.1| Transcriptional factor regulator [Bartonella henselae str.
           Houston-1]
          Length = 194

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 120/183 (65%), Positives = 141/183 (77%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  Q    +  +GF T E+IVYP HGVG I  I++QEVAG KL+ FVI F KDKM +KVP
Sbjct: 1   MASQHGTSSNAKGFSTSEYIVYPTHGVGQIIAIEDQEVAGHKLKLFVIHFAKDKMDVKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           + KAI +GMRKLS    VERALK++ GKARVKRTMWSRRAQEYDAKINSGDLI IAEVVR
Sbjct: 61  IAKAISVGMRKLSAVDSVERALKILHGKARVKRTMWSRRAQEYDAKINSGDLICIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL R+D QPE+SYSERQLY +AL RM REIA +NS+SE EAINLIE++LS K  +  K+ 
Sbjct: 121 DLFRSDLQPEQSYSERQLYIAALERMAREIAVINSLSETEAINLIEMHLSQKPKRQFKTK 180

Query: 181 SEN 183
            + 
Sbjct: 181 RDE 183


>gi|255325865|ref|ZP_05366957.1| transcriptional regulator, CarD family [Corynebacterium
           tuberculostearicum SK141]
 gi|311740175|ref|ZP_07714007.1| CarD family transcriptional regulator [Corynebacterium
           pseudogenitalium ATCC 33035]
 gi|255297077|gb|EET76402.1| transcriptional regulator, CarD family [Corynebacterium
           tuberculostearicum SK141]
 gi|311304730|gb|EFQ80801.1| CarD family transcriptional regulator [Corynebacterium
           pseudogenitalium ATCC 33035]
          Length = 194

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 46/156 (29%), Positives = 85/156 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            ++ GE +VYP HG   I +I+ +E+ G  LE+ V+  ++  + ++VP+  A ++G+R +
Sbjct: 2   EYKVGEVVVYPHHGAAVIEDIETREMGGETLEYLVLHINQSDLVVRVPIKNADNVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +E+   ++R +   +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGKEGLEKVFSVLRDEDVEEAGNWSRRYKANQERLASGDINKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
             E+++   A   +V E+A    + E +A  ++E  
Sbjct: 122 AGEKRMLGKARTILVGELALAKPVDEKKADTMMEEI 157


>gi|329848406|ref|ZP_08263434.1| carD-like/TRCF domain protein [Asticcacaulis biprosthecum C19]
 gi|328843469|gb|EGF93038.1| carD-like/TRCF domain protein [Asticcacaulis biprosthecum C19]
          Length = 172

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 92/161 (57%), Positives = 122/161 (75%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYPAHGVGT+  ++ QEVAG  LE FV+ FD +KM L+VP  KA   G+R L
Sbjct: 12  DFSVGDKVVYPAHGVGTVAAVETQEVAGYALEVFVVTFDHEKMTLRVPTKKAKTAGLRHL 71

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +    + +AL  ++G+AR+KRTMWSRRAQEY+AKINSG L+++AEVVRDL+R+DSQPE+S
Sbjct: 72  AAEAVMSQALVTLKGRARIKRTMWSRRAQEYEAKINSGCLVSLAEVVRDLYRSDSQPEQS 131

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           YSERQLYESAL+RM RE+AA+  I    A+ L+  NL+  +
Sbjct: 132 YSERQLYESALDRMAREVAAIEKIDRDAAVALLNKNLTKAA 172


>gi|311114871|ref|YP_003986092.1| CarD family transcriptional regulator [Gardnerella vaginalis ATCC
           14019]
 gi|310946365|gb|ADP39069.1| CarD family transcriptional regulator [Gardnerella vaginalis ATCC
           14019]
          Length = 235

 Score =  131 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 92/180 (51%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
           G++ G+ +VYP HG   + EI E+ V G+  ++  +       + + VPV     +G+R 
Sbjct: 39  GYQVGDMVVYPRHGAARVEEISERTVKGITRQYLRLVVLSSDGLEINVPVDNVKKVGVRD 98

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           +  A  V +  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 99  IVGAKEVAKVFEILRTPILEKEMNWSRRYKLNVEKIATGDVNKIAEVVRDLSQRDVDEHG 158

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A + ++ EIA    I E +A  L+ VNL  +      E+  ++  ++AA
Sbjct: 159 LSAGEKRMLARARSILISEIALSEKIDEEQAERLLNVNLGYADPLPGDEQHHTQAPEEAA 218


>gi|227505965|ref|ZP_03936014.1| CarD family transcriptional regulator [Corynebacterium striatum
           ATCC 6940]
 gi|227197487|gb|EEI77535.1| CarD family transcriptional regulator [Corynebacterium striatum
           ATCC 6940]
          Length = 195

 Score =  131 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 46/156 (29%), Positives = 82/156 (52%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ GE +VYP HG   I +I+ +E+ G  LE+ V+  ++  + ++VP      +G+R +
Sbjct: 2   EFKVGEVVVYPHHGAARIADIEHREMGGETLEYLVLQINQSDLVVRVPSKNVELVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +E+   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGKEGLEKVFSVLREIDVEEAGNWSRRYKANQERLASGDINKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
             E+++   A   +V E+A  + + E +A  ++E  
Sbjct: 122 AGEKRMLAKARQILVGELALASPVDEKKADTMLEEI 157


>gi|51473313|ref|YP_067070.1| hypothetical protein RT0102 [Rickettsia typhi str. Wilmington]
 gi|51459625|gb|AAU03588.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 177

 Score =  131 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 78/172 (45%), Positives = 115/172 (66%), Gaps = 1/172 (0%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +T  + +   +  F+ G+ IVYPAHGVG IT I+   +AG +++ +VI+F +DKM LKVP
Sbjct: 4   ITQSEHKTEQKSEFKIGQRIVYPAHGVGEITNIEYHTIAGNEIKVYVISFSQDKMTLKVP 63

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V +A  +G+R ++    ++     ++GK +    MWSRRAQEY+ KINSG+++AIAEV+R
Sbjct: 64  VSRAAVVGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEYEGKINSGNIVAIAEVLR 123

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           DLH  +   ++SYSER LYESALNR+  E+A + +I   EAIN +   L  K
Sbjct: 124 DLH-KNVDNDRSYSERTLYESALNRLAGELAILENIDPTEAINKLVEVLREK 174


>gi|114570846|ref|YP_757526.1| CarD family transcriptional regulator [Maricaulis maris MCS10]
 gi|114341308|gb|ABI66588.1| transcriptional regulator, CarD family [Maricaulis maris MCS10]
          Length = 169

 Score =  131 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 96/161 (59%), Positives = 122/161 (75%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           + F+ G+ IVYPAHGVG +T +++  VAG  +E +V+ F++DKM L+VP  K    GMR 
Sbjct: 6   KSFKKGDFIVYPAHGVGRVTGVEKDSVAGFDIEVYVVTFEQDKMTLRVPTAKTEASGMRP 65

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
           LS    V+ ALK ++GKA+VKRTMWSRRAQEY+AKINSGDLI IAEVVRDLHR + QPE+
Sbjct: 66  LSSDKIVKDALKTLKGKAKVKRTMWSRRAQEYEAKINSGDLIQIAEVVRDLHRAEDQPEQ 125

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           SYSERQLYESAL+RMVRE+AAV  I    A  ++  +L+ K
Sbjct: 126 SYSERQLYESALDRMVRELAAVEEIEHEAAREMLSTSLAKK 166


>gi|296118942|ref|ZP_06837515.1| transcriptional regulator, CarD family [Corynebacterium
           ammoniagenes DSM 20306]
 gi|295968040|gb|EFG81292.1| transcriptional regulator, CarD family [Corynebacterium
           ammoniagenes DSM 20306]
          Length = 195

 Score =  131 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 45/156 (28%), Positives = 80/156 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ GE +VYP HG   I  I+ +E+ G  LE+ V+  ++  + ++VP      +G+R +
Sbjct: 2   EFKVGEVVVYPHHGAAKIEAIEHREMGGEMLEYLVLQINQSDLVVRVPSKNVEQVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +E+   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGKEGLEKVFSVLRETDVEEAGNWSRRYKANQERLASGDINKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
             E+++   A   +V E+A    + E +A  +++  
Sbjct: 122 AGEKRMLAKARQILVGELALAQPVDEKKADTMMDEI 157


>gi|158522831|ref|YP_001530701.1| CarD family transcriptional regulator [Desulfococcus oleovorans
           Hxd3]
 gi|158511657|gb|ABW68624.1| transcriptional regulator, CarD family [Desulfococcus oleovorans
           Hxd3]
          Length = 188

 Score =  131 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 44/164 (26%), Positives = 80/164 (48%), Gaps = 3/164 (1%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           ++ G+ +VYPAHGVG I  I+ + +   + +F+++   +  M + +P      +G+R + 
Sbjct: 20  YQPGDLVVYPAHGVGRIETIESRNIGDTRQDFYIMKILETNMVIMIPTQNLTAVGIRNVI 79

Query: 74  EAHFVERALKLVRGKARV---KRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
               V +   ++R +          W+RR +EY  KI +G L  +AEV RDL       +
Sbjct: 80  CKKEVSKIYNIIRSQEECGAGDNQTWNRRYKEYMDKIKTGSLYEVAEVFRDLFLLKMTKD 139

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            S+ ER+L ++A   +V+E++      E   I+ IE        
Sbjct: 140 LSFGERKLLDTAQGLLVKELSIAKGAEEKTVISEIESFFPKMPP 183


>gi|315498116|ref|YP_004086920.1| transcriptional regulator, card family [Asticcacaulis excentricus
           CB 48]
 gi|315416128|gb|ADU12769.1| transcriptional regulator, CarD family [Asticcacaulis excentricus
           CB 48]
          Length = 169

 Score =  131 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 97/173 (56%), Positives = 128/173 (73%), Gaps = 4/173 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT      A    F+TG+ +VYPAHGVGT+  ++ QEVAG +LE +V+ FD +KM L+VP
Sbjct: 1   MTT----VAAELEFKTGDKVVYPAHGVGTVAAVESQEVAGYQLEVYVVTFDHEKMTLRVP 56

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA   G+R L+ A  + +AL  ++G+ARVKRTMWSRRAQEY+AKINSGDL++IAEVVR
Sbjct: 57  TKKAKTAGLRHLAPAAVMSQALVTLKGRARVKRTMWSRRAQEYEAKINSGDLVSIAEVVR 116

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           DLHR ++QPE+SYSERQLYESAL+RM RE+AA+  I    A+ L+  +L   +
Sbjct: 117 DLHRAENQPEQSYSERQLYESALDRMAREVAAIEKIDRDAAVALLNKSLIKAA 169


>gi|298530964|ref|ZP_07018365.1| transcriptional regulator, CarD family [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298508987|gb|EFI32892.1| transcriptional regulator, CarD family [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 177

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 51/176 (28%), Positives = 90/176 (51%), Gaps = 3/176 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  GE +VYPA GVG + +I+EQ++ G K   +++    + + L VPV  A ++G+R +
Sbjct: 1   MFSVGELVVYPAQGVGRVEKIEEQDLGGAKAVLYIVRILSNNVTLMVPVNNADNVGLRPV 60

Query: 73  SEAHFVERALKLVRGKAR---VKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           S     +  L  +  ++         W+RR +EY  K+ S DL  +A V+++L       
Sbjct: 61  SGKGQGQEILSFLEDRSDFTGYSGQNWNRRYREYSDKLKSKDLQDVAYVLKELFLISRDK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQD 185
           E S+ ER+L E A+  +  E++   SI + EA + +E   +   S   +   + +D
Sbjct: 121 ELSFGERRLMEQAMGLISMELSYALSIDQEEAKSRVEALFADILSPEVQEHDDQED 176


>gi|330838625|ref|YP_004413205.1| transcriptional regulator, CarD family [Selenomonas sputigena ATCC
           35185]
 gi|329746389|gb|AEB99745.1| transcriptional regulator, CarD family [Selenomonas sputigena ATCC
           35185]
          Length = 163

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 40/160 (25%), Positives = 74/160 (46%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+ +VYP HG G I+ I++ EV G    ++V+      M + +P     ++G+R +
Sbjct: 1   MLQVGDTVVYPMHGAGVISGIEDCEVLGEGKSYYVLQMPLGNMKVMIPTDNVDNMGLRDV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                VE    +++         W++R      ++ SGD+  +A V R+L   D   + S
Sbjct: 61  IPETQVEEVKDILQMAPERATGSWNKRFHANLERMKSGDICDVAAVARNLVLQDRLRKIS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
             ER+L + A   +V E+    S S  E  + ++  L+  
Sbjct: 121 SGERRLLDLARQIIVSELVYACSKSPEEVKSWMDGILAEN 160


>gi|114769349|ref|ZP_01446975.1| transcriptional regulator, CarD family protein [alpha
           proteobacterium HTCC2255]
 gi|114550266|gb|EAU53147.1| transcriptional regulator, CarD family protein [alpha
           proteobacterium HTCC2255]
          Length = 170

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 94/173 (54%), Positives = 124/173 (71%), Gaps = 4/173 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M   +K       FR  + +VYPAHGVG I  ++ QE+AG ++E FVIAF+KDKM L+VP
Sbjct: 1   MAKGKK----FGEFRLNDFVVYPAHGVGKIMTVETQEIAGTQMELFVIAFEKDKMTLRVP 56

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             KA  +GMR L+    VE+A+K ++G+ARVKR MWSRRAQEY+ KINSGDL++IAEVVR
Sbjct: 57  TAKATAVGMRNLASEELVEKAMKTLKGRARVKRAMWSRRAQEYEQKINSGDLMSIAEVVR 116

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           DLHR D + E+SYSERQLYE+AL R+ RE+AAV+   E  A   +   L +++
Sbjct: 117 DLHRNDEEREQSYSERQLYEAALERLTREVAAVDGTDEGVAAEKVTDILVARA 169


>gi|332653050|ref|ZP_08418795.1| transcriptional regulator, CarD family [Ruminococcaceae bacterium
           D16]
 gi|332518196|gb|EGJ47799.1| transcriptional regulator, CarD family [Ruminococcaceae bacterium
           D16]
          Length = 158

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 46/158 (29%), Positives = 77/158 (48%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +V+P HG G +  I +++V G+  E++V+      M + VP     +IG+R +
Sbjct: 1   MFQIGDKVVHPMHGAGIVDSIVQKKVNGVMREYYVLKLPVRAMVVMVPTENCEEIGVRPI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +    +R L  +          W+RR +E   +I SGDL  +A VV+ L   D Q   S
Sbjct: 61  VDREQADRVLAAIPDIQVEMTQNWNRRYRENMERIKSGDLFEVARVVKGLMLRDVQKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             ER++  SA   ++ EI    S S  +    I+  L+
Sbjct: 121 TGERKMLHSAKQILISEIVMCQSSSYEDVEACIDHALA 158


>gi|319407756|emb|CBI81403.1| transcriptional factor [Bartonella sp. 1-1C]
          Length = 191

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 112/187 (59%), Positives = 136/187 (72%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M   +      + F T E+IVYP HGVG I  I+EQEVAG KL+ FVI F KDKM +KVP
Sbjct: 1   MAPPRNTSFSAEDFSTSEYIVYPTHGVGQIMAIEEQEVAGHKLKLFVIHFAKDKMDVKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA+  GMRKLS    V RA K+++GKAR+KRTMWSRRAQEYD KINSGD+I+IAEVVR
Sbjct: 61  VAKALSTGMRKLSTVDSVNRAFKILQGKARIKRTMWSRRAQEYDTKINSGDIISIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL R+  QPE+SYSERQLY  AL+RM REIA +N+++E EAINLIE +L  KS    K+ 
Sbjct: 121 DLFRSALQPEQSYSERQLYAIALDRMAREIAIINNLTETEAINLIEKHLDKKSKCEFKNE 180

Query: 181 SENQDKA 187
            +  + A
Sbjct: 181 IDEGNNA 187


>gi|220927797|ref|YP_002504706.1| CarD family transcriptional regulator [Clostridium cellulolyticum
           H10]
 gi|219998125|gb|ACL74726.1| transcriptional regulator, CarD family [Clostridium cellulolyticum
           H10]
          Length = 159

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 41/157 (26%), Positives = 76/157 (48%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            +  G+ IVYP HG G I  I+E+E+ G    ++V+      + + +P     DIG+R +
Sbjct: 1   MYNVGDKIVYPMHGAGVIESIEEKEILGKTCSYYVMKIPIGDLKVMIPTNNITDIGIRDV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 +     ++       + W++R +E   KI SGD+  +A+VVR L + + +   S
Sbjct: 61  ISVSEADSVFDFLKNGQHEIPSNWNKRYRENMVKIKSGDIFEVADVVRGLMQREKEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
             ER++  SA   ++ E+     I++ +    I+  L
Sbjct: 121 TGERKMLSSAKQILISELVLAKGINQHDVEVKIQEYL 157


>gi|326203337|ref|ZP_08193202.1| transcriptional regulator, CarD family [Clostridium papyrosolvens
           DSM 2782]
 gi|325986595|gb|EGD47426.1| transcriptional regulator, CarD family [Clostridium papyrosolvens
           DSM 2782]
          Length = 159

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 78/157 (49%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            +  G+ IVYP HG G I  I+E+E+ G K  ++V+      + + +P     DIG+R +
Sbjct: 1   MYNVGDKIVYPMHGAGVIESIEEKEILGKKCSYYVMKIPIGDLKVMIPTNNITDIGIRGV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 +     ++       + W++R +E   KI SGD+  +A+VVR L + + +   S
Sbjct: 61  ISVSEADNVFNFLKDGQHEIPSNWNKRYRENMVKIKSGDIFEVADVVRSLMQREKEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
             ER++  SA   ++ E+  V  I++ E    I+  L
Sbjct: 121 TGERKMLSSAKQILISELVLVKGINQHEVEIKIQEYL 157


>gi|292571621|gb|ADE29536.1| Transcriptional regulator [Rickettsia prowazekii Rp22]
          Length = 177

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 77/172 (44%), Positives = 114/172 (66%), Gaps = 1/172 (0%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +T  + +   +  F+ G+ IVYPAHGVG IT I+   +A  +++ +VI+F +DKM LKVP
Sbjct: 4   ITQSEHKTEQKSEFKIGQRIVYPAHGVGEITNIEYHTIADTEIKVYVISFSQDKMTLKVP 63

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V +A  +G+R ++    ++     ++GK +    MWSRRAQEY+ KINSG+++AIAEV+R
Sbjct: 64  VNRAAVVGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEYEGKINSGNIVAIAEVLR 123

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           DLH  +   ++SYSER LYESALNR+  E+A + +I   EAIN +   L  K
Sbjct: 124 DLH-KNVDNDRSYSERTLYESALNRLAGELAILENIDPTEAINKLVEVLREK 174


>gi|154497963|ref|ZP_02036341.1| hypothetical protein BACCAP_01943 [Bacteroides capillosus ATCC
           29799]
 gi|150272953|gb|EDN00110.1| hypothetical protein BACCAP_01943 [Bacteroides capillosus ATCC
           29799]
          Length = 158

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/158 (27%), Positives = 77/158 (48%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IV+P HG G +  I  ++V G+  E++++      M + VP   + +IG+R +
Sbjct: 1   MFQVGDKIVHPMHGAGVVDSIVRKKVNGVVREYYILKLPVGGMLVMVPTEHSEEIGVRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +    +R L  +          W+RR +E   ++ SGDL+ +A VV+ L R D     S
Sbjct: 61  CQRDEADRVLAAIPDIEVDMTQNWNRRYRENMMRLKSGDLLEVARVVKGLMRRDEDRGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             ER++  SA   ++ EI    + S  +    I   +S
Sbjct: 121 TGERKMLHSAKQILISEIVLSQNASYEDVEARINGAMS 158


>gi|167629441|ref|YP_001679940.1| transcriptional regulator, card family, putative [Heliobacterium
           modesticaldum Ice1]
 gi|167592181|gb|ABZ83929.1| transcriptional regulator, card family, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 158

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 46/158 (29%), Positives = 85/158 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG G I  ++E+EV G K  ++V+      M + VP G+  +IG+R++
Sbjct: 1   MFAIGDKVVYPMHGAGVIEAVEEREVLGEKRLYYVLRLSLGDMRILVPSGQIAEIGLRQV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +A   ++ + +++ +  V    W RR +    K+ +GD+ A+AEVVR+L R + +   S
Sbjct: 61  IDAIEADQVMSVLQSRKSVMSNNWHRRYRANLDKMKTGDVYAVAEVVRNLIRRNQEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             ER++ E+A   +V E+         +   ++   L+
Sbjct: 121 TGERRMLENAKQILVSELVLAYDTPPEQIEAMLSRLLA 158


>gi|298253496|ref|ZP_06977286.1| CarD-like transcriptional regulator [Gardnerella vaginalis 5-1]
 gi|297532263|gb|EFH71151.1| CarD-like transcriptional regulator [Gardnerella vaginalis 5-1]
          Length = 215

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 90/180 (50%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
            ++ G+ +VYP HG   + EI E+ V G+  ++  +       + + VPV     +G+R 
Sbjct: 19  EYQVGDMVVYPRHGAARVEEISERTVKGVTRQYLRLVVLSSDGLEINVPVDNVKKVGVRD 78

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           +  A  V +  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 79  IVGAQEVAKVFEILRTPIVEKEMNWSRRYKLNVEKIATGDVNNIAEVVRDLSQRDVDEHG 138

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKT--EKSTSENQDKAA 188
            S  E+++   A + ++ EIA    I E EA  L++VNL  K  +   E   +   ++ A
Sbjct: 139 LSAGEKRMLARARSILISEIALSEKIDEIEAERLLDVNLGYKEPQEGDENHHTVAPEEPA 198


>gi|319406281|emb|CBI79918.1| transcriptional factor [Bartonella sp. AR 15-3]
          Length = 191

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 110/183 (60%), Positives = 136/183 (74%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M   +   +  + F T E+IVYP HGVG I  I+EQEVAG KL+ FVI F KDKM +KVP
Sbjct: 1   MAPPRNTSSSAKDFSTSEYIVYPTHGVGQIIAIEEQEVAGHKLKLFVIHFAKDKMDVKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           + KA+  GMRKLS    + RA K+++G+AR+KRTMWSRRAQEYD KINSGD+I+IAEVVR
Sbjct: 61  IAKALSTGMRKLSTVDSMNRAFKILQGRARIKRTMWSRRAQEYDTKINSGDIISIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL R+D QPE+SYSERQLY  AL+RM REIA +NS++E EAINLIE  L+ KS    K+ 
Sbjct: 121 DLFRSDLQPEQSYSERQLYTIALDRMAREIAVINSLTEMEAINLIEKYLTKKSKCEFKNE 180

Query: 181 SEN 183
            + 
Sbjct: 181 IDE 183


>gi|91206102|ref|YP_538457.1| transcriptional regulator [Rickettsia bellii RML369-C]
 gi|157826465|ref|YP_001495529.1| transcriptional regulator [Rickettsia bellii OSU 85-389]
 gi|91069646|gb|ABE05368.1| Transcriptional regulator [Rickettsia bellii RML369-C]
 gi|157801769|gb|ABV78492.1| Transcriptional regulator [Rickettsia bellii OSU 85-389]
          Length = 178

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 75/167 (44%), Positives = 113/167 (67%), Gaps = 1/167 (0%)

Query: 6   KRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAI 65
           K +  +  F+ G+ IVYPAHGVG IT I+   +AG +++ +VI+F +DKM +KVPV +A 
Sbjct: 10  KTEQQKSEFKIGQRIVYPAHGVGEITNIENHTIAGTEIKVYVISFPQDKMTVKVPVSRAT 69

Query: 66  DIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRT 125
            +G+R ++    ++     ++GK +    MWSRRAQEY+ KINSG+++A+AEV+RDLH  
Sbjct: 70  VVGLRAVASKKDLDLIYSTLQGKPKQGNRMWSRRAQEYEGKINSGNIVAVAEVLRDLH-K 128

Query: 126 DSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           +   ++SYSER LYE+ALNR+  E+A + +I   EAIN +   L  K
Sbjct: 129 NVDNDRSYSERTLYEAALNRLAGELAILENIDSSEAINKLVEVLREK 175


>gi|237784959|ref|YP_002905664.1| putative transcription factor [Corynebacterium kroppenstedtii DSM
           44385]
 gi|237757871|gb|ACR17121.1| putative transcription factor [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 196

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/175 (24%), Positives = 85/175 (48%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG   I + +++++ G  +++ V+   +  + ++VP   A  +G+R +
Sbjct: 2   EFNIGDTVVYPHHGAAVIEKKEQRQIKGETVDYLVLKVHQGDLTVRVPEKNAESVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                + +   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGEEGLLKVFSVLRETDVEEAGNWSRRYKANQERLASGDVNKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDKA 187
             E+++   A   +V E+A  +   + +A  + +    + +    K   E++D  
Sbjct: 122 AGEKRMLAKARQVLVGELALADGTDDAKADAMYQEAQEAIARHRAKLLGEDEDST 176


>gi|319404796|emb|CBI78397.1| transcriptional factor [Bartonella rochalimae ATCC BAA-1498]
          Length = 191

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 111/187 (59%), Positives = 136/187 (72%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M   +      + F T E+IVYP HGVG I  I+EQEVAG KL+ FVI F KDKM +KVP
Sbjct: 1   MAPPRNTSFSAEDFSTSEYIVYPTHGVGQIMAIEEQEVAGHKLKLFVIHFAKDKMDVKVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA+  GMRKLS    V RA K+++GKAR+KRTMWSRRAQEYD KINSG++I+IAEVVR
Sbjct: 61  VAKALSTGMRKLSTVDSVNRAFKILQGKARIKRTMWSRRAQEYDTKINSGNIISIAEVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL R+  QPE+SYSERQLY  AL+RM REIA +N+++E EAINLIE +L  KS    K+ 
Sbjct: 121 DLFRSALQPEQSYSERQLYAIALDRMAREIAIINNLTETEAINLIEKHLDKKSKCDFKNE 180

Query: 181 SENQDKA 187
            +  + A
Sbjct: 181 IDEGNNA 187


>gi|295694809|ref|YP_003588047.1| transcriptional regulator, CarD family [Bacillus tusciae DSM 2912]
 gi|295410411|gb|ADG04903.1| transcriptional regulator, CarD family [Bacillus tusciae DSM 2912]
          Length = 165

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/155 (29%), Positives = 81/155 (52%), Gaps = 3/155 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG G I  I+E+EV G    ++++      + + VP+ +   +G+R++
Sbjct: 1   MFNVGDRVVYPMHGAGVIESIEEREVLGKTGRYYIMRMPVGDIKVMVPIEQTGAVGLREV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +A  V + L ++  +   +   W+RR ++   KI SGD  AIA+VVR L   D     S
Sbjct: 61  VDAEGVHKILDILFDEGTQETAAWNRRYRDNMDKIKSGDAFAIADVVRQLAWLDRHKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEV 167
             E+++YE A   ++ E+       + +A + +E 
Sbjct: 121 TGEKRMYEMARQILLSELRLA--APQEDA-DRLEE 152


>gi|212716130|ref|ZP_03324258.1| hypothetical protein BIFCAT_01045 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661497|gb|EEB22072.1| hypothetical protein BIFCAT_01045 [Bifidobacterium catenulatum DSM
           16992]
          Length = 198

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 57/180 (31%), Positives = 94/180 (52%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
           G++ G+ +VYP HG   +  I E+ V G+  E+  ++      + + VPV  A  +G+R 
Sbjct: 2   GYKVGDMVVYPRHGAAKVEAITERTVKGITREYLQLSVLSSDGLVINVPVDNAKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           + +A+ V +  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVDANEVAKVFEILRTPIIEKEMNWSRRYKLNVEKIATGDVNKIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A N +  EI+    + E EA  L++VNL         EK  +E  ++AA
Sbjct: 122 LSAGEKRMLTKARNILTSEISLSEKLDETEAQRLLDVNLGYEPAQPGDEKHHTEAPEEAA 181


>gi|227502085|ref|ZP_03932134.1| CarD family transcriptional regulator [Corynebacterium accolens
           ATCC 49725]
 gi|306836888|ref|ZP_07469843.1| CarD family transcriptional regulator [Corynebacterium accolens
           ATCC 49726]
 gi|227077144|gb|EEI15107.1| CarD family transcriptional regulator [Corynebacterium accolens
           ATCC 49725]
 gi|304567229|gb|EFM42839.1| CarD family transcriptional regulator [Corynebacterium accolens
           ATCC 49726]
          Length = 194

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/156 (28%), Positives = 85/156 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            ++ GE +VYP HG   I +I+ +E+ G +LE+ V+  ++  + ++VP   A ++G+R +
Sbjct: 2   EYKVGEVVVYPHHGAAVIEDIETREMGGEELEYLVLHINQSDLVVRVPKKNADNVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +E+   ++R +   +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGKEGLEKVFSVLRDEDVEEAGNWSRRYKANQERLASGDINKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
             E+++   A   +V E+A    + + +A  ++E  
Sbjct: 122 AGEKRMLGKARTILVGELALAQPVDDKKADTMMEEI 157


>gi|224282833|ref|ZP_03646155.1| transcriptional regulator [Bifidobacterium bifidum NCIMB 41171]
 gi|310287288|ref|YP_003938546.1| transcriptional regulator, CarD family [Bifidobacterium bifidum
           S17]
 gi|311064136|ref|YP_003970861.1| transcriptional regulator CarD [Bifidobacterium bifidum PRL2010]
 gi|313139992|ref|ZP_07802185.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
 gi|309251224|gb|ADO52972.1| transcriptional regulator, CarD family [Bifidobacterium bifidum
           S17]
 gi|310866455|gb|ADP35824.1| CarD transcriptional regulator [Bifidobacterium bifidum PRL2010]
 gi|313132502|gb|EFR50119.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
          Length = 198

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 57/180 (31%), Positives = 92/180 (51%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
           G++ G+ +VYP HG   +  I E+ V G+K E+  +       + + VPV  A  +G+R 
Sbjct: 2   GYKVGDMVVYPRHGAARVEAITERVVKGVKREYLQLTVLSSDGLVINVPVENAQKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           + +A+ V +  +++R     K   WSRR +    K+ +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVDANEVAKVFEILRTPIVEKEMNWSRRYKLNVEKLATGDVNKIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A + +  EIA    + E E   L++VNL  S      EK  SE   + A
Sbjct: 122 LSAGEKRMLTRARSILTSEIALSEDLDEAEIQRLLDVNLGFSEPKPGDEKHHSEAPAEPA 181


>gi|309389958|gb|ADO77838.1| transcriptional regulator, CarD family [Halanaerobium praevalens
           DSM 2228]
          Length = 168

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/155 (25%), Positives = 75/155 (48%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            ++ G+ +VYP HG GTI  I  + +   K E++++     +M + +PV K   IG+R +
Sbjct: 1   MYKIGDKVVYPNHGAGTIVGIDTKTILDEKKEYYIMKLPIGEMKVMIPVDKIDKIGIRDV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 +   +L+ G+       W+RR +    K+ +GD+  +AEVVR+L   D     S
Sbjct: 61  ISEEKADEVFELLDGEKSKMSQNWNRRFRANQEKLKTGDIFEVAEVVRNLSIRDRDKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEV 167
             E+++  +A   ++ E+     + E      ++ 
Sbjct: 121 TGEKKMLSNARQILISELVLAKDMDEESVSEKMDD 155


>gi|296453869|ref|YP_003661012.1| CarD family transcriptional regulator [Bifidobacterium longum
           subsp. longum JDM301]
 gi|296183300|gb|ADH00182.1| transcriptional regulator, CarD family [Bifidobacterium longum
           subsp. longum JDM301]
          Length = 197

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 55/180 (30%), Positives = 88/180 (48%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
            ++ G+ +VYP HG   +  I E+ V G+  E+  ++      + + VPV  A  +G+R 
Sbjct: 2   SYKVGDMVVYPRHGAAKVEAITERTVKGVTREYLQLSVLSSDGLVINVPVDNARKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           +  A  V +   ++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVSASEVAKVFGILRTPIIEKEMNWSRRYKLNVEKIATGDVNKIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A   +  EIA    I E EA  L++VNL         +K  +   ++AA
Sbjct: 122 LSAGEKRMLTKARAILTSEIALSEKIDEAEAQRLLDVNLGYEPAQPGDDKHHTAEPEEAA 181


>gi|269217464|ref|ZP_06161318.1| transcriptional regulator, CarD family [Actinomyces sp. oral taxon
           848 str. F0332]
 gi|269213085|gb|EEZ79425.1| transcriptional regulator, CarD family [Actinomyces sp. oral taxon
           848 str. F0332]
          Length = 163

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/161 (27%), Positives = 86/161 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            +  GE +VYP HG   I ++  +++ G +  +  +   +  + ++VP     D+G+R +
Sbjct: 2   SYTIGETVVYPHHGAARIEDVFTRKIRGEEKTYLKLRVVQGDLEIQVPADMLEDVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           S+   +++   ++R +   + + WSRR +    K+ SGD+I +AEVVRDL R D+    S
Sbjct: 62  SDDEQLKQVFTVLRAEQIEEPSNWSRRYKANSEKLTSGDVIKVAEVVRDLTRRDADRHLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
             E+++   A   +  E+A    +SE EA+ L++  L   +
Sbjct: 122 AGEKRMLSQARQILGSEVALARQVSEGEALELLDEILGESA 162


>gi|116327105|ref|YP_796825.1| transcriptional regulator [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116332238|ref|YP_801956.1| transcriptional regulator [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116119849|gb|ABJ77892.1| Transcriptional regulator [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116125927|gb|ABJ77198.1| Transcriptional regulator [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 181

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 58/183 (31%), Positives = 96/183 (52%), Gaps = 2/183 (1%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++K        + G+++VYP HGVG I EI ++ + G K + +V+     KM + +P
Sbjct: 1   MAAKKKNS--EIEHKVGDYVVYPIHGVGEILEISKKNILGKKKDCYVLEIQGSKMKVMIP 58

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA  + +R + +   +++ + L++         W  R Q    KI SG +  + EV R
Sbjct: 59  VDKAEQVRIRPIIDKKEIKKVIALLKKDEVDTEEDWKIRYQNNLNKIKSGSIYEVGEVCR 118

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           +L R  S  E S  ER+LYESA N +  E+A    +++ EA NL+   L+S  + +EK  
Sbjct: 119 NLFRRASGKELSIMERKLYESAYNLVKMEVALSKGVTQEEAGNLVSDVLASTLAPSEKKA 178

Query: 181 SEN 183
            E+
Sbjct: 179 EED 181


>gi|229087271|ref|ZP_04219415.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-44]
 gi|228696061|gb|EEL48902.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-44]
          Length = 164

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+++EV G   ++ VI      M + +P+ K    G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEDKEVLGKTRQYCVIHMVISDMQVMIPMDKVATSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           + + +   L             W +R      K+ +GDL   AEVVRDL R + +   + 
Sbjct: 67  DKNTLNDVLVGFHNGEADSSLSWKQRYTMNMEKMKNGDLSDGAEVVRDLIRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   ++ E+A V ++SE +A + ++  ++
Sbjct: 127 SEKQMLDNARRILISEVALVQNVSENQATDFLQDTIN 163


>gi|83591305|ref|YP_431314.1| CarD family transcriptional regulator [Moorella thermoacetica ATCC
           39073]
 gi|83574219|gb|ABC20771.1| transcriptional regulator, CarD family [Moorella thermoacetica ATCC
           39073]
          Length = 158

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 42/158 (26%), Positives = 86/158 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG G I  I+E+EV G K +++++      M + +P+     +G+R++
Sbjct: 1   MFKVGDKVVYPMHGAGVIEAIEEREVLGKKRKYYILRLPLGDMKVMIPLESEQAVGLREV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++  +K+++         W+RR +    K+ SG++  +AEVV +L R +     S
Sbjct: 61  IDEKEIQEVIKILKEPRSNGSGNWNRRYRANLEKMRSGNIYQLAEVVGNLSRREHDQGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             ER++ E+A   ++ E+A   +  + +  N++E  L+
Sbjct: 121 TGERKMLENARQMLISELALARNAEKNQVENMLEKLLA 158


>gi|121602125|ref|YP_988461.1| CarD family transcriptional regulator [Bartonella bacilliformis
           KC583]
 gi|120614302|gb|ABM44903.1| transcriptional regulator, CarD family [Bartonella bacilliformis
           KC583]
          Length = 192

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 112/188 (59%), Positives = 143/188 (76%), Gaps = 2/188 (1%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  QQK+ +   GF T E+IVYP HGVG I  I+EQEVAG KLE FVI F KDKM +KVP
Sbjct: 1   MASQQKKTS--HGFSTSEYIVYPTHGVGQIMVIEEQEVAGHKLELFVIHFAKDKMDVKVP 58

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           + KA+  GMRKLSE   VE+ALK+++GKAR+KR MWSRRAQEYD KINSG+ + IAEVVR
Sbjct: 59  IAKALSTGMRKLSEPASVEKALKILQGKARIKRIMWSRRAQEYDTKINSGNFMFIAEVVR 118

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           DL R+D QPE+SYSERQLY +AL+RM REI+ +N++SE EA+NLIE +L+     + ++ 
Sbjct: 119 DLFRSDLQPEQSYSERQLYAAALDRMSREISVINNLSETEAVNLIEKHLNEGQKSSFEAK 178

Query: 181 SENQDKAA 188
            +  D+ +
Sbjct: 179 IDEADEDS 186


>gi|46190223|ref|ZP_00121736.2| COG1329: Transcriptional regulators, similar to M. xanthus CarD
           [Bifidobacterium longum DJO10A]
 gi|189439614|ref|YP_001954695.1| transcriptional_regulator [Bifidobacterium longum DJO10A]
 gi|213692627|ref|YP_002323213.1| transcriptional regulator, CarD family [Bifidobacterium longum
           subsp. infantis ATCC 15697]
 gi|227546164|ref|ZP_03976213.1| transcriptional regulator [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|312133013|ref|YP_004000352.1| transcriptional regulator [Bifidobacterium longum subsp. longum
           BBMN68]
 gi|322688825|ref|YP_004208559.1| transcriptional regulator [Bifidobacterium longum subsp. infantis
           157F]
 gi|322690813|ref|YP_004220383.1| transcriptional regulator [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|189428049|gb|ACD98197.1| Transcriptional_regulator [Bifidobacterium longum DJO10A]
 gi|213524088|gb|ACJ52835.1| transcriptional regulator, CarD family [Bifidobacterium longum
           subsp. infantis ATCC 15697]
 gi|227213145|gb|EEI81017.1| transcriptional regulator [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|291517113|emb|CBK70729.1| transcriptional regulator, CarD family [Bifidobacterium longum
           subsp. longum F8]
 gi|311774000|gb|ADQ03488.1| transcriptional regulator [Bifidobacterium longum subsp. longum
           BBMN68]
 gi|320455669|dbj|BAJ66291.1| putative transcriptional regulator [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320458778|dbj|BAJ69399.1| putative transcriptional regulator [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|320460161|dbj|BAJ70781.1| putative transcriptional regulator [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 197

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 55/180 (30%), Positives = 88/180 (48%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
            ++ G+ +VYP HG   +  I E+ V G+  E+  ++      + + VPV  A  +G+R 
Sbjct: 2   SYKVGDMVVYPRHGAAKVEAITERTVKGVTREYLQLSVLSSDGLVINVPVDNAKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           +  A  V +   ++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVSASEVAKVFGILRTPIIEKEMNWSRRYKLNVEKIATGDVNKIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A   +  EIA    I E EA  L++VNL         +K  +   ++AA
Sbjct: 122 LSAGEKRMLTKARAILTSEIALSEKIDEAEAQRLLDVNLGYEPAQPGDDKHHTAEPEEAA 181


>gi|260905792|ref|ZP_05914114.1| transcriptional regulator, CarD family protein [Brevibacterium
           linens BL2]
          Length = 160

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 82/159 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG  TI +IK++ + G +  +  +      + ++VP      +G+R +
Sbjct: 2   SFEVGDTVVYPHHGAATIQDIKKRTIKGEEKLYLKLQVAHGDLVIEVPAENCDLVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                VE+   ++R +   + T WSRR +    K+ SGD+I +AEVVRDL R +     S
Sbjct: 62  VGEEGVEKVFNVLRAEFVEEPTNWSRRYKANLEKLQSGDVIKVAEVVRDLWRREQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E+++   A   +V E+A      E EA  +++  L+S
Sbjct: 122 TGEKRMLSKARQILVSELALAEKKEESEAEAILDEVLAS 160


>gi|332976449|gb|EGK13297.1| CarD family transcriptional regulator [Desmospora sp. 8437]
          Length = 162

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/155 (26%), Positives = 79/155 (50%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  ++E+E+ G K  +++I      + + +P  +  D+G+R + 
Sbjct: 5   FQVGDKIVYPLHGAGVIDAVEEKEILGKKQRYYIIHMSLGNVQIMIPADRIDDMGLRHIV 64

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +E    L           W++R +    K+ +GD+    EV+RDL + + +     
Sbjct: 65  DPDTMENVFLLFNDDPSASSGSWNQRFRMNMDKMKTGDIFKTTEVIRDLAQINKEKSLGT 124

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
            E++L ++A   ++ E+  V  I E +AI L++  
Sbjct: 125 GEKKLLDNAKQILISELVLVKEIEEEQAIQLLDEA 159


>gi|67458425|ref|YP_246049.1| transcriptional regulator [Rickettsia felis URRWXCal2]
 gi|67003958|gb|AAY60884.1| Transcriptional regulator [Rickettsia felis URRWXCal2]
          Length = 177

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 78/171 (45%), Positives = 114/171 (66%), Gaps = 1/171 (0%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
           T  + +   +  F+ G+ IVYPAHGVG IT I+   +AG +++ +VI+F +DKM LKVPV
Sbjct: 5   TQSENKTEQKSEFKIGQRIVYPAHGVGEITNIEYHTIAGTEIKVYVISFSQDKMTLKVPV 64

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            +A  +G+R ++    ++     ++GK +    MWSRRAQEY+ KINSG+++AIAEV+RD
Sbjct: 65  SRAAVVGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEYEGKINSGNIVAIAEVLRD 124

Query: 122 LHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           LH  +   ++SYSER LYESALNR+  E+A + +I   EAIN +   L  K
Sbjct: 125 LH-KNVDNDRSYSERTLYESALNRLAGELAILENIHPTEAINKLVEVLREK 174


>gi|23465567|ref|NP_696170.1| transcriptional regulator [Bifidobacterium longum NCC2705]
 gi|23326233|gb|AAN24806.1| possible transcriptional regulator [Bifidobacterium longum NCC2705]
          Length = 197

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 55/180 (30%), Positives = 88/180 (48%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
            ++ G+ +VYP HG   +  I E+ V G+  E+  ++      + + VPV  A  +G+R 
Sbjct: 2   SYKVGDMVVYPRHGAAKVEAITERTVKGVTREYLQLSVLSSDGLVINVPVDNAKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           +  A  V +   ++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVSASEVAKVFDILRTPIIEKEMNWSRRYKLNVEKIATGDVNKIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A   +  EIA    I E EA  L++VNL         +K  +   ++AA
Sbjct: 122 LSAGEKRMLTKARAILTSEIALSEKIDEAEAQRLLDVNLGYEPAQPGDDKHHTAEPEEAA 181


>gi|301060351|ref|ZP_07201214.1| CarD-like protein [delta proteobacterium NaphS2]
 gi|300445547|gb|EFK09449.1| CarD-like protein [delta proteobacterium NaphS2]
          Length = 159

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 47/159 (29%), Positives = 87/159 (54%), Gaps = 1/159 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+  VYPAHGVG I +I+ QE++G K +F+V+    + M + +P      +G+R +
Sbjct: 1   MFQVGDLAVYPAHGVGVIEKIESQEISGCKQDFYVMRILDNDMIIMIPTTNVDHVGLRDI 60

Query: 73  SEAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                + +   +++ +   +    W+RR +EY  KI +G +  +AEV RDL       E 
Sbjct: 61  IPKTELPKLFSILKKRDVTLDSQTWNRRYREYMEKIKTGSVFEVAEVYRDLLILRYDKEL 120

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           S+ ER++ ++A   +V+EI+    I+E +  + ++   S
Sbjct: 121 SFGERKMLDTARTLLVKEISLAKEITESQVESDLDRMFS 159


>gi|242280390|ref|YP_002992519.1| CarD family transcriptional regulator [Desulfovibrio salexigens DSM
           2638]
 gi|242123284|gb|ACS80980.1| transcriptional regulator, CarD family [Desulfovibrio salexigens
           DSM 2638]
          Length = 171

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 84/171 (49%), Gaps = 3/171 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F   + +VYP+ GVG +  I+ QE+ G   EF+++    + + L VPV  A ++G+R +
Sbjct: 1   MFELDQLVVYPSQGVGKVERIESQEIGGATAEFYIVRILSNNVTLMVPVMNAHNVGLRAV 60

Query: 73  SEAHFVERALKLVRGKAR---VKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
            +        + ++ ++         W+RR +EY  K+ SGDL  +A V+++L       
Sbjct: 61  CDKDAGMEIFESLKDRSDFTGYTGQNWNRRYREYSEKLKSGDLQDVAYVLKELFLIGRDK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           E S+ ER+L E A+  +  E++    + + E    I    S    K E+ +
Sbjct: 121 ELSFGERRLLEQAMGLVSMELSFALDLDQEEIKEDINALFSDVLEKQEEES 171


>gi|157825168|ref|YP_001492888.1| transcriptional regulator [Rickettsia akari str. Hartford]
 gi|157799126|gb|ABV74380.1| Transcriptional regulator [Rickettsia akari str. Hartford]
          Length = 177

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 79/171 (46%), Positives = 115/171 (67%), Gaps = 1/171 (0%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
           T  + +   + GF+ G+ IVYPAHGVG IT I+   +AG +++ +VI+F +DKM LKVPV
Sbjct: 5   TQSENKTEQKSGFKIGQRIVYPAHGVGEITNIEYNTIAGTEIKVYVISFSQDKMTLKVPV 64

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            +A  +G+R ++    ++     ++GK +    MWSRRAQEY+ KINSG+++AIAEV+RD
Sbjct: 65  SRAAVVGLRAVASRKDLDLIYSTLQGKPKQGNRMWSRRAQEYEGKINSGNIVAIAEVLRD 124

Query: 122 LHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           LH  +   ++SYSER LYESALNR+  E+A + +I   EAIN +   L  K
Sbjct: 125 LH-KNVDNDRSYSERTLYESALNRLAGELAILENIHPTEAINKLVEVLREK 174


>gi|323700581|ref|ZP_08112493.1| transcriptional regulator, CarD family [Desulfovibrio sp. ND132]
 gi|323460513|gb|EGB16378.1| transcriptional regulator, CarD family [Desulfovibrio desulfuricans
           ND132]
          Length = 171

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 48/169 (28%), Positives = 87/169 (51%), Gaps = 3/169 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+  E +VYP+ GVG +  ++ QE+ G+K +F+++    + + L VPV  A+++G+R +
Sbjct: 1   MFKVDELVVYPSQGVGRVERVESQEIGGVKADFYIVRILSNNVTLMVPVANAVNVGLRSV 60

Query: 73  SEAHFVERALKLVRGK---ARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
             A   +   + ++ +          W+RR +EY  K+ SGDL  +A V+++L       
Sbjct: 61  CPADVGQAIFESLKDRTGFTGYTGQNWNRRYREYSEKLKSGDLADVAYVLKELFLIGKDK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEK 178
           E S+ ER+L E A+  +  E+A     S+ E    I    +   +  EK
Sbjct: 121 ELSFGERRLLEQAMGLVSMELAYSLDRSQEEIKGDINEMFADVIAAQEK 169


>gi|308235377|ref|ZP_07666114.1| CarD-like protein [Gardnerella vaginalis ATCC 14018]
          Length = 198

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 92/180 (51%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
           G++ G+ +VYP HG   + EI E+ V G+  ++  +       + + VPV     +G+R 
Sbjct: 2   GYQVGDMVVYPRHGAARVEEISERTVKGITRQYLRLVVLSSDGLEINVPVDNVKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           +  A  V +  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVGAKEVAKVFEILRTPILEKEMNWSRRYKLNVEKIATGDVNKIAEVVRDLSQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A + ++ EIA    I E +A  L+ VNL  +      E+  ++  ++AA
Sbjct: 122 LSAGEKRMLARARSILISEIALSEKIDEEQAERLLNVNLGYADPLPGDEQHHTQAPEEAA 181


>gi|317481883|ref|ZP_07940910.1| CarD-like/TRCF domain-containing protein [Bifidobacterium sp.
           12_1_47BFAA]
 gi|316916674|gb|EFV38069.1| CarD-like/TRCF domain-containing protein [Bifidobacterium sp.
           12_1_47BFAA]
          Length = 197

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 55/180 (30%), Positives = 87/180 (48%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
            ++ G+ +VYP HG   +  I E+ V G+  E+  ++      + + VPV  A  +G+R 
Sbjct: 2   SYKVGDMVVYPRHGAAKVEAITERTVKGVTREYLQLSVLSSDGLVINVPVDNAKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           +  A  V +   ++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVSASEVAKVFGILRTPIIEKEMNWSRRYKLNVEKIATGDVNKIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A   +  EIA    I E EA  L++VNL         +K  +   + AA
Sbjct: 122 LSAGEKRMLTKARAILTSEIALSEKIDEAEAQRLLDVNLGYEPAQPGDDKHHTAEPEDAA 181


>gi|312144273|ref|YP_003995719.1| transcriptional regulator, CarD family [Halanaerobium sp.
           'sapolanicus']
 gi|311904924|gb|ADQ15365.1| transcriptional regulator, CarD family [Halanaerobium sp.
           'sapolanicus']
          Length = 166

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 40/155 (25%), Positives = 77/155 (49%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            ++ G+ +VYP HG GTI  I+ + +   K +++++     +M + +PV K   IG+R +
Sbjct: 1   MYKIGDKVVYPNHGAGTIVGIETKTILDEKKKYYIMKLPIGEMKVMIPVDKIDKIGIRDV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                     KL+ G+       W+RR +    K+ +GD+  +AEVVR+L   D +   S
Sbjct: 61  ISEEKANDVFKLLNGEKSKMSQNWNRRYRANQEKLKTGDIFEVAEVVRNLSIRDREKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEV 167
             E+++  +A   ++ E+     + E E    ++ 
Sbjct: 121 TGEKKMLSNARKILISELVLAKDMDEEEIAEKMDD 155


>gi|332703818|ref|ZP_08423906.1| transcriptional regulator, CarD family [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332553967|gb|EGJ51011.1| transcriptional regulator, CarD family [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 194

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 47/160 (29%), Positives = 81/160 (50%), Gaps = 3/160 (1%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F   + +VYPA GVG +  I+ QE+ G   EF+++    + + L VPV  A ++G+R + 
Sbjct: 26  FSPNDLVVYPAQGVGRVERIQRQEIGGASTEFYIVRILSNNVTLMVPVPNARNVGLRPVC 85

Query: 74  EAHFVERALKLVRGKAR---VKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
            A   E  L+ ++ ++         W+RR +EY  K+ SG L  +A V+++L    +  E
Sbjct: 86  SATSGEAILESLKDRSDFTGYTGQNWNRRYREYSEKLKSGALEDVAYVLKELLLIGNDKE 145

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            S+ ER+L E A+N +  E++      + E    I     
Sbjct: 146 LSFGERRLLEQAMNLITLELSFCLEKPQKEIQERINSLFE 185


>gi|225351869|ref|ZP_03742892.1| hypothetical protein BIFPSEUDO_03471 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157116|gb|EEG70455.1| hypothetical protein BIFPSEUDO_03471 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 198

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 55/180 (30%), Positives = 94/180 (52%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
           G++ G+ +VYP HG   +  I E+ V G+  E+  ++      + + VPV  A  +G+R 
Sbjct: 2   GYKVGDMVVYPRHGAAKVEAITERTVKGITREYLQLSVLSSDGLVINVPVDNAKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           + +A+ V +  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVDANEVAKVFEILRTPIIEKEMNWSRRYKLNVEKIATGDVNKIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A + +  EI+    + E EA  L++VNL         E+  +E  ++AA
Sbjct: 122 LSAGEKRMLTKARSILTSEISLSEHLDEAEAQRLLDVNLGYEPAQPGDEEHHTEAPEEAA 181


>gi|83942849|ref|ZP_00955310.1| transcriptional regulator, CarD family protein [Sulfitobacter sp.
           EE-36]
 gi|83846942|gb|EAP84818.1| transcriptional regulator, CarD family protein [Sulfitobacter sp.
           EE-36]
          Length = 160

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 99/156 (63%), Positives = 118/156 (75%)

Query: 17  GEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLSEAH 76
            E +VYPAHGVG I  ++EQEVAG+ LE FVIAF+KDKM L+VP  KA +IGMR LS   
Sbjct: 1   NEFVVYPAHGVGQIISVEEQEVAGISLELFVIAFEKDKMTLRVPTHKATEIGMRALSSPD 60

Query: 77  FVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSYSER 136
            +  A+K ++GKA+VKR MWSRRAQEY+ KINSGDLIAIAEVVRDLHRTD Q E+SYSER
Sbjct: 61  VISHAMKTLKGKAKVKRAMWSRRAQEYEQKINSGDLIAIAEVVRDLHRTDDQREQSYSER 120

Query: 137 QLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           QLYE+AL R+ RE+AAV    E  A   +   L S+
Sbjct: 121 QLYEAALERLTREVAAVAGGDELAASKQVGDVLESR 156


>gi|15891953|ref|NP_359667.1| hypothetical protein RC0030 [Rickettsia conorii str. Malish 7]
 gi|157827900|ref|YP_001494142.1| hypothetical protein A1G_00190 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932588|ref|YP_001649377.1| carD-like transcriptional regulator [Rickettsia rickettsii str.
           Iowa]
 gi|238650343|ref|YP_002916195.1| carD-like transcriptional regulator [Rickettsia peacockii str.
           Rustic]
 gi|15619064|gb|AAL02568.1| unknown [Rickettsia conorii str. Malish 7]
 gi|157800381|gb|ABV75634.1| hypothetical protein A1G_00190 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907675|gb|ABY71971.1| carD-like transcriptional regulator [Rickettsia rickettsii str.
           Iowa]
 gi|238624441|gb|ACR47147.1| carD-like transcriptional regulator [Rickettsia peacockii str.
           Rustic]
          Length = 173

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +   +  F+ G+ IVYPAHGVG IT I+   +AG +++ +VI+F +DKM LKVPV +A  
Sbjct: 6   QSEQKSEFKIGQRIVYPAHGVGEITNIEYHTIAGTEIKVYVISFSQDKMTLKVPVSRAAV 65

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +G+R ++    ++     ++GK +    MWSRRAQEY+ KINSG+++AIAEV+RDLH  +
Sbjct: 66  VGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEYEGKINSGNIVAIAEVLRDLH-KN 124

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
              ++SYSER LYESALNR+  E+A + +I   EAIN +   L  K
Sbjct: 125 VDNDRSYSERTLYESALNRLAGELAILENIHPTEAINKLVEVLREK 170


>gi|158319511|ref|YP_001512018.1| CarD family transcriptional regulator [Alkaliphilus oremlandii
           OhILAs]
 gi|158139710|gb|ABW18022.1| transcriptional regulator, CarD family [Alkaliphilus oremlandii
           OhILAs]
          Length = 167

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 47/161 (29%), Positives = 85/161 (52%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  GE +VYP HG G I  I+E+E+ G + +++++      M + +P+ +  DIG+RK+
Sbjct: 1   MFNIGEKVVYPIHGAGVIESIEEREILGERRKYYIMKMPIGDMQVMIPLDQIDDIGIRKV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +   L+++          W+RR +     I +GD+  +A+VVR+L   + +   S
Sbjct: 61  IDVEEIGSVLEILASDTTKMHQNWNRRYRANMDLIKTGDIYEVADVVRNLTLMEKEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
             ER++  +A   ++ EI  V  ISE EA  L+E  +  + 
Sbjct: 121 TGERKMLNNARQILLSEIVLVAEISEEEASKLVEKVILQQE 161


>gi|86157697|ref|YP_464482.1| CarD family transcriptional regulator [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|197122995|ref|YP_002134946.1| CarD family transcriptional regulator [Anaeromyxobacter sp. K]
 gi|220917784|ref|YP_002493088.1| transcriptional regulator, CarD family [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|85774208|gb|ABC81045.1| transcriptional regulator, CarD family [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|196172844|gb|ACG73817.1| transcriptional regulator, CarD family [Anaeromyxobacter sp. K]
 gi|219955638|gb|ACL66022.1| transcriptional regulator, CarD family [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 171

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 91/158 (57%), Gaps = 1/158 (0%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+  VYP  GVG +  I+ +EVAG +  F+V+   ++ M + +P+ K   +G+R++ 
Sbjct: 13  FKVGDKAVYPGQGVGEVMGIEHKEVAGQRQSFYVLRILENGMKIMIPMNKVGSVGLREII 72

Query: 74  EAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
               V R   ++R K   V  T W+RR +EY  KI +G +  IAEV+RDL+   S  + S
Sbjct: 73  GEKDVRRVYGILREKEVSVDSTTWNRRYREYMDKIKTGSVFEIAEVLRDLYLLRSDKDLS 132

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           + ER++ ++A + +++E+A   +  E +  + ++   +
Sbjct: 133 FGERKMLDTARSLLIKELAIAKACDEQDVEDDLKKIFN 170


>gi|294827601|ref|NP_710430.2| transcriptional regulator [Leptospira interrogans serovar Lai str.
           56601]
 gi|293385445|gb|AAN47448.2| transcriptional regulator [Leptospira interrogans serovar Lai str.
           56601]
          Length = 181

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 59/183 (32%), Positives = 95/183 (51%), Gaps = 2/183 (1%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++K        + G+++VYP HGVG I EI ++ + G K + +V+     KM + +P
Sbjct: 1   MAAKKKNS--EIEHKVGDYVVYPIHGVGEILEISKKNILGKKKDCYVLEIQGSKMKVMIP 58

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA  + +R + +   +++ + L++         W  R Q    KI SG +  + EV R
Sbjct: 59  VDKAEQVRIRPIIDKKEIKKVIALLKKDEVDTEEDWKIRYQNNLNKIKSGSIYEVGEVCR 118

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           +L R  S  E S  ER+LYESA N +  E+A    +++ EA NL+   L+S  S +EK  
Sbjct: 119 NLFRRASGKELSIMERKLYESAYNLVKMEVALSKGVTQEEAGNLVSDVLASTLSPSEKKA 178

Query: 181 SEN 183
            E 
Sbjct: 179 EEE 181


>gi|157964091|ref|YP_001498915.1| transcriptional regulator [Rickettsia massiliae MTU5]
 gi|157843867|gb|ABV84368.1| Transcriptional regulator [Rickettsia massiliae MTU5]
          Length = 195

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 78/171 (45%), Positives = 114/171 (66%), Gaps = 1/171 (0%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
           T  + +   +  F+ G+ IVYPAHGVG IT I+   +AG +++ +VI+F +DKM LKVPV
Sbjct: 23  TQSEHKTEQKSEFKIGQRIVYPAHGVGEITNIEYHTIAGTEIKVYVISFSQDKMTLKVPV 82

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            +A  +G+R ++    ++     ++GK +    MWSRRAQEY+ KINSG+++AIAEV+RD
Sbjct: 83  SRAAVVGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEYEGKINSGNIVAIAEVLRD 142

Query: 122 LHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           LH  +   ++SYSER LYESALNR+  E+A + +I   EAIN +   L  K
Sbjct: 143 LH-KNVDNDRSYSERTLYESALNRLAGELAILENIHPTEAINKLVEVLREK 192


>gi|218781211|ref|YP_002432529.1| CarD family transcriptional regulator [Desulfatibacillum
           alkenivorans AK-01]
 gi|218762595|gb|ACL05061.1| transcriptional regulator, CarD family [Desulfatibacillum
           alkenivorans AK-01]
          Length = 177

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 44/165 (26%), Positives = 83/165 (50%), Gaps = 1/165 (0%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            +    F   +  VYPAHGVG I  ++ + + G K  F+++   ++ M + +P      +
Sbjct: 13  ASEEYTFSVNDLAVYPAHGVGRIEAVETRTIGGEKQSFYIMRILENDMVIMIPTQNVESV 72

Query: 68  GMRKLSEAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           G+R++     V +   ++  K        W+RR ++Y  KI +G L  +A V RDL+   
Sbjct: 73  GLREVIRKGDVSQVYAILGEKEIPPDNQTWNRRYRDYMEKIKTGSLFEVAGVFRDLYLLK 132

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
              + S+ ER+L ++A   +++E++   S +E   ++ IE  L S
Sbjct: 133 VTKDLSFGERKLLDTAQTLLLKELSIAKSCTEEVIMSEIESLLES 177


>gi|229817858|ref|ZP_04448140.1| hypothetical protein BIFANG_03144 [Bifidobacterium angulatum DSM
           20098]
 gi|229784758|gb|EEP20872.1| hypothetical protein BIFANG_03144 [Bifidobacterium angulatum DSM
           20098]
          Length = 197

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 58/180 (32%), Positives = 95/180 (52%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
           G++ G+ +VYP HG   +  I E+ V G+  E+  ++      + + VPV  A  +G+R 
Sbjct: 2   GYKVGDMVVYPRHGAARVEAITERTVRGVTREYLELSVLSADGLVINVPVDNAKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           + +A+ V +  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVDANEVAKVFEILRTPIIEKEMNWSRRYKLNVEKIATGDVNNIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A + +  EIA    I E EA  L++VNL  S      EK  ++  ++AA
Sbjct: 122 LSAGEKRMLTKARSILTSEIALSEKIEESEAQRLLDVNLGYSPAKPGDEKHHTQEPEEAA 181


>gi|229586256|ref|YP_002844757.1| Transcriptional regulator [Rickettsia africae ESF-5]
 gi|228021306|gb|ACP53014.1| Transcriptional regulator [Rickettsia africae ESF-5]
          Length = 173

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +   +  F+ G+ IVYPAHGVG IT I+   +AG +++ +VI+F +DKM LKVPV +A  
Sbjct: 6   QSEQKSEFKIGQRIVYPAHGVGEITNIEYHTIAGTEIKVYVISFSQDKMTLKVPVSRAAV 65

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +G+R ++    ++     ++GK +    MWSRRAQEY+ KINSG+++AIAEV+RDLH  +
Sbjct: 66  VGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEYEGKINSGNIVAIAEVLRDLH-KN 124

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
              ++SYSER LYESALNR+  E+A + +I   EAIN +   L  K
Sbjct: 125 VDNDRSYSERTLYESALNRLAGELAILENIHPTEAINKLVEVLREK 170


>gi|94967584|ref|YP_589632.1| CarD family transcriptional regulator [Candidatus Koribacter
           versatilis Ellin345]
 gi|94549634|gb|ABF39558.1| transcriptional regulator, CarD family [Candidatus Koribacter
           versatilis Ellin345]
          Length = 186

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 76/172 (44%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HGVG I +I  + +     + + +      + + VP      +G+R++
Sbjct: 14  SFIVGDKVVYPNHGVGIIEQISSRTIGAAVQKCYWLKIKASSLRVMVPFDSVHLVGLRRV 73

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                + + ++ +          W  R +E   K+ +G L+ +A V++ L         S
Sbjct: 74  VRNGEITKIIEYLSDGKCESNHDWKDRFKENSDKMRTGSLMEVAGVLKSLLLLGQSKPLS 133

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQ 184
           + E+++ E A   +V E+A   S  EPE   L+   L     +  +++S  +
Sbjct: 134 FREKKMLERARYLLVSELAMAKSCEEPEVEELLGRALQKCKLRFPEASSIAE 185


>gi|239948445|ref|ZP_04700198.1| transcriptional regulator [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922721|gb|EER22745.1| transcriptional regulator [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 177

 Score =  127 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 78/171 (45%), Positives = 114/171 (66%), Gaps = 1/171 (0%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
           T  + +   +  F+ G+ IVYPAHGVG IT I+   +AG +++ +VI+F +DKM LKVPV
Sbjct: 5   TQSEHKTEQKSEFKIGQRIVYPAHGVGEITNIEYHTIAGTEIKVYVISFSQDKMTLKVPV 64

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            +A  +G+R ++    ++     ++GK +    MWSRRAQEY+ KINSG+++AIAEV+RD
Sbjct: 65  SRAAVVGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEYEGKINSGNIVAIAEVLRD 124

Query: 122 LHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           LH  +   ++SYSER LYESALNR+  E+A + +I   EAIN +   L  K
Sbjct: 125 LH-KNVDNDRSYSERTLYESALNRLAGELAILENIHPTEAINKLVEVLREK 174


>gi|34581009|ref|ZP_00142489.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262394|gb|EAA25898.1| unknown [Rickettsia sibirica 246]
          Length = 173

 Score =  127 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +   +  F+ G+ IVYPAHGVG IT I+   +AG +++ +VI+F +DKM LKVPV +A  
Sbjct: 6   QSEQKSEFKIGQRIVYPAHGVGEITNIEYYTIAGTEIKVYVISFSQDKMTLKVPVSRAAV 65

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +G+R ++    ++     ++GK +    MWSRRAQEY+ KINSG+++AIAEV+RDLH  +
Sbjct: 66  VGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEYEGKINSGNIVAIAEVLRDLH-KN 124

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
              ++SYSER LYESALNR+  E+A + +I   EAIN +   L  K
Sbjct: 125 VDNDRSYSERTLYESALNRLAGELAILENIHPTEAINKLVEVLREK 170


>gi|315186624|gb|EFU20383.1| transcriptional regulator, CarD family [Spirochaeta thermophila DSM
           6578]
          Length = 218

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 54/175 (30%), Positives = 81/175 (46%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT +         F+  +H+VYP  GVG +  I+E+E  G  L ++VI      M + VP
Sbjct: 1   MTSRNTSAQPEPQFKVHDHVVYPLQGVGEVVRIEEREFKGEGLLYYVIYIPVSDMTVMVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA +IG+R +        AL  +    +   T W  R Q     +  G ++ IA VVR
Sbjct: 61  VHKAAEIGIRPIVSREEALEALDFISENPQAGPTDWKTRYQMNLDLLKKGSVMDIARVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSK 175
            L+      E    ER+L+++AL  +V EI+    IS  E    I   L  +S+ 
Sbjct: 121 ALYYRSKIKELPILERKLFDNALRILVDEISFALEISAKEVEARIFQQLEQESAP 175


>gi|183222034|ref|YP_001840030.1| CarD family transcriptional regulator [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189912101|ref|YP_001963656.1| transcriptional regulator [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167776777|gb|ABZ95078.1| Transcriptional regulator [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167780456|gb|ABZ98754.1| Transcriptional regulator, CarD family [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 193

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 100/191 (52%), Gaps = 6/191 (3%)

Query: 1   MTFQQKRDAMRQ-GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKV 59
           M  ++  +  ++  F+ G+++VYP HGVG +TE+ ++ + G K + + +     KM + +
Sbjct: 1   MATKKLNEKTKEPKFKVGDYVVYPIHGVGEVTEVAKKLILGKKKDCYSLEIQGSKMKVSI 60

Query: 60  PVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVV 119
           PV +A+D+G+R + +   +++ L L++         W  R Q    KI SG +  +A+V 
Sbjct: 61  PVDRAMDVGIRSIIDKKEIKKVLTLLKKDEVDTEEDWKVRYQNNMNKIKSGSIFEVADVC 120

Query: 120 RDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS-----KSS 174
           R+L+R     E S  ER+LYESA N +  EIA    + + EA N++   L++        
Sbjct: 121 RNLYRRAYGKELSIMERKLYESAYNLVKMEIALSKGVPQEEAGNIVSDVLAASVQGIAPP 180

Query: 175 KTEKSTSENQD 185
              K   ++ D
Sbjct: 181 PPPKELDDDLD 191


>gi|283783080|ref|YP_003373834.1| CarD-like protein [Gardnerella vaginalis 409-05]
 gi|283440982|gb|ADB13448.1| CarD-like protein [Gardnerella vaginalis 409-05]
          Length = 198

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 90/180 (50%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
            ++ G+ +VYP HG   + EI E+ V G+  ++  +       + + VPV     +G+R 
Sbjct: 2   EYQVGDMVVYPRHGAARVEEISERTVKGVTRQYLRLVVLSSDGLEINVPVDNVKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           +  A  V +  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVGAQEVAKVFEILRTPIVEKEMNWSRRYKLNVEKIATGDVNNIAEVVRDLSQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKT--EKSTSENQDKAA 188
            S  E+++   A + ++ EIA    I E EA  L++VNL  K  +   E   +   ++ A
Sbjct: 122 LSAGEKRMLARARSILISEIALSEKIDEIEAERLLDVNLGYKEPQEGDENHHTVAPEEPA 181


>gi|291059888|gb|ADD72623.1| transcription factor [Treponema pallidum subsp. pallidum str.
           Chicago]
          Length = 243

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 49/163 (30%), Positives = 73/163 (44%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           FR  +H+VYP  GVG + EI E+      L ++VI  ++  M + +PV KA ++G+R + 
Sbjct: 71  FRPHDHVVYPGQGVGQVQEISEKTFKNETLLYYVIYLEESDMTVLIPVDKAQELGIRTIV 130

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +    ERAL+ +          W  R Q       SG ++  A VVR L+      E   
Sbjct: 131 KRKEAERALRFLSEDFDPSPLDWKMRYQVNLNLFKSGGILDNAAVVRSLYHRSKVKELPI 190

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKT 176
            ER+LY+SA      E+     +  PE   LI   L       
Sbjct: 191 QERRLYDSAYRIFQDEMCFALGLRPPEVETLIHGYLEKAKENP 233


>gi|15639502|ref|NP_218952.1| transcription factor (carD) [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189025741|ref|YP_001933513.1| transcription factor [Treponema pallidum subsp. pallidum SS14]
 gi|3322803|gb|AAC65499.1| transcription factor (carD) [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189018316|gb|ACD70934.1| transcription factor [Treponema pallidum subsp. pallidum SS14]
          Length = 208

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 49/163 (30%), Positives = 73/163 (44%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           FR  +H+VYP  GVG + EI E+      L ++VI  ++  M + +PV KA ++G+R + 
Sbjct: 36  FRPHDHVVYPGQGVGQVQEISEKTFKNETLLYYVIYLEESDMTVLIPVDKAQELGIRTIV 95

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +    ERAL+ +          W  R Q       SG ++  A VVR L+      E   
Sbjct: 96  KRKEAERALRFLSEDFDPSPLDWKMRYQVNLNLFKSGGILDNAAVVRSLYHRSKVKELPI 155

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKT 176
            ER+LY+SA      E+     +  PE   LI   L       
Sbjct: 156 QERRLYDSAYRIFQDEMCFALGLRPPEVETLIHGYLEKAKENP 198


>gi|150392190|ref|YP_001322239.1| CarD family transcriptional regulator [Alkaliphilus metalliredigens
           QYMF]
 gi|149952052|gb|ABR50580.1| transcriptional regulator, CarD family [Alkaliphilus
           metalliredigens QYMF]
          Length = 159

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/156 (28%), Positives = 77/156 (49%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ IVYP HG G I  I+E+E+ G K +++++      M + +P+    ++G+R +
Sbjct: 1   MFNIGDKIVYPMHGAGVIEAIEEKEILGKKRKYYIMKMPLGDMQVMIPLDHIEEVGIRSI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                VE+   ++          W+RR +     I  GD+ A+AEVVR+L   D +   S
Sbjct: 61  IGLAEVEQVFAVLAADTTKMPQNWNRRYRANMDLIKGGDIYAVAEVVRNLLLRDREKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
             ER++  +A   +V E+       E E ++ IE  
Sbjct: 121 TGERKMLNNAKQILVSEVVLSTDKEEQEVLDWIENV 156


>gi|125975421|ref|YP_001039331.1| CarD family transcriptional regulator [Clostridium thermocellum
           ATCC 27405]
 gi|256005283|ref|ZP_05430249.1| transcriptional regulator, CarD family [Clostridium thermocellum
           DSM 2360]
 gi|281419382|ref|ZP_06250397.1| transcriptional regulator, CarD family [Clostridium thermocellum
           JW20]
 gi|125715646|gb|ABN54138.1| transcriptional regulator, CarD family [Clostridium thermocellum
           ATCC 27405]
 gi|255990719|gb|EEU00835.1| transcriptional regulator, CarD family [Clostridium thermocellum
           DSM 2360]
 gi|281407002|gb|EFB37265.1| transcriptional regulator, CarD family [Clostridium thermocellum
           JW20]
 gi|316939546|gb|ADU73580.1| transcriptional regulator, CarD family [Clostridium thermocellum
           DSM 1313]
          Length = 158

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/158 (27%), Positives = 84/158 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            +  G+ IVYP HG G I  I+E+E+ G K  ++V+     +M + +P+     IG+R++
Sbjct: 1   MYNIGDKIVYPMHGAGVIESIEEREILGKKQSYYVVKIPIGEMKVLIPIKNVDGIGIREV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 ++   +++ KA    T W++R +E  +KI SG++  +A+VVR L   D     S
Sbjct: 61  ISEEDADKVFLILKNKALPSNTNWNKRYRENMSKIKSGNIFEVADVVRCLMLRDKLKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             E+++  SA   ++ E+    +++  E   +I+  +S
Sbjct: 121 TGEKKMLNSAKQILISELVLAKNMNPMEIEGMIDKYIS 158


>gi|157803212|ref|YP_001491761.1| hypothetical protein A1E_00115 [Rickettsia canadensis str. McKiel]
 gi|157784475|gb|ABV72976.1| hypothetical protein A1E_00115 [Rickettsia canadensis str. McKiel]
          Length = 175

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 79/171 (46%), Positives = 114/171 (66%), Gaps = 2/171 (1%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
           T Q +    +  F+ G+ IVYPAHGVG IT I+   +AG +++ +VI+F +DKM LKVPV
Sbjct: 4   TTQSEHKT-KSEFKIGQRIVYPAHGVGEITNIEYHTIAGTEIKVYVISFAQDKMTLKVPV 62

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            +A  +G+R ++    ++     ++GK +    MWSRRAQEY+ KINSG+++AIAEV+RD
Sbjct: 63  NRATIVGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEYEGKINSGNIVAIAEVLRD 122

Query: 122 LHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           LH  +   ++SYSER LYESALNR+  E+A + +I   EAIN +   L  K
Sbjct: 123 LH-KNVDNDRSYSERTLYESALNRLAGELAILENIHPTEAINKLVEVLREK 172


>gi|148272243|ref|YP_001221804.1| putative transcription factor [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147830173|emb|CAN01106.1| putative transcription factor [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 164

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 84/159 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG  TIT +K + + G+  ++  +   + ++ + VPV  A  +G+R + 
Sbjct: 3   FEVGETVVYPHHGAATITAVKTRTIKGVDKKYITLQIHQSELVIDVPVDNAELVGLRDVI 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           ++  VE    ++RG    +   WSRR +    K+ SGD+  ++EVVRDL R D     S 
Sbjct: 63  DSSGVEAVFDVLRGDVEEEAGNWSRRFKANTEKMGSGDVRRVSEVVRDLWRRDQDSGVSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            E+++   A   +V E+A     ++ EA  +++  L+  
Sbjct: 123 GEKRMLSKARQILVSELALAQKSTDEEASVVLDGVLAQS 161


>gi|315605258|ref|ZP_07880304.1| CarD family transcriptional regulator [Actinomyces sp. oral taxon
           180 str. F0310]
 gi|315313075|gb|EFU61146.1| CarD family transcriptional regulator [Actinomyces sp. oral taxon
           180 str. F0310]
          Length = 172

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/165 (27%), Positives = 84/165 (50%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG  TI E+  + + G +  +  +  ++  + ++VP      +G+R +
Sbjct: 2   SFEIGQTVVYPHHGAATIEEVMTRTIRGEERTYLKLRVNQGDLEIQVPAENVDMVGVRDI 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +E  L ++R     + T WSRR +    KI +GD++ +AEVVRDL R D   + S
Sbjct: 62  VDEDGLEEVLSVLRAPYVEEPTNWSRRFKANQEKIATGDIVKVAEVVRDLTRRDDLKKLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTE 177
             E+++   A + +  E+A   +I +  A   ++  L+    + E
Sbjct: 122 TGEKRMLTKARSILTSELALARNIEKTAAAERLDSVLAEGRIEIE 166


>gi|154508491|ref|ZP_02044133.1| hypothetical protein ACTODO_00992 [Actinomyces odontolyticus ATCC
           17982]
 gi|293194140|ref|ZP_06609941.1| transcriptional regulator, CarD family [Actinomyces odontolyticus
           F0309]
 gi|153798125|gb|EDN80545.1| hypothetical protein ACTODO_00992 [Actinomyces odontolyticus ATCC
           17982]
 gi|292819782|gb|EFF78793.1| transcriptional regulator, CarD family [Actinomyces odontolyticus
           F0309]
          Length = 172

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 85/171 (49%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG  TI E+  + + G +  +  +  ++  + ++VP      +G+R +
Sbjct: 2   SFEIGQTVVYPHHGAATIEEVMTRTIRGEERTYLKLRVNQGDLEIQVPAENVDMVGVRDI 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +E  L ++R     + T WSRR +    KI +GD++ +AEVVRDL R D   + S
Sbjct: 62  VDEDGLEEVLSVLRAPYIEEPTNWSRRFKANQEKIATGDIVKVAEVVRDLTRRDDLKKLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSEN 183
             E+++   A   +  E+A   +I +  A   ++  L+    + E+   E 
Sbjct: 122 TGEKRMLTKARGILTSELALARNIEKSAAAERLDAVLAEGRIEVEEDAVEE 172


>gi|296128524|ref|YP_003635774.1| transcriptional regulator, CarD family [Cellulomonas flavigena DSM
           20109]
 gi|296020339|gb|ADG73575.1| transcriptional regulator, CarD family [Cellulomonas flavigena DSM
           20109]
          Length = 160

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 81/158 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I EIK + + G +  +  +      + ++VP      +G+R + 
Sbjct: 3   FTVGETVVYPHHGAAKIEEIKSRTIRGEEKIYLKLKVAHGDLTIEVPAENVDLVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               ++R  +++R     + T WSRR +    K+ SGD+I +AEVVRDL R D+    S 
Sbjct: 63  GQEGLDRVFEVLRAPYTEEPTNWSRRYKANLEKLQSGDVIKVAEVVRDLSRRDADRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A      E +A  +++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAEKTEEEKAEAILDEVLAS 160


>gi|78045099|ref|YP_361149.1| CarD family transcriptional regulator [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77997214|gb|ABB16113.1| transcriptional regulator, CarD family [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 160

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 51/157 (32%), Positives = 86/157 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G  +VYP HG G I EI+E+  A   ++++V++F    M L +PV K   +G+R +
Sbjct: 1   MFKVGAKVVYPMHGAGIIREIEERLAADRVMKYYVLSFWATNMILWLPVEKVERVGLRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                VE+   +++       + W++R + +  KI S D++AIA+VVRDL R +     S
Sbjct: 61  IGKDMVEKVFAVLKEGEEKIHSNWNKRYKNHVDKIKSNDILAIADVVRDLRRREKVKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
             E++L ESA   +V E+  V    E + + +IE  +
Sbjct: 121 TGEKKLLESARQILVSELILVLEEDEEKVLAMIEEAI 157


>gi|95929125|ref|ZP_01311870.1| transcriptional regulator, CarD family [Desulfuromonas acetoxidans
           DSM 684]
 gi|95135026|gb|EAT16680.1| transcriptional regulator, CarD family [Desulfuromonas acetoxidans
           DSM 684]
          Length = 162

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  G+  VYPA GVG I  I+ +E +G + +F+V+      M + VP   A  +GMR L 
Sbjct: 3   FSVGDKAVYPAQGVGIIESIETKEFSGEEHDFYVLRICDSDMTIMVPTANAEQVGMRGLV 62

Query: 74  EAHFVERALKLVRGKARV--KRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
           +   V++   +++    +    + WSRR +EY+ KI SGDL+ +A V+R+L+   +  E 
Sbjct: 63  DKAHVQKVYDVLQNTDAMAGSISSWSRRQREYNEKIKSGDLLEVAAVLRELYMIGNGKEL 122

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
           SY E+++ E A   +V+E+A    + E +  + +E   
Sbjct: 123 SYGEKKVLELARRLVVKEVAFAEGVEEDQICSRVEGVF 160


>gi|170781116|ref|YP_001709448.1| hypothetical protein CMS_0684 [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169155684|emb|CAQ00804.1| conserved hypothetical protein [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 164

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 84/159 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG  TIT +K + + G+  ++  +   + ++ + VPV  A  +G+R + 
Sbjct: 3   FEVGETVVYPHHGAATITAVKTRTIKGVDKKYITLQIHQSELVIDVPVDNAELVGLRDVI 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           ++  VE    ++RG    +   WSRR +    K+ SGD+  ++EVVRDL R D     S 
Sbjct: 63  DSSGVEAVFDVLRGDVEEEAGNWSRRFKANTEKMGSGDVRRVSEVVRDLWRRDQDSGVSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            E+++   A   +V E+A     ++ EA  +++  L+  
Sbjct: 123 GEKRMLAKARQILVSELALAQKSTDEEASVVLDGVLAQS 161


>gi|189183652|ref|YP_001937437.1| hypothetical protein OTT_0745 [Orientia tsutsugamushi str. Ikeda]
 gi|189180423|dbj|BAG40203.1| hypothetical protein OTT_0745 [Orientia tsutsugamushi str. Ikeda]
          Length = 169

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 68/165 (41%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
             ++ F+ G+ +VYP+HGVG +  I+ Q   G +L  +V++F  DKM LKVPV      G
Sbjct: 4   QQQEQFKIGDKVVYPSHGVGEVIGIENQVFCGKELRVYVVSFPMDKMTLKVPVNSKSASG 63

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           +R +S     ++  K++  +++    MWSRRAQEY+ KINSGDL +IAEVVRDL+  +++
Sbjct: 64  LRAISYKTDTDKIYKILCSQSQPGNRMWSRRAQEYENKINSGDLCSIAEVVRDLY-KNAE 122

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            ++SYSER +YESA+ R+ RE+A + S+   E I  +   L +++
Sbjct: 123 VDRSYSERTIYESAITRLARELAILESLKYEEIIEKLTEILKNRN 167


>gi|270284727|ref|ZP_05966557.2| transcriptional regulator [Bifidobacterium gallicum DSM 20093]
 gi|270276297|gb|EFA22151.1| transcriptional regulator [Bifidobacterium gallicum DSM 20093]
          Length = 198

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 57/180 (31%), Positives = 94/180 (52%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
           G++ G+ +VYP HG   +  I E+ V G+  E+  ++      + + VPV  A  +G+R 
Sbjct: 2   GYKVGDMVVYPRHGAAKVEAITERTVKGVTREYLQLSVLSSDGLVINVPVENAKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           + +AH V +  +++R     K   WSRR +    K+ +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVDAHEVAKVFEILRTPIIEKEMNWSRRYKLNVEKLATGDVNKIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A + +  EIA    + E EA  L++VNL  S      ++  S   D+AA
Sbjct: 122 LSAGEKRMLTKARSVLTSEIALSEKLEETEAQRLLDVNLGYSEPLPGDDRHHSFAPDEAA 181


>gi|154487498|ref|ZP_02028905.1| hypothetical protein BIFADO_01353 [Bifidobacterium adolescentis
           L2-32]
 gi|154084016|gb|EDN83061.1| hypothetical protein BIFADO_01353 [Bifidobacterium adolescentis
           L2-32]
          Length = 198

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 56/180 (31%), Positives = 92/180 (51%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
           G++ G+ +VYP HG   +  I E+ V G+  E+  ++      + + VPV  A  +G+R 
Sbjct: 2   GYKVGDMVVYPRHGAAKVEAITERTVKGVTREYLQLSVLSSDGLVINVPVENAKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           +  A  V +  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVGAKEVAKVFEILRTPIIEKEMNWSRRYKLNVEKIATGDVNKIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A + +  EIA    + E EA  L++VNL   +     E   +E  ++AA
Sbjct: 122 LSAGEKRMLTKARSILTSEIALSEHLDENEAQRLLDVNLGYEAPRPGDEDHHTEAPEEAA 181


>gi|227485949|ref|ZP_03916265.1| transcription factor CarD [Anaerococcus lactolyticus ATCC 51172]
 gi|227235994|gb|EEI86009.1| transcription factor CarD [Anaerococcus lactolyticus ATCC 51172]
          Length = 160

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 78/157 (49%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG G I  +++ E  G + E++++     +M + +P     D  +R +
Sbjct: 2   MFKVGDKIVYPMHGAGVIDAVEKIEFMGEEREYYILKMPIGEMDISIPADNMKDANIRFI 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                    L ++  K     + W++R ++    + +GD+  IA++VR+L   DS    S
Sbjct: 62  ISKEEGLEVLAILDDKPTEMNSNWTKRYRDNQEILKTGDIFEIAKMVRNLAILDSDKGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            +E++L   A   +  E+    S+ + EA  +I+ ++
Sbjct: 122 TTEKKLLNRARRILASELVMAGSLEKEEAEKMIDESI 158


>gi|227496787|ref|ZP_03927058.1| transcription factor CarD [Actinomyces urogenitalis DSM 15434]
 gi|226833703|gb|EEH66086.1| transcription factor CarD [Actinomyces urogenitalis DSM 15434]
          Length = 164

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 50/161 (31%), Positives = 85/161 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE +VYP HG   I +I++++V G +  +  +   +  + + VP      IG+R + 
Sbjct: 3   FEVGETVVYPHHGAARIIDIRQRKVRGEEKTYLQLEVAQGDLTILVPAESVDYIGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +A  +E+   ++R     + T WSRR +    KI SGD+I +AEVVRDL R D+    S 
Sbjct: 63  DAAGLEKVFDVLRAPLTEEPTNWSRRFKANQEKIASGDVIKVAEVVRDLSRRDTDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            E+++   A   +V E+A      E  A + ++  L+S ++
Sbjct: 123 GEKRMLSKARQILVSELALAEKTEEEAAESKLDEVLASGTA 163


>gi|227495622|ref|ZP_03925938.1| possible transcription factor CarD [Actinomyces coleocanis DSM
           15436]
 gi|226830854|gb|EEH63237.1| possible transcription factor CarD [Actinomyces coleocanis DSM
           15436]
          Length = 169

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 46/158 (29%), Positives = 75/158 (47%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  GE IVYP HG  TI EI  +E  G K  +  +   +  + ++VP      +G R + 
Sbjct: 3   FHIGETIVYPHHGAATIEEINVREFKGEKRTYLTLRVAQGDLTIQVPADNVEMVGGRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +    +  + ++   +  +  +WSRR ++   KI SG + ++AEVVRDL R D+    S 
Sbjct: 63  DEGGFQEVVDILHEDSTDEPAIWSRRYKQNQEKIASGSIRSVAEVVRDLTRRDAVKGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+ +   A   +  E+A    I E  A   ++  L  
Sbjct: 123 GEKCMLSKARQILTSEVALARGIDEAAAHICLDEILEE 160


>gi|115378642|ref|ZP_01465793.1| transcriptional regulator, CarD family [Stigmatella aurantiaca
           DW4/3-1]
 gi|310820620|ref|YP_003952978.1| carD domain-containing protein transcriptional regulator
           [Stigmatella aurantiaca DW4/3-1]
 gi|115364354|gb|EAU63438.1| transcriptional regulator, CarD family [Stigmatella aurantiaca
           DW4/3-1]
 gi|309393692|gb|ADO71151.1| Transcriptional regulator, CarD domain protein [Stigmatella
           aurantiaca DW4/3-1]
          Length = 165

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 48/161 (29%), Positives = 92/161 (57%), Gaps = 1/161 (0%)

Query: 11  RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMR 70
           +  F+TG+  VYP  GVG +  I+  EVAG +  F+V+   ++ M + +P+ K   +G+R
Sbjct: 2   QTSFKTGDKAVYPGQGVGEVMGIEHTEVAGQRQSFYVLRILENGMRIMIPINKVGLVGLR 61

Query: 71  KLSEAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           ++     V++   +++ K   V  T W+RR +EY  KI +G +  IAEV+RDL+      
Sbjct: 62  EIISEEDVKQVYSILKEKDISVDSTTWNRRYREYMEKIKTGSVFEIAEVLRDLYLLKGDK 121

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           + S+ ER++ ++A + +++E++     SE E  + ++   +
Sbjct: 122 DLSFGERKMLDTARSLLIKELSLAKDCSEEEIESDLKKIFN 162


>gi|254293138|ref|YP_003059161.1| CarD family transcriptional regulator [Hirschia baltica ATCC 49814]
 gi|254041669|gb|ACT58464.1| transcriptional regulator, CarD family [Hirschia baltica ATCC
           49814]
          Length = 171

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 96/168 (57%), Positives = 126/168 (75%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +      F   +HIVYPAHGVG +T ++ QEVA MKLE +V+AF++DK+ L+VP  KA  
Sbjct: 4   QAGTGSMFEVEQHIVYPAHGVGRVTAVEVQEVADMKLEVYVVAFEQDKLILRVPTAKAKS 63

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
            GMR L+    V  A+K + G+AR+KRTMWSRRAQEY+AKINSGDLI+IAEVVRDLHR D
Sbjct: 64  SGMRSLASTKVVGDAIKTLGGRARIKRTMWSRRAQEYEAKINSGDLISIAEVVRDLHRAD 123

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            QP++SYSERQLYESAL+RM RE+A V +I   EA+  +  +L+ +++
Sbjct: 124 DQPDQSYSERQLYESALDRMARELAVVENIEHTEAVARLSQSLAQRAA 171


>gi|119025686|ref|YP_909531.1| transcriptional regulator [Bifidobacterium adolescentis ATCC 15703]
 gi|118765270|dbj|BAF39449.1| possible transcriptional regulator [Bifidobacterium adolescentis
           ATCC 15703]
          Length = 198

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 56/180 (31%), Positives = 93/180 (51%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
           G++ G+ +VYP HG   +  I E+ V G+  E+  ++      + + VPV  A  +G+R 
Sbjct: 2   GYKVGDMVVYPRHGAAKVEAITERTVKGVTREYLQLSVLSSDGLVINVPVENAKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           +  A  V +  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVGAKEVAKVFEILRTPIIEKEMNWSRRYKLNVEKIATGDVNKIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKT--EKSTSENQDKAA 188
            S  E+++   A + +  EIA    + E EA  L++VNL  +  +   E   +E  ++AA
Sbjct: 122 LSAGEKRMLTKARSILTSEIALSEHLDENEAQRLLDVNLGYEPPRPGDEDHHTEAPEEAA 181


>gi|153005358|ref|YP_001379683.1| CarD family transcriptional regulator [Anaeromyxobacter sp.
           Fw109-5]
 gi|152028931|gb|ABS26699.1| transcriptional regulator, CarD family [Anaeromyxobacter sp.
           Fw109-5]
          Length = 171

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 90/158 (56%), Gaps = 1/158 (0%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+  VYP  GVG +  I+ +EVAG +  F+V+   ++ M + +P+ K   +G+R++ 
Sbjct: 13  FKVGDKAVYPGQGVGEVMGIEHKEVAGQRQSFYVLRILENGMKIMIPMNKVGSVGLREII 72

Query: 74  EAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
               V R   ++R K   V  T W+RR +EY  KI +G +  IAEV+RDL+   S  + S
Sbjct: 73  GEKDVRRVYTILREKEVSVDSTTWNRRYREYMDKIKTGSVFEIAEVLRDLYLLRSDKDLS 132

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           + ER++ ++A + +++E+A      E +  + ++   +
Sbjct: 133 FGERKMLDTARSLLIKELAIAKECGEDDVEDDLKKIFN 170


>gi|227489404|ref|ZP_03919720.1| CarD family transcriptional regulator [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227540998|ref|ZP_03971047.1| CarD family transcriptional regulator [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227090582|gb|EEI25894.1| CarD family transcriptional regulator [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227183258|gb|EEI64230.1| CarD family transcriptional regulator [Corynebacterium
           glucuronolyticum ATCC 51866]
          Length = 193

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 47/180 (26%), Positives = 86/180 (47%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG   + + +++E  G   +F V+      + ++VPV  A  +G+R +
Sbjct: 2   EFNVGDIVVYPHHGAAEVAKTEQREHKGEMTDFLVLKILHSDLVVRVPVANAEYVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +E+   ++R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VGKEGLEKVFGMLRETDVEEAGNWSRRYKANQERLASGDVNKVAEVVRDLWRRDQDRGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEA---INLIEVNLSSK-SSKTEKSTSENQDKAA 188
             E+++   A   +V E+A    + +  A      +   L+ +  ++  K  SE + + A
Sbjct: 122 AGEKRMLAKARQILVGELALAGPVDDKLADDFEARLTEELNRQREARAPKLASELEPEEA 181


>gi|148284672|ref|YP_001248762.1| putative transcriptional factor regulator [Orientia tsutsugamushi
           str. Boryong]
 gi|146740111|emb|CAM80284.1| putative transcriptional factor regulator [Orientia tsutsugamushi
           str. Boryong]
          Length = 169

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 68/165 (41%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
             ++ F+ G+ +VYP+HGVG +  I+ Q   G +L  +V++F  DKM LKVPV      G
Sbjct: 4   QQQEQFKIGDKVVYPSHGVGEVIGIENQVFCGKELRVYVVSFPMDKMTLKVPVNSKSTSG 63

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           +R +S     ++  K++  +++    MWSRRAQEY+ KINSGDL +IAEVVRDL+  +++
Sbjct: 64  LRAISYKTDTDKIYKILSSQSQPGNRMWSRRAQEYENKINSGDLCSIAEVVRDLY-KNAE 122

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            ++SYSER +YESA+ R+ RE+A + S+   E I  +   L +++
Sbjct: 123 VDRSYSERIIYESAITRLARELAILESVKYEEIIEKLTEILKNRN 167


>gi|294790738|ref|ZP_06755896.1| transcriptional regulator, CarD family [Scardovia inopinata F0304]
 gi|294458635|gb|EFG26988.1| transcriptional regulator, CarD family [Scardovia inopinata F0304]
          Length = 219

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 50/180 (27%), Positives = 86/180 (47%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
            ++ G+ +VYP HG   I EI E+ + G+   +  +       + + VP      +G+R+
Sbjct: 2   EYKVGDTVVYPRHGAARIEEISERTLRGVTRTYLRLTVLSSDGLEISVPADSVEKVGVRE 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRT-DSQPE 130
           +     V +  +++R     ++T WSRR +    KI +GD+  IAEVVRDL +  D    
Sbjct: 62  IVNGVAVAKVFEILRTPIVEEKTNWSRRYKLNVEKIATGDVNKIAEVVRDLSQRDDDDHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A   +  EIA    I + EA  L++VNL         +K  ++   + A
Sbjct: 122 LSAGEKRMLSKARGILTSEIALSEGIDDDEAQRLLDVNLGYQDPEPGDDKHHAKAPQEPA 181


>gi|297243682|ref|ZP_06927613.1| CarD-like transcriptional regulator [Gardnerella vaginalis AMD]
 gi|296888433|gb|EFH27174.1| CarD-like transcriptional regulator [Gardnerella vaginalis AMD]
          Length = 208

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 90/180 (50%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
            ++ G+ +VYP HG   + EI E+ V G+  ++  +       + + VPV     +G+R 
Sbjct: 12  EYQVGDMVVYPRHGAARVEEISERTVKGVTRQYLRLVVLSSDGLEINVPVDNVKKVGVRD 71

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           +  A  V +  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 72  IVGAQEVAKVFEILRTPIVEKEMNWSRRYKLNVEKIATGDVNNIAEVVRDLSQRDVDEHG 131

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKT--EKSTSENQDKAA 188
            S  E+++   A + ++ EIA    I E EA  L++VNL  K  +   E   +   ++ A
Sbjct: 132 LSAGEKRMLARARSILISEIALSEKIDEIEAERLLDVNLGYKEPQKGDENHHTVAPEEPA 191


>gi|149919688|ref|ZP_01908166.1| transcriptional regulator, CarD family protein [Plesiocystis
           pacifica SIR-1]
 gi|149819459|gb|EDM78889.1| transcriptional regulator, CarD family protein [Plesiocystis
           pacifica SIR-1]
          Length = 165

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 51/164 (31%), Positives = 82/164 (50%), Gaps = 1/164 (0%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
              Q F  G   VYPAHGV  I  ++ + V G  L F+ +      + + VPV KA + G
Sbjct: 2   IAAQRFDIGSTAVYPAHGVADIIGVETKTVGGHDLSFYQLQVRGSGLKIIVPVNKANENG 61

Query: 69  MRKLSEAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           MR L+    ++R  +++R     + R  W+RR + +  KI +G +  +AEV RDL    S
Sbjct: 62  MRPLAGPDAIDRTFQILRDHDVPIDRQTWNRRYRNFMDKIRAGAIEGVAEVYRDLALLRS 121

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
           Q   S+ ER++  +A + +V E+A     SE E    ++    +
Sbjct: 122 QKTLSHGEREMLRTARDLLVGELAVARETSESEVAEELDSMFKN 165


>gi|308274564|emb|CBX31163.1| hypothetical protein N47_E46750 [uncultured Desulfobacterium sp.]
          Length = 183

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 50/170 (29%), Positives = 89/170 (52%), Gaps = 2/170 (1%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
             + F  G+  VYPAHGVG I  I+ + V G K +F++I   ++ M + +P      +G+
Sbjct: 14  EVREFHVGDLAVYPAHGVGRIEAIENKIVNGEKHDFYIIKVLENGMVIMIPTWNVDSVGL 73

Query: 70  RKLSEAHFVERALKLVRGK--ARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           R +     V +    ++ K    +    W+RR ++Y  KI +G L  +AEV RDL+    
Sbjct: 74  RDVISEGEVPKIYDFMKSKKETPIDTQTWNRRYRDYMDKIKTGSLYDVAEVFRDLYLLKL 133

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTE 177
             + S+ ER+L+++A   +V+E++   + SE +  + IE    SK +  +
Sbjct: 134 TKDLSFGERKLFDTAQTLLVKELSTARNTSEDKIFSEIESLFISKENPKD 183


>gi|116624660|ref|YP_826816.1| CarD family transcriptional regulator [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116227822|gb|ABJ86531.1| transcriptional regulator, CarD family [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 170

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 43/159 (27%), Positives = 79/159 (49%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ +VYP  GVG I  I  +       +F+++ F    M + VP   A +IG+R+++
Sbjct: 4   FQIGDKVVYPNQGVGIIENISIRSFGSAFEKFYLLRFGCSSMTVLVPFSNAANIGLRRVT 63

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   + R L  +          W  R +E   K+ SGDL+  AEV + L +       S+
Sbjct: 64  KDREISRILSYLATGWCPLNPDWKVRFKENTDKMQSGDLLKAAEVFKVLLQLHVDKPLSF 123

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            E+++ + A + +V EI+   ++ E  A+ L++  L+  
Sbjct: 124 REKKMLDRARHMLVSEISIARNVPEIHAVGLMQRALAKA 162


>gi|108760890|ref|YP_630846.1| CarD family transcriptional regulator CdnL [Myxococcus xanthus DK
           1622]
 gi|108464770|gb|ABF89955.1| transcriptional regulator, CarD family [Myxococcus xanthus DK 1622]
          Length = 164

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 48/161 (29%), Positives = 92/161 (57%), Gaps = 1/161 (0%)

Query: 11  RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMR 70
           +  F+TG+  VYP  GVG +  I+  EVAG +  F+V+   ++ M + +P+ K   +G+R
Sbjct: 2   QTSFKTGDKAVYPGQGVGEVMGIEHTEVAGQRQSFYVLRILENGMRIMIPINKVGSVGLR 61

Query: 71  KLSEAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           ++     V++   +++ K   V  T W+RR +EY  KI +G +  IAEV+RDL+      
Sbjct: 62  EIISEEDVKQVYSILKEKDISVDSTTWNRRYREYMEKIKTGSVFEIAEVLRDLYLLKGDK 121

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           + S+ ER++ ++A + +++E++     SE E  + ++   +
Sbjct: 122 DLSFGERKMLDTARSLLIKELSLAKDCSEDEIESDLKKIFN 162


>gi|260892305|ref|YP_003238402.1| transcriptional regulator, CarD family [Ammonifex degensii KC4]
 gi|260864446|gb|ACX51552.1| transcriptional regulator, CarD family [Ammonifex degensii KC4]
          Length = 159

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 51/159 (32%), Positives = 89/159 (55%), Gaps = 1/159 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD-KDKMCLKVPVGKAIDIGMRK 71
            F+ G+ +VYP HG G I  I+E+E+ G K E++V+ F   + M + VP+    +IG+R+
Sbjct: 1   MFKVGDKVVYPMHGAGIIEAIEEKEILGQKREYYVLRFPIGNNMKVMVPIDNCQEIGLRR 60

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
           + +   V+  LKL+R         W+ R +    KI SG++ A+AEVVR+L R + +   
Sbjct: 61  VIDKSEVQNVLKLLRSSCTAMPANWNHRYRANLEKIKSGNIYAVAEVVRNLARRERERGL 120

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           S  E+++ E+A   ++ E+     + E EA  L++   +
Sbjct: 121 SSGEKRMLENAKQILISELVLAMEMKEEEARQLLDRAFA 159


>gi|171743211|ref|ZP_02919018.1| hypothetical protein BIFDEN_02339 [Bifidobacterium dentium ATCC
           27678]
 gi|283455808|ref|YP_003360372.1| CarD family transcriptional regulator [Bifidobacterium dentium Bd1]
 gi|306823056|ref|ZP_07456432.1| transcriptional regulator [Bifidobacterium dentium ATCC 27679]
 gi|309801155|ref|ZP_07695284.1| CarD-like protein [Bifidobacterium dentium JCVIHMP022]
 gi|171278825|gb|EDT46486.1| hypothetical protein BIFDEN_02339 [Bifidobacterium dentium ATCC
           27678]
 gi|283102442|gb|ADB09548.1| CarD family transcriptional regulator [Bifidobacterium dentium Bd1]
 gi|304553688|gb|EFM41599.1| transcriptional regulator [Bifidobacterium dentium ATCC 27679]
 gi|308222044|gb|EFO78327.1| CarD-like protein [Bifidobacterium dentium JCVIHMP022]
          Length = 198

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 94/180 (52%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
           G++ G+ +VYP HG   +  I E+ V G+  E+  ++      + + VPV  A  +G+R 
Sbjct: 2   GYKVGDMVVYPRHGAAKVEAITERTVKGVTREYLQLSVLSSDGLVINVPVDNAKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           + +A+ V +  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVDANEVAKVFEILRTPIIEKEMNWSRRYKLNVEKIATGDVNKIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL--SSKSSKTEKSTSENQDKAA 188
            S  E+++   A + +  EI+    + E EA  L++VNL   +     ++  +E   +AA
Sbjct: 122 LSAGEKRMLTKARSILTSEISLSEHLEEGEAQRLLDVNLGYEAPQPGDDQHHTEAPQEAA 181


>gi|256397245|ref|YP_003118809.1| CarD family transcriptional regulator [Catenulispora acidiphila DSM
           44928]
 gi|256363471|gb|ACU76968.1| transcriptional regulator, CarD family [Catenulispora acidiphila
           DSM 44928]
          Length = 160

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 52/158 (32%), Positives = 87/158 (55%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ GE +VYP HG   I +I+ + + G   E+ V+   +  + ++VP  KA  +G+R + 
Sbjct: 3   FKVGETVVYPHHGAALIEDIEIRVIKGEPKEYLVLKVAQGDLTVRVPSEKAEYVGVRDVV 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +ER   ++R     + T WSRR +    KI SGD+I +AEVVRDL R D     S 
Sbjct: 63  DQGGLERVFDVLRAPHTEEPTNWSRRYKANIEKIQSGDVIKVAEVVRDLWRRDRDRGLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E+++   A   +V E+A   + +E +A  +++  L+S
Sbjct: 123 GEKRMLAKARQILVSELALAEATNEDKADAILDEVLAS 160


>gi|302390636|ref|YP_003826457.1| transcriptional regulator, CarD family [Thermosediminibacter oceani
           DSM 16646]
 gi|302201264|gb|ADL08834.1| transcriptional regulator, CarD family [Thermosediminibacter oceani
           DSM 16646]
          Length = 158

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 51/157 (32%), Positives = 88/157 (56%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG G I  I+E+E+ G K +++V+      M + +P+    +IG+R++
Sbjct: 1   MFNIGDKVVYPMHGAGIIEAIEEKEILGEKQKYYVMRMPFGNMRVMIPINSVKEIGVRQI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +++ LK++RG+       W+ R +    KI SG++  +AEVVR+L   + +   S
Sbjct: 61  VSDEEIDQVLKILRGEKSKMPANWNHRYRANMEKIKSGNIFQVAEVVRNLGLREKEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
             ER+++E+A   +V EIA   +I E  A  +IE  L
Sbjct: 121 AGERRMFENAKQILVSEIALSKNIDEKSAHEMIENAL 157


>gi|332981599|ref|YP_004463040.1| CarD family transcriptional regulator [Mahella australiensis 50-1
           BON]
 gi|332699277|gb|AEE96218.1| transcriptional regulator, CarD family [Mahella australiensis 50-1
           BON]
          Length = 162

 Score =  124 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 82/158 (51%), Gaps = 1/158 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+ +VYP HG G +  I+E+E+ G+  +++++      + + +P+  A DIG+R +
Sbjct: 1   MLQIGDKVVYPMHGAGVVEAIEEKEILGVTQKYYILKLPVCDVKIMIPLSSADDIGIRHI 60

Query: 73  SEAHFVERALKLV-RGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +    +R L  + +       T W+RR +    KI SGD+  +A+VVR L   + Q   
Sbjct: 61  IDEDESKRVLAALSQNNQDGDNTNWNRRYRINMDKIKSGDIYEVADVVRSLMIREKQKGL 120

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
           S  ER++  SA   +V E+A  NS    E   LIE  +
Sbjct: 121 SAGERKMLNSAKQILVSELALANSTGTDEIERLIEERI 158


>gi|38234538|ref|NP_940305.1| putative CarD-like transcriptional factor [Corynebacterium
           diphtheriae NCTC 13129]
 gi|38200801|emb|CAE50505.1| Putative CarD-like transcriptional factor [Corynebacterium
           diphtheriae]
          Length = 193

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 48/172 (27%), Positives = 87/172 (50%), Gaps = 4/172 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG   I  I+ +E+ G  LE+ V+  ++  + ++VP   A  +G+R +
Sbjct: 2   EFKVGDTVVYPHHGAAVIEAIEHREMGGETLEYLVLQINQSDLVVRVPSKNAELVGVRDV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +++    +R     +   WSRR +    ++ SGD+  +AEVVRDL R D     S
Sbjct: 62  VDDDGLQKVFGFLRETDVEEAGNWSRRFKANQERLASGDVNKVAEVVRDLWRRDQGKGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQ 184
             E+++   A   +V E+A   +  E +     E  L+   +  E+  +EN+
Sbjct: 122 AGEKRMLAKARQVLVGELALAENKDEKQT----EEILAQVDATIERHRAENK 169


>gi|307719573|ref|YP_003875105.1| transcriptional regulatory protein [Spirochaeta thermophila DSM
           6192]
 gi|306533298|gb|ADN02832.1| transcriptional regulatory protein [Spirochaeta thermophila DSM
           6192]
          Length = 217

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 77/165 (46%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           MT +         F+  +H+VYP  GVG +  I+E+E  G  L ++VI      M + VP
Sbjct: 1   MTSRNTSAQPEPQFKVHDHVVYPLQGVGEVVRIEEREFKGEGLLYYVIYIPVSDMTVMVP 60

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
           V KA +IG+R +        AL  +    +   T W  R Q     +  G ++ IA VVR
Sbjct: 61  VHKAAEIGIRPIVSREEALEALDFISENPQAGPTDWKTRYQMNLDLLKKGSVMDIARVVR 120

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLI 165
            L+      E    ER+L+++AL  +V EI+    IS  E    I
Sbjct: 121 ALYYRSKIKELPILERKLFDNALRILVDEISFALEISAKEVEARI 165


>gi|317152592|ref|YP_004120640.1| transcription factor carD [Desulfovibrio aespoeensis Aspo-2]
 gi|316942843|gb|ADU61894.1| transcription factor CarD [Desulfovibrio aespoeensis Aspo-2]
          Length = 171

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 82/170 (48%), Gaps = 3/170 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+  E +VYP+ GVG +  ++ QE+ G+K +F+++    + + L VPV  A ++G+R +
Sbjct: 1   MFKVNELVVYPSQGVGRVERVESQEIGGVKADFYIVRILSNNVTLMVPVANAKNVGLRSV 60

Query: 73  SEAHFVERALKLVRGK---ARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
                 +   + ++ +          W+RR +EY  K+ SGDL  +A V+++L       
Sbjct: 61  CSLRVGQEIFESLKDRTGFTGYTGQNWNRRYREYSEKLKSGDLSDVAYVLKELFLIGRDK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           E S+ ER+L E A+  +  E+A      +      I    +      E+ 
Sbjct: 121 ELSFGERRLLEQAMGLVSMELAYSVDRPQDAVKADINAMFADILEAQEEK 170


>gi|228993464|ref|ZP_04153374.1| Transcriptional regulator, CarD [Bacillus pseudomycoides DSM 12442]
 gi|228999501|ref|ZP_04159079.1| Transcriptional regulator, CarD [Bacillus mycoides Rock3-17]
 gi|229007057|ref|ZP_04164684.1| Transcriptional regulator, CarD [Bacillus mycoides Rock1-4]
 gi|228754206|gb|EEM03624.1| Transcriptional regulator, CarD [Bacillus mycoides Rock1-4]
 gi|228760212|gb|EEM09180.1| Transcriptional regulator, CarD [Bacillus mycoides Rock3-17]
 gi|228766286|gb|EEM14930.1| Transcriptional regulator, CarD [Bacillus pseudomycoides DSM 12442]
          Length = 164

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 85/157 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+++EV G   ++ VI      M + +P+ K  + G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEDKEVLGKIRQYCVIHMVISDMQVMIPMDKVENSGIRYVV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           + + +   L  +          W +R      K+ +G+L+  AEVVRDL R + +   + 
Sbjct: 67  DKNTLNDVLVDIHNGEADHSLSWKQRYTMNMEKMKNGNLLDGAEVVRDLIRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   ++ E+A V ++SE +A  +++  ++
Sbjct: 127 SEKQMLDNARRILISEVALVQNVSENQATYILQDTIN 163


>gi|28493316|ref|NP_787477.1| transcriptional regulator [Tropheryma whipplei str. Twist]
 gi|28572573|ref|NP_789353.1| transcription regulator CarD [Tropheryma whipplei TW08/27]
 gi|28410705|emb|CAD67091.1| putative CarD-family transcriptional regulator [Tropheryma whipplei
           TW08/27]
 gi|28476357|gb|AAO44446.1| transcriptional regulator [Tropheryma whipplei str. Twist]
          Length = 160

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 45/159 (28%), Positives = 84/159 (52%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG  +I EIK++ + G ++ +  +      + ++VP  K   +G+R +
Sbjct: 2   QFKVGQTVVYPHHGTASILEIKKRVIRGEEVTYLKLHVSDGDLMIEVPAEKIEAVGLRGV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            ++    R ++++R     + T WSRR +    KI SGD+  + EVVRDL R +     S
Sbjct: 62  IDSDGARRVVEVLRENLVDEPTNWSRRYKSNLEKIASGDVTKVTEVVRDLSRREKTRVLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E+++   A   +V E+A     ++ +A  L++  L+ 
Sbjct: 122 AGEKRMLTRARGILVAELALARHTNQEDAEALLDEVLAE 160


>gi|227500782|ref|ZP_03930831.1| transcription factor CarD [Anaerococcus tetradius ATCC 35098]
 gi|227217087|gb|EEI82445.1| transcription factor CarD [Anaerococcus tetradius ATCC 35098]
          Length = 159

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 81/157 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG G I  I+++E  G + ++F++      M + +P  K  D+ +R +
Sbjct: 1   MFKIGDKIVYPMHGAGIIDSIEKKEFLGEEKDYFILKMPIGDMDISIPTNKINDMNIRDV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 +R LK++  +     + W+ R ++    + +GD+  IA++VR+L   D     S
Sbjct: 61  ISKEEGDRVLKILDDEPSDMSSNWTVRYRQNQEILKTGDIFEIAKMVRNLAILDKDKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            +E++L   +   +  E+    S+ + EA  +I+ ++
Sbjct: 121 TTEKKLLNRSRRILASELVMAGSLEKEEAEKMIDESI 157


>gi|114328507|ref|YP_745664.1| carD-like transcriptional regulator [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316681|gb|ABI62741.1| carD-like transcriptional regulator [Granulibacter bethesdensis
           CGDNIH1]
          Length = 216

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 66/170 (38%), Positives = 104/170 (61%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
               +     + F+TG+ +VYP HGVG +  +  Q+VAG K+E   I+F +++M +++P 
Sbjct: 17  ATAAQSSPAAKQFKTGDAVVYPGHGVGRVDHVGMQDVAGHKIEMIQISFAENQMTIRLPA 76

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            K    G+RKLS     E+A+  + G+ R+ + MWS+RAQEY A+INSGDL+A+AE++RD
Sbjct: 77  AKVATTGLRKLSSKADAEKAIAALSGRPRISKVMWSKRAQEYQARINSGDLLALAELLRD 136

Query: 122 LHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
           L R     + S+SERQ++E+AL+R   EIA V    + +    +   L  
Sbjct: 137 LRRNAGSQDGSFSERQIFETALDRFASEIATVRGEDKADTSQQLIALLIK 186


>gi|282883398|ref|ZP_06291990.1| CarD family transcriptional regulator [Peptoniphilus lacrimalis
           315-B]
 gi|300813669|ref|ZP_07093991.1| CarD-like protein [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|281296754|gb|EFA89258.1| CarD family transcriptional regulator [Peptoniphilus lacrimalis
           315-B]
 gi|300512211|gb|EFK39389.1| CarD-like protein [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 160

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 93/158 (58%), Gaps = 1/158 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP HG GTI  I+++E+ G K E++V+    +K+ + +PV KA ++G+RK+
Sbjct: 1   MFKIGDKVVYPMHGAGTIVAIEDREILGKKHEYYVLLLPINKLKVMIPVKKADEVGVRKI 60

Query: 73  SEAHFVERALKLVRGKARV-KRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            E   +E  L+++  + +    T W+RR +    KI SG+LI IA V++ L + DS+   
Sbjct: 61  MEISEMEEVLEILSSEEKFKMPTNWNRRYRFNLDKIKSGNLIEIAGVIKSLEKLDSKKSL 120

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
           S  ER++   A   ++ E+A V      E +++++  +
Sbjct: 121 STGERKILNEARIIIISEMALVFDKDVDEVVSMVDEAI 158


>gi|325478954|gb|EGC82056.1| CarD-like protein [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 159

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 78/157 (49%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG GTI  I+++E  G   ++F++      M + +P  K  D+ +R +
Sbjct: 1   MFKIGDKIVYPMHGAGTIDSIEKKEFLGEVKDYFILKMPIGDMDISIPTSKINDMNIRDV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 ++ LK++          W+ R ++    + +GD+  IA +VR+L   D     S
Sbjct: 61  ITKEEGDKVLKILDEDPSDMSENWTTRYRQNQEILKTGDVYEIARMVRNLAILDKDKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            +E++L   +   +  E+    S+ + EA  +I+ ++
Sbjct: 121 TTEKKLLNRSRRILASELVMAGSLDKEEAEAMIDESI 157


>gi|262277939|ref|ZP_06055732.1| transcriptional regulator, CarD family [alpha proteobacterium
           HIMB114]
 gi|262225042|gb|EEY75501.1| transcriptional regulator, CarD family [alpha proteobacterium
           HIMB114]
          Length = 255

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 67/176 (38%), Positives = 112/176 (63%), Gaps = 3/176 (1%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           ++  ++ ++  ++++YP HG+G I  + +  +AG++   + I   KDK+ L +P  +   
Sbjct: 82  QETEKRTYKVKDYVIYPKHGIGQIISVDKLTIAGIEASVYKIEITKDKLNLTIPTNQQQ- 140

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
             +R LS  + + +AL +++GKA++KRTMWSRRA EY+ KINSGD+  IAEVVRDL++  
Sbjct: 141 -HLRPLSSLNQINKALSILKGKAKIKRTMWSRRAAEYEQKINSGDIYQIAEVVRDLNKNT 199

Query: 127 SQP-EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTS 181
             P ++SYSERQL+E A +R++ E++ V  ISE E    +   L  K  +T  + +
Sbjct: 200 DMPVDQSYSERQLFEKAYDRLLGEVSIVLKISEEEGKARLNKALGKKVEETSNTPA 255


>gi|46579983|ref|YP_010791.1| CarD family transcriptional regulator [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602605|ref|YP_967005.1| CarD family transcriptional regulator [Desulfovibrio vulgaris DP4]
 gi|46449399|gb|AAS96050.1| transcriptional regulator, CarD family [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562834|gb|ABM28578.1| transcriptional regulator, CarD family [Desulfovibrio vulgaris DP4]
 gi|311234019|gb|ADP86873.1| transcriptional regulator, CarD family [Desulfovibrio vulgaris
           RCH1]
          Length = 171

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 51/168 (30%), Positives = 82/168 (48%), Gaps = 3/168 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F   E +VYPA GVG +  I+ QEV G+  EF+++    + + L VPV  A ++G+R L
Sbjct: 1   MFSPDELVVYPAQGVGKVERIERQEVGGVTAEFYIVRILTNNVTLMVPVKNAANVGLRPL 60

Query: 73  SEAHFVERALKLVRGK---ARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
                    +  +  +          W+RR +EY  K+ S DL  +A V+R+L       
Sbjct: 61  CSTERANEIMLSLEDRSGFTGYTGQNWNRRYREYSEKLKSPDLGDVAYVLRELLLIGKDK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTE 177
           E S+ ER+L E A++ +V E++ V  +++ E    IE          E
Sbjct: 121 ELSFGERRLLEQAMSLLVVELSHVQGLTQEEVRANIEALFQDVLQPRE 168


>gi|289178764|gb|ADC86010.1| CarD-like transcriptional regulator [Bifidobacterium animalis
           subsp. lactis BB-12]
          Length = 223

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 90/180 (50%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM-CLKVPVGKAIDIGMRK 71
           G++ G+ +VYP HG   + EI ++ V G+  E+  ++        + VPV     +G+R 
Sbjct: 27  GYKVGDMVVYPRHGAARVEEILQRTVKGVTREYLKLSVLSSDDLEIFVPVDNLKKVGVRD 86

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           + +   V R  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 87  IVDGDEVSRVFEILRTPIVEKEMNWSRRYKLNVEKIATGDVNNIAEVVRDLSQRDVDEHG 146

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKT--EKSTSENQDKAA 188
            S  E+++   A + +  EIA    +SE E   L++VNL     +    +  +E  ++ A
Sbjct: 147 LSAGEKRMLTKARSILTSEIALSEELSEEETQRLLDVNLGYAEPQEGDAEHHTEVPEEPA 206


>gi|284043149|ref|YP_003393489.1| transcriptional regulator, CarD family [Conexibacter woesei DSM
           14684]
 gi|283947370|gb|ADB50114.1| transcriptional regulator, CarD family [Conexibacter woesei DSM
           14684]
          Length = 171

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 41/161 (25%), Positives = 84/161 (52%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+++VYP HG G + + +++E+ G   E+  I    + M + VP   A   G+R++
Sbjct: 2   EFEIGDNVVYPHHGAGKVLKKEDKEILGETREYLTIKILHNDMTVMVPTANAAVAGLRRV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   V++ L +++ +       W+RR +    KI +GD+  +AEVVR+L   +++   S
Sbjct: 62  IDEETVKKVLAVLQDECSDMPKNWNRRFKHNRDKIKTGDIYELAEVVRNLAIREAEKGLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
             E+Q++  A   +  E+     + E +A   ++  L++ +
Sbjct: 122 TGEKQMFTRAKKILASELMYALEMEEEQAEEHLDELLAASA 162


>gi|77917722|ref|YP_355537.1| putative transcriptional regulator [Pelobacter carbinolicus DSM
           2380]
 gi|77543805|gb|ABA87367.1| transcriptional regulator, CarD family [Pelobacter carbinolicus DSM
           2380]
          Length = 161

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/157 (33%), Positives = 86/157 (54%), Gaps = 2/157 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+  VYPA GVG I  I+ +E  G K++F+V+      M + +PV     +GMR L
Sbjct: 1   MFKIGDMAVYPAQGVGVIEAIESKEFVGQKMDFYVLRIVDSDMTIMIPVNNVDSVGMRSL 60

Query: 73  SEAHFVERALKLVRGKARVKRT--MWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
            +   V     +++ K + +     WSRR ++Y+ KI SGD+  +AEV+R+L+      E
Sbjct: 61  IDKDRVRTVYDILKDKTQNQGNLASWSRRQRDYNEKIRSGDVFEVAEVLRELYMIREDKE 120

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEV 167
            SY E+++ E A   +V+EIA  +   E +  + +E 
Sbjct: 121 LSYGEKKVLELARKLVVKEIALADGKDEQQVTDRVES 157


>gi|302390930|ref|YP_003826750.1| CarD family transcriptional regulator [Acetohalobium arabaticum DSM
           5501]
 gi|302203007|gb|ADL11685.1| transcriptional regulator, CarD family [Acetohalobium arabaticum
           DSM 5501]
          Length = 169

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 44/141 (31%), Positives = 81/141 (57%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F TG+ IVYP HG GTIT+I+++EV G   +++V+     +M + +P+    DIG+R++
Sbjct: 1   MFETGDKIVYPNHGAGTITDIEKKEVLGETKKYYVMQLPIGEMRVMIPMDNVDDIGIREV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
             +  V+   ++++G+       W+RR +    KI SGD+  +AEVVR+L   D +   S
Sbjct: 61  ISSDRVDDVFQILKGEKSEMSQNWNRRYRANTEKIKSGDIFEVAEVVRNLTLRDIEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAV 153
             E+++  ++   ++ E+   
Sbjct: 121 TGEKKMLSNSRQILISELVLA 141


>gi|229158326|ref|ZP_04286393.1| Transcriptional regulator, CarD [Bacillus cereus ATCC 4342]
 gi|228625284|gb|EEK82044.1| Transcriptional regulator, CarD [Bacillus cereus ATCC 4342]
          Length = 164

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP +G G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMNGAGVIEAIEEKEILGTTRQYCVIRIISKDMQVMLPMDQLQKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DKGTLDDILLEFQNGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V ++SE +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVSEHQATEYLQDTMN 163


>gi|94264420|ref|ZP_01288210.1| Transcription factor CarD [delta proteobacterium MLMS-1]
 gi|93455177|gb|EAT05395.1| Transcription factor CarD [delta proteobacterium MLMS-1]
          Length = 166

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 47/165 (28%), Positives = 85/165 (51%), Gaps = 1/165 (0%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
           D     F+ G+  VYPAHGVG I  I+ ++V  ++  F+VI   +  M + +P     ++
Sbjct: 2   DVALDTFQVGDMAVYPAHGVGRIESIESRQVGELEQSFYVIRIVESNMTVMIPTKSCNNV 61

Query: 68  GMRKLSEAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           G+R +     V++   ++  +   +    W++R +EY  +I +G +  IA V+RDL    
Sbjct: 62  GLRNIICPGDVKQVFAILGERGLEMVSQPWNQRYREYTNRIKTGSVFEIAAVLRDLLLLR 121

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
           +  E S+ ER++ E+A   +++EIA      E +    I+   SS
Sbjct: 122 ADKELSFGERKMVETARGLLIKEIALATDNDEEQVAQRIDRIFSS 166


>gi|320354570|ref|YP_004195909.1| CarD family transcriptional regulator [Desulfobulbus propionicus
           DSM 2032]
 gi|320123072|gb|ADW18618.1| transcriptional regulator, CarD family [Desulfobulbus propionicus
           DSM 2032]
          Length = 159

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 46/156 (29%), Positives = 83/156 (53%), Gaps = 1/156 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+  VYPAHGVG I  IK Q + G+   F+V+    + M + +P   + ++G+R +
Sbjct: 1   MFSKGDMAVYPAHGVGLIEAIKTQSIGGIDQSFYVMKILDNDMTIMIPTATSANVGLRAI 60

Query: 73  SEAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                V + + +++ +  ++    W+RR +EY  KI +G +  +A V+RDL       + 
Sbjct: 61  ISGEDVPKVIDILKERDIKITAQTWNRRYREYMEKIKTGSVFEVAVVLRDLFLLKEDKDL 120

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEV 167
           SY ER++ ++A N +V+E++    + E      IE 
Sbjct: 121 SYGERKMLDTAKNLLVKELSLAKQMEEGMIEQQIEK 156


>gi|324328612|gb|ADY23872.1| transcriptional regulator, CarD family protein [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 159

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 44/158 (27%), Positives = 82/158 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP +G G I  I+E+E+ G   ++ VI      M + +P+ +    G+R +
Sbjct: 1   MFQIGDKIVYPMNGAGVIEAIEEKEILGTTRQYCVIRIISKDMQVMLPMDQLQKSGIRYI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   +
Sbjct: 61  VDKGTLDDILLEFQNGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            SE+Q+ ++A   M+ E+A V ++SE +A   ++  ++
Sbjct: 121 ASEKQMLDNARKMMISEVALVQNVSEHQATEYLQDTIN 158


>gi|330994677|ref|ZP_08318600.1| hypothetical protein SXCC_04565 [Gluconacetobacter sp. SXCC-1]
 gi|329758318|gb|EGG74839.1| hypothetical protein SXCC_04565 [Gluconacetobacter sp. SXCC-1]
          Length = 196

 Score =  121 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 68/170 (40%), Positives = 99/170 (58%)

Query: 3   FQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
              K       FR G+ IVY AHGVG +  I   E+AG KLE   I+F  ++M L++P+ 
Sbjct: 27  KSSKAVKDEDPFREGDAIVYAAHGVGRVDRIGVDEIAGTKLEMIQISFPGNQMTLRIPLS 86

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
           KA   G+RK+     V++A+ +++GK  V R MW+RRA  Y  KINSGDL+ IAEV+RDL
Sbjct: 87  KARKSGLRKIVSREIVDKAMAIIKGKPHVSRGMWARRAVAYQEKINSGDLVQIAEVLRDL 146

Query: 123 HRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            R     + S+SER+L+E+A  R V E+A +      E +  +   + + 
Sbjct: 147 RRNVDSLDGSFSERKLFEAAQERFVAEVAVLEGKDPTEVLEKLTEVMKAA 196


>gi|47565141|ref|ZP_00236184.1| CarD-like transcriptional regulator [Bacillus cereus G9241]
 gi|47557927|gb|EAL16252.1| CarD-like transcriptional regulator [Bacillus cereus G9241]
          Length = 162

 Score =  121 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP +G G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 5   FQIGDKIVYPMNGAGVIEAIEEKEILGTTRQYCVIRIISKDMQVMLPMDQLQKSGIRYIV 64

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 65  DKGTLDDILLEFQNGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 124

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V ++SE +A   ++  ++
Sbjct: 125 SEKQMLDNARKMMISEVALVQNVSEHQATEYLQDTIN 161


>gi|301056223|ref|YP_003794434.1| CarD-like transcriptional regulator [Bacillus anthracis CI]
 gi|300378392|gb|ADK07296.1| CarD-like transcriptional regulator [Bacillus cereus biovar
           anthracis str. CI]
          Length = 159

 Score =  121 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 44/158 (27%), Positives = 82/158 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP +G G I  I+E+E+ G   ++ VI      M + +P+ +    G+R +
Sbjct: 1   MFQIGDKIVYPMNGAGVIEAIEEKEILGTIRQYCVIRIISKDMQVMLPMDQLQKSGIRYI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   +
Sbjct: 61  VDKGTLDDILLEFQNGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            SE+Q+ ++A   M+ E+A V ++SE +A   ++  ++
Sbjct: 121 ASEKQMLDNARKMMISEVALVQNVSEHQATEYLQDTMN 158


>gi|257065690|ref|YP_003151946.1| transcriptional regulator, CarD family [Anaerococcus prevotii DSM
           20548]
 gi|256797570|gb|ACV28225.1| transcriptional regulator, CarD family [Anaerococcus prevotii DSM
           20548]
          Length = 159

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 79/157 (50%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG GTI  I+++E  G   ++F++      M + +P  K  ++ +R +
Sbjct: 1   MFKIGDKIVYPMHGAGTIDSIEKKEFLGEVKDYFILKMPIGDMDISIPTSKINEMNIRDV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 +  LK++          W+ R ++    + +GD+  IA++VR+L   D+    S
Sbjct: 61  ITKEEGDEVLKILDDDPSDMSNNWTVRYRQNQEILKTGDIFEIAKMVRNLAILDNDKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            +E++L   +   +  E+    S+ + EA  +I+ ++
Sbjct: 121 TTEKKLLNRSRRILASELVMAGSLKKEEAEAMIDESI 157


>gi|304321707|ref|YP_003855350.1| transcriptional regulator [Parvularcula bermudensis HTCC2503]
 gi|303300609|gb|ADM10208.1| transcriptional regulator [Parvularcula bermudensis HTCC2503]
          Length = 308

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 91/169 (53%), Positives = 119/169 (70%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
             Q F+    I+YPAHGVG I ++++Q +   ++E FVI F+ +KM L+VPV KA   GM
Sbjct: 140 KNQKFKVNTQIIYPAHGVGNIVDLEKQTIGDFEVELFVIDFEHEKMKLRVPVAKAAASGM 199

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           R LS    ++ AL+L+ G+ARVKRTMWSRRAQEY+AKINSGDL+++AEVVRDL R D QP
Sbjct: 200 RNLSTTEQIDDALELLEGRARVKRTMWSRRAQEYEAKINSGDLVSVAEVVRDLFRADDQP 259

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEK 178
           E+SYSERQL+E A  R  RE+AAV   S  +AI+ I ++L  K     K
Sbjct: 260 EQSYSERQLFEQARERFGREVAAVRKKSLEKAIDEIHIHLDRKEKVEAK 308


>gi|332970720|gb|EGK09700.1| CarD family transcriptional regulator [Desmospora sp. 8437]
          Length = 168

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 44/168 (26%), Positives = 86/168 (51%), Gaps = 1/168 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG G I  I+E+E+ G    ++V+      M + +P+ K   IG+R++
Sbjct: 1   MFNIGDKVVYPMHGAGIIEAIEEKEILGESQRYYVMRMPVGDMKVMIPMSKVDSIGLREV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +   ++ +   +    + W+RR +    K+ SGD+  +A+VVR L   D +   S
Sbjct: 61  VDEKTISEVIERLANGSAEVSSNWNRRYRANLDKMKSGDIHDLADVVRCLMLRDKEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEV-NLSSKSSKTEKS 179
             ER++ ++A   ++ E+     + E +A  L++   LS    + E++
Sbjct: 121 TGERKMLDNARQILISELVLAKEMEESQAFGLLDEIILSESKPRVERA 168


>gi|229175432|ref|ZP_04302945.1| Transcriptional regulator, CarD [Bacillus cereus MM3]
 gi|228608040|gb|EEK65349.1| Transcriptional regulator, CarD [Bacillus cereus MM3]
          Length = 164

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP +G G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMNGAGVIEAIEEKEILGTTRQYCVIRIISKDMQIMLPMDQLQKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DKGTLDGILLEFQNGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V ++SE +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVSEHQATEFLQDTIN 163


>gi|212696984|ref|ZP_03305112.1| hypothetical protein ANHYDRO_01547 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212676072|gb|EEB35679.1| hypothetical protein ANHYDRO_01547 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 159

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 41/157 (26%), Positives = 75/157 (47%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG G I  ++ +E  G + E+F++      M + +P      + +R +
Sbjct: 1   MFKIGDKIVYPMHGAGIIDSVETKEFLGEEKEYFILKMPIGNMDISIPKSNINKMNIRDV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 E+ L ++  K       W+ R +E    + +GD+  IA +VRDL   D     S
Sbjct: 61  ISKEEGEKILAILDEKPEDLNGNWNLRYRENQEILKTGDIFKIANMVRDLVALDDDKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            +E++L   A   M  E+    S+ + +A  +I+ ++
Sbjct: 121 TTEKKLLNRARRIMASELVMSGSLEKDQAEKMIDESI 157


>gi|42783903|ref|NP_981150.1| CarD family transcriptional regulator [Bacillus cereus ATCC 10987]
 gi|206977288|ref|ZP_03238185.1| transcriptional regulator, CarD family [Bacillus cereus H3081.97]
 gi|217962204|ref|YP_002340774.1| transcriptional regulator, CarD family [Bacillus cereus AH187]
 gi|228987970|ref|ZP_04148076.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229141451|ref|ZP_04269988.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST26]
 gi|42739833|gb|AAS43758.1| transcriptional regulator, CarD family [Bacillus cereus ATCC 10987]
 gi|206744439|gb|EDZ55849.1| transcriptional regulator, CarD family [Bacillus cereus H3081.97]
 gi|217066173|gb|ACJ80423.1| transcriptional regulator, CarD family [Bacillus cereus AH187]
 gi|228642014|gb|EEK98308.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST26]
 gi|228771774|gb|EEM20234.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 164

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP +G G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMNGAGVIEAIEEKEILGTTRQYCVIRIISKDMQVMLPMDQLQKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DKGTLDDILLEFQNGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V ++SE +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVSEHQATEYLQDTIN 163


>gi|49481535|ref|YP_038761.1| CarD family transcriptional regulator [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|118479850|ref|YP_897001.1| CarD family transcriptional regulator [Bacillus thuringiensis str.
           Al Hakam]
 gi|196032819|ref|ZP_03100232.1| transcriptional regulator, CarD family [Bacillus cereus W]
 gi|196040853|ref|ZP_03108151.1| transcriptional regulator, CarD family [Bacillus cereus NVH0597-99]
 gi|196043838|ref|ZP_03111075.1| transcriptional regulator, CarD family [Bacillus cereus 03BB108]
 gi|218905945|ref|YP_002453779.1| transcriptional regulator, CarD family [Bacillus cereus AH820]
 gi|225866704|ref|YP_002752082.1| transcriptional regulator, CarD family [Bacillus cereus 03BB102]
 gi|228929769|ref|ZP_04092786.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228936026|ref|ZP_04098836.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228948465|ref|ZP_04110747.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229093818|ref|ZP_04224917.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-42]
 gi|229124284|ref|ZP_04253475.1| Transcriptional regulator, CarD [Bacillus cereus 95/8201]
 gi|229186972|ref|ZP_04314126.1| Transcriptional regulator, CarD [Bacillus cereus BGSC 6E1]
 gi|49333091|gb|AAT63737.1| transcriptional regulator, CarD family [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|118419075|gb|ABK87494.1| transcriptional regulator, CarD family [Bacillus thuringiensis str.
           Al Hakam]
 gi|195994248|gb|EDX58203.1| transcriptional regulator, CarD family [Bacillus cereus W]
 gi|196025174|gb|EDX63844.1| transcriptional regulator, CarD family [Bacillus cereus 03BB108]
 gi|196028307|gb|EDX66916.1| transcriptional regulator, CarD family [Bacillus cereus NVH0597-99]
 gi|218538565|gb|ACK90963.1| transcriptional regulator, CarD family [Bacillus cereus AH820]
 gi|225788519|gb|ACO28736.1| transcriptional regulator, CarD family [Bacillus cereus 03BB102]
 gi|228596526|gb|EEK54192.1| Transcriptional regulator, CarD [Bacillus cereus BGSC 6E1]
 gi|228659185|gb|EEL14834.1| Transcriptional regulator, CarD [Bacillus cereus 95/8201]
 gi|228689703|gb|EEL43511.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-42]
 gi|228811224|gb|EEM57563.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228823794|gb|EEM69616.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228829948|gb|EEM75568.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 164

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP +G G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMNGAGVIEAIEEKEILGTIRQYCVIRIISKDMQVMLPMDQLQKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DKGTLDDILLEFQNGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V ++SE +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVSEHQATEYLQDTMN 163


>gi|297587316|ref|ZP_06945961.1| CarD family transcriptional regulator [Finegoldia magna ATCC 53516]
 gi|297575297|gb|EFH94016.1| CarD family transcriptional regulator [Finegoldia magna ATCC 53516]
          Length = 160

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/158 (25%), Positives = 86/158 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG G ITE++ +EV G+K +++++     +M + +PV K  D+G+R +
Sbjct: 1   MFKIGDKIVYPMHGAGIITEVQNKEVLGVKKDYYILQMPMGEMKISIPVDKINDMGIRFV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   +     +++       + W++R +E   K+ +GD+   A V + L+  D     S
Sbjct: 61  AQEEIIHSLRDILKNSEVDFPSNWNKRYKENLEKLRTGDIKETAIVYKGLYELDCSKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             E+++  ++   ++ EIA+  +I   +A +++   + 
Sbjct: 121 MIEKKVLNTSRKMLISEIASGLNIKPSKAESMVNELID 158


>gi|157692393|ref|YP_001486855.1| transcription factor CarD [Bacillus pumilus SAFR-032]
 gi|157681151|gb|ABV62295.1| possible transcription factor CarD [Bacillus pumilus SAFR-032]
          Length = 158

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 43/157 (27%), Positives = 82/157 (52%), Gaps = 2/157 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG G I  ++E+E+ G   E+F+I      M + +P G+   +G+R +
Sbjct: 1   MFQIGDKIVYPMHGAGVIEGMEEKEILGKTEEYFLIQMP--NMQMMIPRGRINQLGIRPV 58

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  +     +       W +R  E   K+ +G +   A+VV+DL R + +   +
Sbjct: 59  ADQATLKVVMNNFAEETNDDTLTWKQRYDENLKKLKTGAIEDGADVVKDLMRRNQKKALN 118

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            SE+++ E A   +V EI+    +S+ E ++ +E  L
Sbjct: 119 SSEKKMLEDARGMLVSEISLAQGLSQDEVLSALENEL 155


>gi|325845929|ref|ZP_08169127.1| CarD-like protein [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325481835|gb|EGC84867.1| CarD-like protein [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 159

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 41/157 (26%), Positives = 75/157 (47%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG G I  ++ +E  G + E+F++      M + +P      + +R +
Sbjct: 1   MFKIGDKIVYPMHGAGVIDSVETKEFLGEEKEYFILKMPIGNMDISIPKSNINKMNIRDV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 E+ L ++  K       W+ R +E    + +GD+  IA +VRDL   D     S
Sbjct: 61  ISKEEGEKILAILDEKPEDLNGNWNLRYRENQEILKTGDIFKIANMVRDLVALDDDKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            +E++L   A   M  E+    S+ + +A  +I+ ++
Sbjct: 121 TTEKKLLNRARRIMASELVMSGSLEKDQAEKMIDESI 157


>gi|258404969|ref|YP_003197711.1| transcriptional regulator, CarD family [Desulfohalobium retbaense
           DSM 5692]
 gi|257797196|gb|ACV68133.1| transcriptional regulator, CarD family [Desulfohalobium retbaense
           DSM 5692]
          Length = 174

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 83/173 (47%), Gaps = 3/173 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F   + +VYPA GVG +  I+ QE+ G + +F+++    + + L VPV  A ++G+R +
Sbjct: 1   MFSEKQLVVYPAQGVGEVERIESQEIGGTRADFYIVRILSNNVTLMVPVANAENVGLRSV 60

Query: 73  SEAHFVERALKLVRGKARVK---RTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
             A      L+ ++ ++         W+RR +EY  K+ SG+L  ++ V+++L       
Sbjct: 61  CGADEGRLVLEGLKDRSDFMGYSGQNWNRRYREYSEKLKSGELDDVSYVLKELILIGRDK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSE 182
           E S+ ER+L E A+  +  EIA      +      IE   +    +      +
Sbjct: 121 ELSFGERRLLEQAMTLITMEIAYALGTQQDAVRKEIEEIFADILKRPGADEED 173


>gi|302342168|ref|YP_003806697.1| CarD family transcriptional regulator [Desulfarculus baarsii DSM
           2075]
 gi|301638781|gb|ADK84103.1| transcriptional regulator, CarD family [Desulfarculus baarsii DSM
           2075]
          Length = 161

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 86/158 (54%), Gaps = 1/158 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+  VYPAHGVG I  ++E+ + G +  F+++   ++ M + VP   A  +G+R +
Sbjct: 1   MFDLGQLAVYPAHGVGRIEAVEEKTIGGAQQCFYILRILENDMIIMVPTANAGAVGLRPI 60

Query: 73  SEAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                V + L ++R     ++   W+RR ++Y +KI +G +  +AEV+RDL    S  E 
Sbjct: 61  IPTEEVPQVLSILRDHDVIIENQTWNRRYRDYMSKIKTGSVYEVAEVLRDLFILKSDKEL 120

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
           S+ ER++ ++A N +V+E++     +E      +E   
Sbjct: 121 SFGERKMLDTARNLLVKELSIAQQQTEDVVAAQVEGIF 158


>gi|52140791|ref|YP_086042.1| CarD family transcriptional regulator [Bacillus cereus E33L]
 gi|222098186|ref|YP_002532243.1| transcriptional regulator, card family [Bacillus cereus Q1]
 gi|228917367|ref|ZP_04080920.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229032373|ref|ZP_04188344.1| Transcriptional regulator, CarD [Bacillus cereus AH1271]
 gi|229198880|ref|ZP_04325571.1| Transcriptional regulator, CarD [Bacillus cereus m1293]
 gi|51974260|gb|AAU15810.1| transcriptional regulator, CarD family [Bacillus cereus E33L]
 gi|221242244|gb|ACM14954.1| transcriptional regulator, CarD family [Bacillus cereus Q1]
 gi|228584583|gb|EEK42710.1| Transcriptional regulator, CarD [Bacillus cereus m1293]
 gi|228728936|gb|EEL79941.1| Transcriptional regulator, CarD [Bacillus cereus AH1271]
 gi|228842294|gb|EEM87389.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 164

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP +G G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMNGAGVIEAIEEKEILGTIRQYCVIRIISKDMQVMLPMDQLQKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DKGTLDDILLEFQNGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V ++SE +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVSEHQATEYLQDTIN 163


>gi|291456490|ref|ZP_06595880.1| transcriptional regulator, CarD family [Bifidobacterium breve DSM
           20213]
 gi|291381767|gb|EFE89285.1| transcriptional regulator, CarD family [Bifidobacterium breve DSM
           20213]
          Length = 197

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 83/165 (50%), Gaps = 2/165 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK-MCLKVPVGKAIDIGMRK 71
            ++ G+ +VYP HG   +  I E+ V G+  E+  ++      + + VPV  A  +G+R 
Sbjct: 2   SYQVGDMVVYPRHGAAKVEAITERTVKGVTREYLQLSVLSSDGLVINVPVENAKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           +     V +  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVSGSEVAKVFEILRTPIIEKEMNWSRRYKLNVEKIATGDVNKIAEVVRDLAQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSK 175
            S  E+++   A   +  EIA    I E EA  L++VNL    ++
Sbjct: 122 LSAGEKRMLTKARAILTSEIALSEKIDETEAQRLLDVNLGYAPAQ 166


>gi|218885594|ref|YP_002434915.1| CarD family transcriptional regulator [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756548|gb|ACL07447.1| transcriptional regulator, CarD family [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 171

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 51/171 (29%), Positives = 82/171 (47%), Gaps = 3/171 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F   + +VYPA GVG +  ++ Q V G+  +F+++    + + L VPV  A ++G+R L
Sbjct: 1   MFAQDQLVVYPAQGVGKVERVESQVVGGVATDFYIVRILGNNVTLMVPVRNAANVGLRSL 60

Query: 73  SEAHFVERALKLVRGK---ARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
                    L+ +R +          W+RR +EY  K+ SGDL  +A V+R+L       
Sbjct: 61  CAPELGAEILESLRDRSGFTGYTGQNWNRRYREYSEKLKSGDLADVAYVLRELLLIGRDK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           E S+ ER+L E A+  +  E+A V   ++      IE          EKS 
Sbjct: 121 ELSFGERRLLEQAMGLITLELACVLDRTQDNVRAEIEEMFQDVLQAREKSE 171


>gi|299144435|ref|ZP_07037515.1| transcriptional regulator, CarD family [Peptoniphilus sp. oral
           taxon 386 str. F0131]
 gi|298518920|gb|EFI42659.1| transcriptional regulator, CarD family [Peptoniphilus sp. oral
           taxon 386 str. F0131]
          Length = 161

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/156 (28%), Positives = 83/156 (53%), Gaps = 1/156 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ +VYP HG G I  I+++E+ G   +++++    + M + VPV  A ++G+R++
Sbjct: 1   MFDIGDKVVYPMHGAGVIVAIEDREILGEIRKYYILKMPINDMKVMVPVENADEVGVREI 60

Query: 73  SEAHFVERALKLVR-GKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +   +   L+++   +       W+RR +    +I SG++  IA+VVR L R DS+   
Sbjct: 61  LDEDKMNLVLEVLSCNEITNMPKNWNRRYRFNMDRIKSGNIEEIAKVVRCLERLDSKKSL 120

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEV 167
           S  ER++   A   +V E+  V + S  E   L++ 
Sbjct: 121 STGERKMLNGAKQIIVSEMVLVYNKSVEEITELVDK 156


>gi|115372710|ref|ZP_01460016.1| hmga-type transcription factor [Stigmatella aurantiaca DW4/3-1]
 gi|115370191|gb|EAU69120.1| hmga-type transcription factor [Stigmatella aurantiaca DW4/3-1]
          Length = 361

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 52/174 (29%), Positives = 85/174 (48%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
                  G+ +VYP  GV  I+ I+ +EVAG KL F  +  ++D   + VP  K   IG+
Sbjct: 38  EGLQLSVGDRVVYPNQGVCLISAIEVKEVAGQKLTFVTMRREEDGAVVMVPQAKVQAIGV 97

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           RK++    VE+    +R  +      W +RA+    ++  G ++ +AEVV+ L       
Sbjct: 98  RKVAGPAEVEQIYAFLRSDSDKADLDWKQRARTNLDRMTQGGILGLAEVVKGLQVLSELR 157

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSEN 183
                ER+LY++A + +V E+AA  SI E  A + I++ L     +  K T   
Sbjct: 158 PLPTKERELYDNARHLLVTEVAAALSIPEVNAEDSIDIVLFPPGKERPKRTVAE 211


>gi|258591297|emb|CBE67594.1| CarD-like transcriptional regulator [NC10 bacterium 'Dutch
           sediment']
          Length = 162

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 46/156 (29%), Positives = 81/156 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            +RTG  +VYP HGVG I  I+ +EV G    F+V+    + M + VP   A  +G+R++
Sbjct: 2   MYRTGTKVVYPTHGVGWIEAIENKEVGGGPQAFYVVRIIGNGMTILVPTKNAKRVGLREV 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            EA  + + L +++       + W+RR ++   +I +G L  +A V+R L     +   S
Sbjct: 62  IEASEIPKILAILKKNDLEISSNWNRRFKDNLERIRTGSLFEVALVLRKLVLLQKERSLS 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
           + E+ + E+    +V EI+  + I +  A  L+E  
Sbjct: 122 FGEKTMLENVRRLIVSEISHASGIDQERAKVLVEQA 157


>gi|51246583|ref|YP_066467.1| transcription factor [Desulfotalea psychrophila LSv54]
 gi|50877620|emb|CAG37460.1| related to transcription factor [Desulfotalea psychrophila LSv54]
          Length = 165

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 45/158 (28%), Positives = 79/158 (50%), Gaps = 1/158 (0%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  G+  VYPAHGVG I  ++ Q VAG    F+V+    + M + +P   +  +G+R + 
Sbjct: 8   FVAGDMAVYPAHGVGVIKSVETQTVAGTDQSFYVMEIMGNNMTIMIPTASSEKVGLRAIV 67

Query: 74  EAHFVERALKLVRGKARV-KRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
               V   + ++  +        W+RR ++Y  KI +G +  +A V+RDL       + S
Sbjct: 68  SEEQVSEVVTILEDRDVELGSQTWNRRYRDYMEKIKTGSVHEVAAVLRDLFLLSVDKDLS 127

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           Y ER++ ++A   +V+E++    I E    + I+   S
Sbjct: 128 YGERKMLDTAKGLLVKELSLAKKIEEVAMSDQIDAIFS 165


>gi|295394468|ref|ZP_06804691.1| CarD family transcriptional regulator [Brevibacterium mcbrellneri
           ATCC 49030]
 gi|294972647|gb|EFG48499.1| CarD family transcriptional regulator [Brevibacterium mcbrellneri
           ATCC 49030]
          Length = 175

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 73/144 (50%)

Query: 5   QKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKA 64
           ++R   +  F+ G+ +VYP HG  TI EIK + + G    +  +      + ++VP    
Sbjct: 9   RERGKNKMSFQVGDTVVYPHHGAATIQEIKTRTIKGEDKLYLKLQVSHGDLTIEVPAENC 68

Query: 65  IDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHR 124
             +G+R +     +E+  +++R +   + T WSRR +    K  SGD+I +AEVVRDL R
Sbjct: 69  DLVGVRDVVGEEGLEKVFQVLRAEVTEEPTNWSRRYKANLEKFQSGDVIKVAEVVRDLWR 128

Query: 125 TDSQPEKSYSERQLYESALNRMVR 148
            +     S  E+++   A   +V 
Sbjct: 129 REQDRGLSTGEKRMLAKARQVLVS 152


>gi|328950177|ref|YP_004367512.1| transcriptional regulator, CarD family [Marinithermus
           hydrothermalis DSM 14884]
 gi|328450501|gb|AEB11402.1| transcriptional regulator, CarD family [Marinithermus
           hydrothermalis DSM 14884]
          Length = 163

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 80/164 (48%), Gaps = 1/164 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYPA G G I E+ E+EV G + +++V+    D   + VPVG   + G+R  
Sbjct: 1   MFQVGDAVVYPAQGAGRIVEVVEREVMGSRKQYYVVQLLSDAARIMVPVGAVREAGLRPP 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
             A  +ER  + +        ++W  R +E    + SGD   +A +V  L+R D     +
Sbjct: 61  LAAAELERLWQALAE-DLPLPSVWMPRYREEQRLLASGDPFKLAALVGTLYRRDQAKPLA 119

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKT 176
            SER+LYE AL  +  E+A   S +   A   +   L + +   
Sbjct: 120 SSERRLYEDALTALASEVALSLSETLEAAKARVMGMLEALTPSP 163


>gi|325474975|gb|EGC78161.1| transcriptional regulator [Treponema denticola F0402]
          Length = 209

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 51/170 (30%), Positives = 81/170 (47%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           + +  F   E +VYP  GVGTIT+I ++E+AG  ++++VI      M + VP+    ++G
Sbjct: 2   SKKFVFSAKEVVVYPGQGVGTITDITKKEIAGEVIDYYVIYLSDSDMTVLVPITGIDNLG 61

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           +R++      E ALK +          W  R Q       SG ++    VVR L++    
Sbjct: 62  IRRIVTKAEAEAALKFLSEDFEPIPIDWKARYQMNMDLFKSGKILDTGSVVRSLYQRSKT 121

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEK 178
            E    ER+LY+SA      EIAA   +++ E    I ++L       EK
Sbjct: 122 KELPIQERKLYDSAYRIFQDEIAAALKMTKTEVEAAIHLHLEPLGGPIEK 171


>gi|42527792|ref|NP_972890.1| transcriptional regulator, putative [Treponema denticola ATCC
           35405]
 gi|41818620|gb|AAS12809.1| transcriptional regulator, putative [Treponema denticola ATCC
           35405]
          Length = 208

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 51/170 (30%), Positives = 81/170 (47%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           + +  F   E +VYP  GVGTIT+I ++E+AG  ++++VI      M + VP+    ++G
Sbjct: 2   SKKFVFSAKEVVVYPGQGVGTITDITKKEIAGEVIDYYVIYLSDSDMTVLVPITGIDNLG 61

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           +R++      E ALK +          W  R Q       SG ++    VVR L++    
Sbjct: 62  IRRIVTKAEAEAALKFLSEDFEPIPIDWKARYQMNMDLFKSGKILDTGSVVRSLYQRSKT 121

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEK 178
            E    ER+LY+SA      EIAA   +++ E    I ++L       EK
Sbjct: 122 KELPIQERKLYDSAYRIFQDEIAAALKMTKTEVEAAIHLHLEPLGGPIEK 171


>gi|262197699|ref|YP_003268908.1| CarD family transcriptional regulator [Haliangium ochraceum DSM
           14365]
 gi|262081046|gb|ACY17015.1| transcriptional regulator, CarD family [Haliangium ochraceum DSM
           14365]
          Length = 162

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 47/160 (29%), Positives = 81/160 (50%), Gaps = 1/160 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+  VYPA GV  +  I+ +E+      F+V+     +M + VP  KA  +G+R +
Sbjct: 3   EFSIGDKAVYPAQGVAEVVGIENKEINSTICSFYVLKVLDTEMQILVPKDKADQVGLRPV 62

Query: 73  SEAHFVERALKLVRGKARVKR-TMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
           +    VE    ++R +        W+RR + +  KI +G L  +AEV RDL+R  S    
Sbjct: 63  ASDEEVEEVFDILREQDIHIDKQTWNRRYRGFMEKIKTGSLFEVAEVFRDLYRLKSTKTL 122

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
           S+ ER++ ++A N +V+E+A   +  E      +E   ++
Sbjct: 123 SFGERRMLDTAKNLIVKELAVARNWDEQRVEKELEKAFAA 162


>gi|283853058|ref|ZP_06370314.1| transcriptional regulator, CarD family [Desulfovibrio sp. FW1012B]
 gi|283571525|gb|EFC19529.1| transcriptional regulator, CarD family [Desulfovibrio sp. FW1012B]
          Length = 170

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 48/170 (28%), Positives = 85/170 (50%), Gaps = 4/170 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F   + +VYPA GVG +  I+ Q + G   +FF++    + + L VPV  A ++G+R L
Sbjct: 1   MFSEEQLVVYPAQGVGRVERIETQVIGGASADFFIVRILSNNVTLMVPVKNAANVGLRPL 60

Query: 73  SEAHFVERALKLVRGKAR---VKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
             A   +  ++ ++ ++         W+RR +EY  K+ SGDL  +A V+++L       
Sbjct: 61  CTAEEGQAIIETLKDRSDFTGYTGQNWNRRYREYSEKLKSGDLGDVAYVLKELLLIGQNK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK-SSKTEK 178
           E S+ ER+L E A + +  E+A      + E  ++I    +     K E+
Sbjct: 121 ELSFGERRLLEQATSLLTLELALAMDKEQQEIKDIINEIFADVLQPKPEE 170


>gi|310826140|ref|YP_003958497.1| transcriptional regulator [Eubacterium limosum KIST612]
 gi|308737874|gb|ADO35534.1| transcriptional regulator [Eubacterium limosum KIST612]
          Length = 157

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 43/157 (27%), Positives = 86/157 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            +  G+ IVYP HG G + +I+E+E+      ++++    + M + +PV KA ++G+R +
Sbjct: 1   MYEIGDKIVYPMHGAGVVKDIEEKEIFDTTQMYYLMEIVSEGMEILIPVDKADEVGVRDI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
             +  +E+ L  +   +      WS+R Q+    + SGD+  +A+VV++L   D +   S
Sbjct: 61  VTSDVIEKMLDSLEEPSDQMNGNWSKRYQDNMDILKSGDIFDVAKVVKNLTLLDRKKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
             E+++  SA N ++ E+  V   S+ E++ +IE  +
Sbjct: 121 TGEKKMLTSARNFLISEMVLVQGRSKEESLQVIEEKI 157


>gi|313887993|ref|ZP_07821671.1| CarD-like protein [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845948|gb|EFR33331.1| CarD-like protein [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 160

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 52/158 (32%), Positives = 84/158 (53%), Gaps = 1/158 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ IVYP HG G I  I+E+E+ G   +++++    + + + VPV  A +IG+R +
Sbjct: 1   MFNIGDKIVYPMHGAGEIVAIEEREILGDVHKYYIMRLPINDLKVMVPVKNAKEIGVRDI 60

Query: 73  SEAHFVERALKLV-RGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
           S+A  +E+ LK +   +       W+RR +    KI SGDL+ IA+VVR L   D +   
Sbjct: 61  SDADTMEKVLKALSSEEEVSMPKNWNRRYRYNLDKIKSGDLMEIADVVRSLESLDREKSL 120

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
           S  ER++   A   +V E+  V   +  E   LI+  +
Sbjct: 121 STGERKILNEAKQIIVSEMVLVFEKNVEEVTKLIDDAI 158


>gi|183601479|ref|ZP_02962849.1| possible transcriptional regulator [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|219683979|ref|YP_002470362.1| transcriptional regulator [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|241191021|ref|YP_002968415.1| transcriptional regulator [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|241196427|ref|YP_002969982.1| transcriptional regulator [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|183219085|gb|EDT89726.1| possible transcriptional regulator [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|219621629|gb|ACL29786.1| possible transcriptional regulator [Bifidobacterium animalis subsp.
           lactis AD011]
 gi|240249413|gb|ACS46353.1| transcriptional regulator [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|240250981|gb|ACS47920.1| transcriptional regulator [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|295794010|gb|ADG33545.1| transcriptional regulator [Bifidobacterium animalis subsp. lactis
           V9]
          Length = 198

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 90/180 (50%), Gaps = 4/180 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM-CLKVPVGKAIDIGMRK 71
           G++ G+ +VYP HG   + EI ++ V G+  E+  ++        + VPV     +G+R 
Sbjct: 2   GYKVGDMVVYPRHGAARVEEILQRTVKGVTREYLKLSVLSSDDLEIFVPVDNLKKVGVRD 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD-SQPE 130
           + +   V R  +++R     K   WSRR +    KI +GD+  IAEVVRDL + D  +  
Sbjct: 62  IVDGDEVSRVFEILRTPIVEKEMNWSRRYKLNVEKIATGDVNNIAEVVRDLSQRDVDEHG 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKT--EKSTSENQDKAA 188
            S  E+++   A + +  EIA    +SE E   L++VNL     +    +  +E  ++ A
Sbjct: 122 LSAGEKRMLTKARSILTSEIALSEELSEEETQRLLDVNLGYAEPQEGDAEHHTEVPEEPA 181


>gi|162449975|ref|YP_001612342.1| putative transcription factor [Sorangium cellulosum 'So ce 56']
 gi|161160557|emb|CAN91862.1| putative transcription factor [Sorangium cellulosum 'So ce 56']
          Length = 168

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 45/164 (27%), Positives = 84/164 (51%), Gaps = 1/164 (0%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +      F+ G+  VYPA GV  +  I+E+++AG +  F+V+        + VPV  A  
Sbjct: 2   QARSEIQFKVGDKAVYPAQGVAEVVNIEEKDIAGNRQRFYVLRILDTDRKIMVPVSNASA 61

Query: 67  IGMRKLSEAHFVERALKLVRGKAR-VKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRT 125
           +G+R++     +     ++R +        W+RR + +  KI +G +  +AEV+RDL+R 
Sbjct: 62  VGLRQVISEQEIREIFDILRERTIAFDNQTWNRRYRGFMDKIKTGSIYDVAEVLRDLYRL 121

Query: 126 DSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            +  + S+ ER++ ++A   +V+EIA     +E +    IE   
Sbjct: 122 KTDKQLSFGERRMLDTARTLIVKEIAIARGQTEEQVKTEIEAIF 165


>gi|256546065|ref|ZP_05473418.1| CarD family transcriptional regulator [Anaerococcus vaginalis ATCC
           51170]
 gi|256398182|gb|EEU11806.1| CarD family transcriptional regulator [Anaerococcus vaginalis ATCC
           51170]
          Length = 159

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 75/157 (47%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG G I  ++ +E  G + E+F++      M + +P      + +R +
Sbjct: 1   MFKIGDKIVYPMHGAGIIDSVETKEFLGEEKEYFILKMPIGNMDISIPKANINKMNIRDV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 E  L ++    +   + W+ R +E    + +GD+  IA +VRDL   D     S
Sbjct: 61  ISKKEGEEILAILEQDPKDLNSNWNLRYRENQEILKTGDIFKIANMVRDLVALDDDKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            +E++L   A   M  E+    S+ + +A  +I+ ++
Sbjct: 121 TTEKKLLNRARRIMASELVMSGSLEKDDAEKMIDESI 157


>gi|302379533|ref|ZP_07268018.1| CarD-like protein [Finegoldia magna ACS-171-V-Col3]
 gi|302312440|gb|EFK94436.1| CarD-like protein [Finegoldia magna ACS-171-V-Col3]
          Length = 160

 Score =  117 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 87/158 (55%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG G ITE++ +EV G+K ++F++     +M + +PV K  D+G+R +
Sbjct: 1   MFKIGDKIVYPMHGAGIITEVQNKEVLGVKKDYFILKMPMGEMKISIPVDKINDMGIRFV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +E   +     +++ +     + W++R +E   K+  GD+   A V + L+  DS    S
Sbjct: 61  AEEEIIHSLRDILKNQEVDFPSNWNQRYKENLEKLRIGDIKETAVVYKGLYELDSSKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             E+++  ++   ++ EIA+  ++   EA +++   + 
Sbjct: 121 MIEKKVLNTSRKMLISEIASGLNLKPSEAESMVNDLID 158


>gi|319790303|ref|YP_004151936.1| transcriptional regulator, CarD family [Thermovibrio ammonificans
           HB-1]
 gi|317114805|gb|ADU97295.1| transcriptional regulator, CarD family [Thermovibrio ammonificans
           HB-1]
          Length = 163

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 38/162 (23%), Positives = 70/162 (43%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ + YP HGVG I   + + V G ++ ++ I      M + +P       G+R +
Sbjct: 1   MFKVGDKVAYPPHGVGVIESTEVRVVGGKEVTYYRITLLGKNMSILIPEVGLESSGVRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +E     +  K       W+ R +    ++ +G++  +A VVR+L       E S
Sbjct: 61  LSEEEIEEVFSYLAEKPTNISEKWTIRHRLNVDRLKTGNIRELATVVRNLSYRSKDKELS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           YSE++++E A +++  EIA        +    I   L     
Sbjct: 121 YSEKRMFEEAFSKLAEEIALSLGEPVRKVKQRIRKILKEAQK 162


>gi|169824929|ref|YP_001692540.1| CarD family transcriptional regulator [Finegoldia magna ATCC 29328]
 gi|167831734|dbj|BAG08650.1| transcriptional regulator CarD family [Finegoldia magna ATCC 29328]
          Length = 160

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 87/158 (55%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG G ITE++ +EV G+K ++F++     +M + +PV K  D+G+R +
Sbjct: 1   MFKIGDKIVYPMHGAGIITEVQNKEVLGVKKDYFILKMPMGEMKISIPVDKINDMGIRFV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +E   +     +++ +     + W++R +E   K+  GD+   A V + L+  DS    S
Sbjct: 61  AEEEIIHSLRDILKNQEVDFPSNWNQRYKENLEKLRIGDIKETAIVYKGLYELDSSKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             E+++  ++   ++ EIA+  ++   EA +++   + 
Sbjct: 121 MIEKKVLNTSRKMLISEIASGLNLKPSEAESMVNDLID 158


>gi|258542109|ref|YP_003187542.1| CarD family transcriptional regulator [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633187|dbj|BAH99162.1| transcriptional regulator CarD [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636244|dbj|BAI02213.1| transcriptional regulator CarD [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639299|dbj|BAI05261.1| transcriptional regulator CarD [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642353|dbj|BAI08308.1| transcriptional regulator CarD [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645408|dbj|BAI11356.1| transcriptional regulator CarD [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648463|dbj|BAI14404.1| transcriptional regulator CarD [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651516|dbj|BAI17450.1| transcriptional regulator CarD [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654507|dbj|BAI20434.1| transcriptional regulator CarD [Acetobacter pasteurianus IFO
           3283-12]
          Length = 196

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 65/166 (39%), Positives = 99/166 (59%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +      F  G+ IVY AHGVG +  I   E+AG KLE   I+F  ++M L++P+ KA  
Sbjct: 31  KVKDEDPFEEGDAIVYAAHGVGRVDRIGVDEIAGTKLEVIQISFPGNQMTLRIPLSKARK 90

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
            G+RK+     V++A+ +++GK  V + MW+RRA  Y  KINSGDL+ IAEV+RDL R  
Sbjct: 91  AGLRKIVSREIVDKAMAIIKGKPHVSKGMWARRAVAYQEKINSGDLVQIAEVLRDLRRNV 150

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
              + S+SER+L+E+A  R V E+A + +    E +  +   + + 
Sbjct: 151 DSLDGSFSERKLFEAAQERFVAEVAVLENKDPTEVLESLTAVMKAA 196


>gi|146296815|ref|YP_001180586.1| CarD family transcriptional regulator [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410391|gb|ABP67395.1| transcriptional regulator, CarD family [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 173

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 80/163 (49%), Gaps = 4/163 (2%)

Query: 11  RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMR 70
           ++ ++ G+ I++P HG G I EI E++V     +++V+    + M + VPV  A +IG+R
Sbjct: 4   QRMYKVGDTIIHPLHGAGEIVEIVEEKVFDNVQKYYVVRILYNGMKILVPVNSAAEIGIR 63

Query: 71  KLSEAHFVERALKLVRG----KARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
            +       +  +L++             +++R +E   K+ SG++  + EV++ L   +
Sbjct: 64  NVISEEEANKVFELLKDNNFKVDINNCGNYNKRIRENQQKLKSGNIYCVVEVLKMLAARE 123

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
                S +E+ ++ +A   +V E+     +   E   +++  L
Sbjct: 124 KVKGLSTNEKMMFNNAKQILVSELGLAKGLDMEEVEKMVDSIL 166


>gi|85859811|ref|YP_462013.1| carD-like transcriptional regulator [Syntrophus aciditrophicus SB]
 gi|85722902|gb|ABC77845.1| carD-like transcriptional regulator [Syntrophus aciditrophicus SB]
          Length = 161

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/159 (28%), Positives = 88/159 (55%), Gaps = 1/159 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+  VYPA GVG I  I+ +EV G   +F+++    + M + +P G A  +G+R+L
Sbjct: 1   MFKVGDLAVYPAQGVGVIEAIESREVMGSTQKFYIMKIMSNGMKIMIPTGSAESVGLREL 60

Query: 73  SEAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                V +  ++++ K   + +  W++R +EY  KI +G +  IA V+RDL    +    
Sbjct: 61  ILEDDVPKVYEILKNKDITIDKQTWNKRYREYLEKIKTGSVFEIARVLRDLLILKNDKNL 120

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           S+ ER++ ++A + +++EI+  ++  E +    ++   S
Sbjct: 121 SFGERKMMDTAKSLLIKEISIASNAEETKIEQDLKTIFS 159


>gi|297624760|ref|YP_003706194.1| CarD family transcriptional regulator [Truepera radiovictrix DSM
           17093]
 gi|297165940|gb|ADI15651.1| transcriptional regulator, CarD family [Truepera radiovictrix DSM
           17093]
          Length = 165

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/160 (26%), Positives = 78/160 (48%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+++VYP+ G G + EI  + V G + E+  I+F +  M + VP+ K  ++G+R  
Sbjct: 1   MFKVGDNVVYPSQGAGRVDEITTRVVLGERHEYLKISFVRGDMDVLVPLKKGEEVGLRHT 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                V   L  +        T W  R +     +  GD  A+A ++  L + D +   +
Sbjct: 61  VALAEVGELLAAIAHSDLSLPTQWPPRHRAEQDILAGGDAYALARLIGVLAQRDLEKGLA 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            +ER++ E A   +  E+A V SIS   A   I+  ++++
Sbjct: 121 ATEREMLEGAKAMLASELAVVQSISLEAAHAQIDETIATQ 160


>gi|225620858|ref|YP_002722116.1| transcriptional regulator [Brachyspira hyodysenteriae WA1]
 gi|225215678|gb|ACN84412.1| Transcriptional regulator [Brachyspira hyodysenteriae WA1]
          Length = 194

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 79/168 (47%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            ++   ++VYP +G+  +  I + +V    +E +V+  + + + LKVP+ +  +  +RK+
Sbjct: 1   MYKLNTYVVYPMYGICKVVGISDNKVNSNLVECYVLECESENITLKVPINRVKEYRIRKI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 +  L +++ K       W  R QE + K+ SGD+    EV R L   +   E S
Sbjct: 61  ISKAEADNLLNILQTKPHDIENNWKIRYQENEEKLRSGDIKDTIEVARSLFTRNKLKELS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
            SE++LYE A   +V EI+        E  +++   L   + K +   
Sbjct: 121 ASEKRLYEKAYMFIVNEISIALKKDRDEIEDIVSNALEKSAKKFKTKP 168


>gi|296116291|ref|ZP_06834907.1| transcriptional regulator, CarD family protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977110|gb|EFG83872.1| transcriptional regulator, CarD family protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 196

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 67/170 (39%), Positives = 99/170 (58%)

Query: 3   FQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
              K +     FR G+ IVY AHGVG +  I   E+AG KLE   I+F  ++M L++P+ 
Sbjct: 27  KSSKPEKDEDPFREGDAIVYAAHGVGRVDRIGIDEIAGTKLEMIQISFPGNQMTLRIPLS 86

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
           KA   G+RK+     V++A+ +++GK  V R MW+RRA  Y  KINSGDL+ IAEV+RDL
Sbjct: 87  KARKSGLRKIVSREIVDKAMAIIKGKPHVSRGMWARRAVAYQEKINSGDLVQIAEVLRDL 146

Query: 123 HRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            R     + S+SER+L+E+A  R V E+A +        +  +   + + 
Sbjct: 147 RRNVDSLDGSFSERKLFEAAQERFVAEVAVLEGKEPAIVLETLTAVMKAA 196


>gi|326333885|ref|ZP_08200118.1| transcription-repair coupling factor [Nocardioidaceae bacterium
           Broad-1]
 gi|325948467|gb|EGD40574.1| transcription-repair coupling factor [Nocardioidaceae bacterium
           Broad-1]
          Length = 1198

 Score =  116 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 62/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++K+       + G+++V+  HGVG   E+K++EV G   E+ V+ +         P
Sbjct: 508 MPARRKKQIDPLELKPGDYVVHEQHGVGQFIEMKQREVQGATREYLVLEY--GASKRGAP 565

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
                    R    A  +++  + V G+      +     Q+  A+         AE+++
Sbjct: 566 PD-------RLYVPADALDQVTRYVGGEQPSLDRLGGADWQKRKARARKAVREIAAELIK 618

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +     Y     ++     +        +  +   I+ ++ ++     
Sbjct: 619 LYAARQATKGFQYGPDNPWQR---ELEDAFPFQETADQLAVIDEVKQDMMRPVP 669


>gi|303234185|ref|ZP_07320831.1| CarD-like protein [Finegoldia magna BVS033A4]
 gi|302494726|gb|EFL54486.1| CarD-like protein [Finegoldia magna BVS033A4]
          Length = 160

 Score =  116 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 42/158 (26%), Positives = 85/158 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG G ITE++ +EV G+K ++F++     +M + +PV K  D+G+R +
Sbjct: 1   MFKIGDKIVYPMHGAGIITEVQNKEVLGVKKDYFILKMPMGEMKISIPVDKINDMGIRFV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +E   +     +++ +     + W++R +    K+  GD+   A V + L+  DS    S
Sbjct: 61  AEEEIIHSLRDILKNQEVDFPSNWNQRYKGNLEKLRIGDIKETAVVYKGLYELDSSKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             E+++  ++   ++ EIA+  ++   EA  ++   + 
Sbjct: 121 MIEKKVLNTSRKMLISEIASGLNLKPSEAEKMVNDLID 158


>gi|284048085|ref|YP_003398424.1| transcriptional regulator, CarD family [Acidaminococcus fermentans
           DSM 20731]
 gi|283952306|gb|ADB47109.1| transcriptional regulator, CarD family [Acidaminococcus fermentans
           DSM 20731]
          Length = 159

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 38/157 (24%), Positives = 81/157 (51%), Gaps = 2/157 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ ++YP HG   I  ++++++ G  + +FV+      M + +P      IG+R +
Sbjct: 1   MFTVGDKVLYPMHGAAVIKNVEQKQIDGHPVNYFVLKMLLSDMKVLIPEVNVDKIGLRPI 60

Query: 73  SEAHFVERALKLVRGKA--RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
                + +   +++ +   ++KR  W+RR   Y  K+ +GD+  +A+VVR L   +++ +
Sbjct: 61  VNKAILPKVEDVLKARPENKMKRITWNRRYNMYVDKMKTGDIFEVADVVRTLAVQETEKK 120

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEV 167
            S  ER+L  +A   ++ E   V S+ E ++   ++ 
Sbjct: 121 LSAGERRLLTTAKQILLSEFMLVESVDEEKSEKWLDQ 157


>gi|162147634|ref|YP_001602095.1| CarD family transcriptional regulator [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542263|ref|YP_002274492.1| CarD family transcriptional regulator [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786211|emb|CAP55793.1| Transcriptional regulator, CarD family [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209529940|gb|ACI49877.1| transcriptional regulator, CarD family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 196

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 66/166 (39%), Positives = 98/166 (59%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +      FR G+ IVY AHGVG +  I   E+AG KLE   I+F  ++M L++P+ KA  
Sbjct: 31  KVKDEDPFREGDAIVYAAHGVGRVDRIGIDEIAGTKLEMIQISFPGNQMTLRIPLAKARK 90

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
            G+RK+     V++A+ +++GK  V R MW+RRA  Y  KINSGDL+ IAEV+RDL R  
Sbjct: 91  AGLRKIVSREIVDKAMAIIKGKPHVSRGMWARRAVAYQEKINSGDLVQIAEVLRDLRRNV 150

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
              + S+SER+L+E+A  R V E+A +        +  +   + + 
Sbjct: 151 DSLDGSFSERKLFEAAQERFVAEVAVLEGKEPTAVLEALTAAMKAA 196


>gi|329114138|ref|ZP_08242900.1| Transcriptional Regulator CarD Family [Acetobacter pomorum DM001]
 gi|326696214|gb|EGE47893.1| Transcriptional Regulator CarD Family [Acetobacter pomorum DM001]
          Length = 196

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 65/166 (39%), Positives = 98/166 (59%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +      F  G+ IVY AHGVG +  I   E+AG KLE   I+F  ++M L++P+ KA  
Sbjct: 31  KVKDEDPFEEGDAIVYAAHGVGRVDRIGVDEIAGTKLEVIQISFPGNQMTLRIPLSKARK 90

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
            G+RK+     V++A+ +++GK  V + MW+RRA  Y  KINSGDL+ IAEV+RDL R  
Sbjct: 91  AGLRKIVSREIVDKAMAIIKGKPHVSKGMWARRAVAYQEKINSGDLVQIAEVLRDLRRNV 150

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
              + S+SER+L+E+A  R V E+A +      E +  +   + + 
Sbjct: 151 DSLDGSFSERKLFEAAQERFVAEVAVLEKKDPTEVLESLTAVMKAA 196


>gi|330813497|ref|YP_004357736.1| carD-like transcriptional regulator [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486592|gb|AEA80997.1| carD-like transcriptional regulator [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 273

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 70/175 (40%), Positives = 111/175 (63%), Gaps = 3/175 (1%)

Query: 3   FQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
             +K+D  ++ ++  ++++YP HG+G IT +++  +AG+ + F+ I   KDK+ L +P  
Sbjct: 98  KIKKQDNEKRTYKIKDYVIYPKHGIGQITAVEKDTIAGIDINFYKIEITKDKLVLTIPTN 157

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
                 +R LS    V +A+ +++GKA+VKRTMWSRRAQEY+ KINSG++  IAEVVRDL
Sbjct: 158 --QQGHLRSLSSTGQVAKAISILKGKAKVKRTMWSRRAQEYEQKINSGEIYQIAEVVRDL 215

Query: 123 HRTDSQP-EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKT 176
           ++    P ++SYSERQL+E A  R++ E+  V   +E EA   +   L  K  + 
Sbjct: 216 NKNTDMPVDQSYSERQLFEKAFERLLGEVTVVLEATEEEAKEKLNKALGKKPEQA 270


>gi|320538285|ref|ZP_08038170.1| CarD-like transcriptional regulator [Treponema phagedenis F0421]
 gi|320144861|gb|EFW36592.1| CarD-like transcriptional regulator [Treponema phagedenis F0421]
          Length = 205

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 47/163 (28%), Positives = 76/163 (46%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           + +  F   + +VYP  GVG ITEI ++E     L+++VI  +   M + VPV +A ++G
Sbjct: 2   SKKFTFAVNQKVVYPGQGVGEITEICKKEFKEEMLQYYVIYLEDSDMTMMVPVMRAEELG 61

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           +R +      E AL  +  +       W  R Q       SG ++  + +VR L+     
Sbjct: 62  IRTIVSKKDAESALDFLSKEVEQGPLDWKMRYQMNLDLFKSGGVLDNSTIVRSLYHRSKI 121

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
            E    ER+LY+SA      EI+A   + + E  +LI   L  
Sbjct: 122 KELPIQERKLYDSAYRIFEDEISAALGLPQNEIKSLIHTYLEK 164


>gi|58040444|ref|YP_192408.1| transcriptional regulator [Gluconobacter oxydans 621H]
 gi|58002858|gb|AAW61752.1| Transcriptional regulator [Gluconobacter oxydans 621H]
          Length = 184

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 64/159 (40%), Positives = 99/159 (62%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           FR G+ IVY AHGVG + +I   EVA   +E   I+F  ++M L++P+ KA   G+RK+ 
Sbjct: 26  FREGDSIVYAAHGVGRVDKIGMVEVADTVIEMIQISFPGNQMTLRIPLAKARKAGLRKIV 85

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               V++A+ +++GK  V + MW+RRA  Y  KINSGDLI IAEV+RDL R     + S+
Sbjct: 86  TRDIVDKAMTVIKGKPHVSKGMWARRAVAYQEKINSGDLIQIAEVLRDLRRNVDSLDGSF 145

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
           SER+L+E+A  R V E+A + ++   + +  +   + + 
Sbjct: 146 SERKLFEAAQERFVAEVAVLENVDPAQVLENLTKTMKAA 184


>gi|300870668|ref|YP_003785539.1| CarD family transcriptional regulator [Brachyspira pilosicoli
           95/1000]
 gi|300688367|gb|ADK31038.1| transcriptional regulator, CarD family [Brachyspira pilosicoli
           95/1000]
          Length = 191

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/172 (25%), Positives = 82/172 (47%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            ++   ++VYP +G+  +  I + +V    +E +V+  + + + LKVP+ +  +  +RK+
Sbjct: 1   MYKVNSYVVYPMYGICKVIGIADNKVNSSVVECYVLECEGENITLKVPINRVKEYRIRKI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 E  L L++ K       W  R QE + K+ SG++    EV R L   +   E S
Sbjct: 61  ISKAEAENFLNLLQTKPHDIENNWKIRYQENEEKLRSGEIKDTIEVARSLFTRNKLKELS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQ 184
            SE++LYE A   +V EI+        +  +++   L   + K +   +E +
Sbjct: 121 ASEKRLYEKAYMFIVNEISIALKKDRDQIEDIVSNALEKSAKKFKTKPAEKE 172


>gi|194014646|ref|ZP_03053263.1| transcriptional regulator, CarD family [Bacillus pumilus ATCC 7061]
 gi|194013672|gb|EDW23237.1| transcriptional regulator, CarD family [Bacillus pumilus ATCC 7061]
          Length = 157

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/157 (27%), Positives = 82/157 (52%), Gaps = 2/157 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G  IVYP HG G I  ++E+E+ G   E+F+I      M + +P G+   +G+R++
Sbjct: 1   MFQIGNKIVYPMHGAGVIEGMEEKEILGKTEEYFLIQMP--NMQMMIPRGRINQLGIRQV 58

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  +     +       W +R  E   K+ +G +   A+VV+DL R + +   +
Sbjct: 59  ADQATLKVVMNNFAEETNDDTLTWKQRYDENMKKLKTGAIEDGADVVKDLMRRNQKKALN 118

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            SE+++ E A   +V EI+    +S+ E ++ +E  L
Sbjct: 119 SSEKKMLEDARGMLVSEISLAQGLSQDEVLSALENEL 155


>gi|297568584|ref|YP_003689928.1| transcriptional regulator, CarD family [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924499|gb|ADH85309.1| transcriptional regulator, CarD family [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 165

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 86/164 (52%), Gaps = 1/164 (0%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
            A  + FR G+  VYPAHGVG I  I+ ++V  ++  F+V+ F +  M + +P      +
Sbjct: 2   SATLEMFRVGDMAVYPAHGVGKIESIESRKVGELEQSFYVMRFIESNMTVMIPTTTCDTV 61

Query: 68  GMRKLSEAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           G+R +  A  V++   ++  +    +   W++R +EY  KI +G +  IA V+RDL    
Sbjct: 62  GLRNIISADDVQQVFAILNQRDVETESQPWNQRYREYTNKIKTGSIFEIAAVLRDLLLLR 121

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
              + S+ ER++ ++A   +V+EIA    I E +    I+   S
Sbjct: 122 GDKDLSFGERKMVDTAKTLLVKEIALAKQIQEEQVAEHIDRIFS 165


>gi|303327050|ref|ZP_07357492.1| transcriptional regulator, CarD family [Desulfovibrio sp. 3_1_syn3]
 gi|302863038|gb|EFL85970.1| transcriptional regulator, CarD family [Desulfovibrio sp. 3_1_syn3]
          Length = 171

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 80/158 (50%), Gaps = 3/158 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F   + +VYPA GVG I  I  Q + G+  EF+++    + + L VPV  A ++G+R L
Sbjct: 1   MFAPDDLVVYPAQGVGKIERIDRQNIGGIACEFYIVRIRANNITLMVPVNNAANVGLRTL 60

Query: 73  SEAHFVERALKLVRG---KARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           +     +  L+ +RG   K       W+RR +EY  ++ S DL  + EV+R+L       
Sbjct: 61  TPEADAQGILETLRGDTDKTIYTGQNWNRRFREYSERLKSPDLAVVTEVLRELLLISRSK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEV 167
           E S+ ER+L E A+  +  E+A V  ++E      +  
Sbjct: 121 ELSFGERRLQEQAMGLVTGELAEVLHLTEDSLREELLE 158


>gi|315501932|ref|YP_004080819.1| transcription-repair coupling factor [Micromonospora sp. L5]
 gi|315408551|gb|ADU06668.1| transcription-repair coupling factor [Micromonospora sp. L5]
          Length = 1218

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 59/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        + G+ +V+  HG+G   E+ ++ V G   E+ V         ++  
Sbjct: 517 MPSRRRNTIDPLELKAGDFVVHEQHGIGRYVELVQRTVNGASREYLV---------IEYA 567

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+      M     Q+  A+         A++++
Sbjct: 568 PSKRGQPGDRLFVPTDQLDQLSRYVGGEQPTLHKMGGSDWQKSKARARKAVREIAAQLIQ 627

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    ++     ++     +        +  +  AI  ++ ++     
Sbjct: 628 LYAARKASKGHNFGPDTPWQR---ELEDAFPWQETPDQLAAIEEVKRDMEQTVP 678


>gi|302865387|ref|YP_003834024.1| transcription-repair coupling factor [Micromonospora aurantiaca
           ATCC 27029]
 gi|302568246|gb|ADL44448.1| transcription-repair coupling factor [Micromonospora aurantiaca
           ATCC 27029]
          Length = 1218

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 59/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        + G+ +V+  HG+G   E+ ++ V G   E+ V         ++  
Sbjct: 517 MPSRRRNTIDPLELKAGDFVVHEQHGIGRYVELVQRTVNGASREYLV---------IEYA 567

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+      M     Q+  A+         A++++
Sbjct: 568 PSKRGQPGDRLFVPTDQLDQLSRYVGGEQPTLHKMGGSDWQKSKARARKAVREIAAQLIQ 627

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    ++     ++     +        +  +  AI  ++ ++     
Sbjct: 628 LYAARKASKGHNFGPDTPWQR---ELEDAFPWQETPDQLAAIEEVKRDMEQTVP 678


>gi|301167408|emb|CBW26990.1| putative transcriptional regulator [Bacteriovorax marinus SJ]
          Length = 176

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/163 (28%), Positives = 82/163 (50%), Gaps = 3/163 (1%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
                F  G++ V P HGVG + +I+E+EV G KL F++I    + M + VP       G
Sbjct: 16  TEVTMFNIGDYAVCPGHGVGQVCDIEEKEVGGDKLSFYIIKIIANGMTVMVPTNSEN--G 73

Query: 69  MRKLSEAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           +R+L     +    +L++     V  + W+RR +EY  KI +G L+ IA+V+R L    +
Sbjct: 74  IRELVGNEEINEVYELLQDHDVEVDNSTWNRRYREYMTKIKTGSLLEIADVLRALFLLRA 133

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           +   S+ E+++ E   + + +EI+  N     E    I+   +
Sbjct: 134 KKNLSFGEKKMLEQCRDLLAQEISLSNGNDTKEISTTIDDYFN 176


>gi|42782726|ref|NP_979973.1| CarD family transcriptional regulator [Bacillus cereus ATCC 10987]
 gi|42738652|gb|AAS42581.1| transcriptional regulator, CarD family [Bacillus cereus ATCC 10987]
          Length = 158

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 43/151 (28%), Positives = 81/151 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP HG G I  I+E+E+AG K +++VI      M L +P G+ +   +R ++
Sbjct: 7   FQIGDNIVYPMHGAGIIKAIEEKEIAGEKQQYYVIKMLGSNMELMIPAGRILSSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   L + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITAIAHILDVFQHGESDRLLTWKQRYKLNTDKIKTGKIQEGAEVVRDLLRMQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITESQIKSF 157


>gi|257456307|ref|ZP_05621504.1| transcription factor [Treponema vincentii ATCC 35580]
 gi|257446393|gb|EEV21439.1| transcription factor [Treponema vincentii ATCC 35580]
          Length = 198

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 51/175 (29%), Positives = 79/175 (45%), Gaps = 2/175 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F   E +VYP  GVG I EI E++     L ++VI FD+  M + VP  KA ++G+R +
Sbjct: 5   SFTVKERVVYPGQGVGEIVEISEKKFKDEMLTYYVIYFDESDMTVLVPAMKAAELGIRTI 64

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
             A   + AL  +  K     + W  R Q       +G ++  A +VR L+      E  
Sbjct: 65  VSADEAQAALAFLSEKFDPIPSDWKMRYQMNLDLFKTGSILDNASIVRSLYHRSKIKELP 124

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS--SKSSKTEKSTSENQD 185
             ER+LY+SA      E++      + E   +I   L   SK++   K    + D
Sbjct: 125 IQERKLYDSAYRIFYDELSYALQKPKSEIEAMIHSYLEVLSKNAPAGKQEQLDDD 179


>gi|328952413|ref|YP_004369747.1| transcriptional regulator, CarD family [Desulfobacca acetoxidans
           DSM 11109]
 gi|328452737|gb|AEB08566.1| transcriptional regulator, CarD family [Desulfobacca acetoxidans
           DSM 11109]
          Length = 169

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 86/159 (54%), Gaps = 1/159 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+  VYPAHGVG I  I+++E++G    F+++    + M + +P   A ++G+R +
Sbjct: 1   MFQLGDLAVYPAHGVGVIESIEDKEISGNHQTFYIMRILDNNMIIMIPTHNASNVGLRGI 60

Query: 73  SEAHFVERALKLVRGKARVKRTM-WSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +   V    +++  K RV     W+RR ++Y  KI +G L  +AEV+RDL       + 
Sbjct: 61  IDGQAVTTIYEILAKKDRVVEHQTWNRRYRDYMEKIKTGSLFHVAEVLRDLTLLKLDKDL 120

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           S+ ER++ ++A N +V+E++      E +    I   L 
Sbjct: 121 SFGERKMLDTAKNLLVKELSIAEKKEEDKIEQKINSLLE 159


>gi|256828487|ref|YP_003157215.1| CarD family transcriptional regulator [Desulfomicrobium baculatum
           DSM 4028]
 gi|256577663|gb|ACU88799.1| transcriptional regulator, CarD family [Desulfomicrobium baculatum
           DSM 4028]
          Length = 176

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 81/176 (46%), Gaps = 7/176 (3%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F   E +VYPA GVG +  I+ QE+ G+  E  ++    + + L VPV  A ++G+R +
Sbjct: 1   MFSVDELVVYPAQGVGKVERIETQEIGGVATELIIVRILSNNVTLMVPVKNARNVGLRGV 60

Query: 73  SEAHFVERALKLVRGKAR---VKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
                 +     ++ +          W+RR +EY  K+ S DL  +A V+++L       
Sbjct: 61  YTPEQADEIRVYLQDRTDFTGYSGQNWNRRYREYSEKLKSSDLRDVAYVLKELILIGKDK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIE----VNLSSKSSKTEKSTS 181
           E S+ ER+L E A+  +  E++      + E    IE      L +K ++ E    
Sbjct: 121 ELSFGERRLLEQAMGLISLELSFALKQDQAEVKKSIEDLFADILHAKDAENEAEVD 176


>gi|134301075|ref|YP_001114571.1| CarD family transcriptional regulator [Desulfotomaculum reducens
           MI-1]
 gi|134053775|gb|ABO51746.1| transcriptional regulator, CarD family [Desulfotomaculum reducens
           MI-1]
          Length = 155

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 37/158 (23%), Positives = 77/158 (48%), Gaps = 4/158 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ + YP HG G I  I+E+E+ G K  ++V+      M +  P     DI +R +
Sbjct: 1   MFQIGDKVFYPMHGAGVIEAIEEKEILGNKQLYYVMQI--RNMQVMFP--MKSDIPLRPV 56

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++        +A       ++R +    K+ SGD+    +V+RDL     +   +
Sbjct: 57  VDLDILDVLFTTFNEEALDLTLKPNQRYRSNMNKMKSGDIYQGVQVIRDLILMSKKRTLA 116

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             ++ + ++AL  ++ E+  V  I+E +A++L+   ++
Sbjct: 117 TGDKAMLDNALQILISELVLVKGITEEQAVDLVNGVIN 154


>gi|296126550|ref|YP_003633802.1| CarD family transcriptional regulator [Brachyspira murdochii DSM
           12563]
 gi|296018366|gb|ADG71603.1| transcriptional regulator, CarD family [Brachyspira murdochii DSM
           12563]
          Length = 191

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 83/173 (47%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            ++   ++VYP +G+  +  I + +V    +E +V+  + + + LKVP+ +  +  +RK+
Sbjct: 1   MYKLNTYVVYPMYGICKVIGISDSKVNSNLVECYVLECESENITLKVPINRVKEYRIRKI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 +  + +++ K +     W  R QE + K+ SG++    EV R L   +   E S
Sbjct: 61  ISKAEADELINVLQTKPQDIENNWKIRYQENEEKLRSGNIKDTIEVARSLFTRNKLKELS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQD 185
            SE++LYE A   +V EI+      + E  +++   L   + K +    E + 
Sbjct: 121 ASEKRLYEKAYMFIVNEISIALKKDKDEIEDIVSNALEKSAKKFKTKPLEKEK 173


>gi|325294895|ref|YP_004281409.1| transcriptional regulator, CarD family [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065343|gb|ADY73350.1| transcriptional regulator, CarD family [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 163

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 41/158 (25%), Positives = 72/158 (45%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +  P HGVG +   +E+EV G K+ +F I+     M + VP     + G+R +
Sbjct: 1   MFKIGDKVACPPHGVGIVEGKEEREVGGKKVIYFRISLVGKSMSILVPEESIENSGIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +E     +          W+ R +    ++ +GD+  +A VVR+L     + E S
Sbjct: 61  LSEESIEEIFNYLSEIPTNISEKWTVRHRLNVDRLKTGDIKELATVVRNLSYRSKEKELS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           YSE++++E A  ++  EIA        +    I   L 
Sbjct: 121 YSEKRMFEEAFGKLAEEIALSLGEPVKKVKQKIRKILK 158


>gi|75761918|ref|ZP_00741841.1| CarD-like transcriptional regulator [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|74490589|gb|EAO53882.1| CarD-like transcriptional regulator [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
          Length = 167

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 40/151 (26%), Positives = 80/151 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E++G K +++VI      M L +P G+  +  +R ++
Sbjct: 16  FQIGDNIVYPMQGAGIIKAIEEKEISGEKQQYYVIKMSASNMELMIPAGRISNSNIRPVT 75

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 76  DITALVHIMDIFQHGESDRLLTWKQRYKLNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 135

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 136 SEKKMLDNAYEFLISELGLIEGITENQIKSF 166


>gi|258540716|ref|YP_003175215.1| transcription-repair coupling factor [Lactobacillus rhamnosus Lc
           705]
 gi|257152392|emb|CAR91364.1| Transcription-repair coupling factor [Lactobacillus rhamnosus Lc
           705]
          Length = 1175

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 19/162 (11%), Positives = 57/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G  T ++  EV G+  + ++    ++   L +PV +   +     
Sbjct: 494 ELKPGDYVVHVNHGIGQYTGMETLEVDGVHRD-YITIVYRNNDKLFIPVDQLNLVQKYVS 552

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +             GK      +     Q+   K+ +       E++    + +++   +
Sbjct: 553 A------------DGKTPNVNKLGGTEWQKTKRKVAARIEDIADELIDLYAKREAEKGYA 600

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +      +    +   E     +  +  +   I+ ++     
Sbjct: 601 FGPDDDLQ---QKFEDEFPYPETPDQLRSAKEIKRDMEKPKP 639


>gi|89096669|ref|ZP_01169561.1| transcriptional regulator, CarD family protein [Bacillus sp. NRRL
           B-14911]
 gi|89088684|gb|EAR67793.1| transcriptional regulator, CarD family protein [Bacillus sp. NRRL
           B-14911]
          Length = 160

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 43/151 (28%), Positives = 82/151 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+  +++VYP HGVG I  I+E+EV G K +++VI      M + +P GK ++ G+R ++
Sbjct: 9   FQIDDNVVYPMHGVGIIKAIEEKEVLGEKQQYYVIKMLVGNMEVMIPAGKIVNSGIRPVT 68

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +++ + + +     +   W +R +    KI +G +    EVVRDL R   +   + 
Sbjct: 69  DIIALKQLMNIFQNGETDRLLPWKQRFKVNTDKIKTGKIQECTEVVRDLMRMKKEKALNT 128

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SERQ+  +A   ++ E+  +  I+E +  + 
Sbjct: 129 SERQMLNNAHEILISELGLMKGITENQIKSF 159


>gi|78357172|ref|YP_388621.1| CarD family transcriptional regulator [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78219577|gb|ABB38926.1| transcriptional regulator, CarD family [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 171

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 84/171 (49%), Gaps = 3/171 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F   + +VYPA GVG +  ++ Q V G + EF+++    + + L VPV  A+++G+R L
Sbjct: 1   MFVPDQLVVYPAQGVGKVERLESQVVGGAEAEFYIVRILSNNVTLMVPVKNAVNVGLRAL 60

Query: 73  SEAHFVERALKLVRGKAR---VKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
             A   ++ L  ++ ++         W+RR +EY  K+ SG L  +A V+++L       
Sbjct: 61  CSAEEGQKILDSLQDRSDFTGYTGQNWNRRYREYSEKLKSGSLEDVAYVLKELLLIGKDK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           E S+ ER+L E ++  +  E+A     ++ +    IEV         E   
Sbjct: 121 ELSFGERRLLEQSMGLITLELAHALDTTQEDVKARIEVFFEDVLHPEENPE 171


>gi|312135061|ref|YP_004002399.1| CarD family transcriptional regulator [Caldicellulosiruptor
           owensensis OL]
 gi|311775112|gb|ADQ04599.1| transcriptional regulator, CarD family [Caldicellulosiruptor
           owensensis OL]
          Length = 168

 Score =  114 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 78/161 (48%), Gaps = 4/161 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            ++ G+ I++P HG G I EI E++V     +++V+    + M + VPV  A +IG+R +
Sbjct: 1   MYKVGDTIIHPLHGAGRIVEIVEEKVFDSVQKYYVVKILYNGMKVLVPVKSASEIGIRNV 60

Query: 73  SEAHFVERALKLVRG----KARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
                  R  +L++             +++R +E   K+ SG++  + EV++ L   +  
Sbjct: 61  ISEEEANRVFELLKDNSFKVDINSCGNYNKRIRENQQKLKSGNIYCVVEVLKMLAMREKI 120

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
              S +E+ ++ +A   +V E+     +   E   +++  L
Sbjct: 121 KGLSTNEKMMFNTAKQILVSELGLAKGLDMEEVERMVDSIL 161


>gi|229551616|ref|ZP_04440341.1| transcription-repair coupling factor [Lactobacillus rhamnosus
           LMS2-1]
 gi|229315020|gb|EEN80993.1| transcription-repair coupling factor [Lactobacillus rhamnosus
           LMS2-1]
          Length = 1182

 Score =  114 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 19/162 (11%), Positives = 57/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G  T ++  EV G+  + ++    ++   L +PV +   +     
Sbjct: 501 ELKPGDYVVHVNHGIGQYTGMETLEVDGVHRD-YITIVYRNNDKLFIPVDQLNLVQKYVS 559

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +             GK      +     Q+   K+ +       E++    + +++   +
Sbjct: 560 A------------DGKTPNVNKLGGTEWQKTKRKVAARIEDIADELIDLYAKREAEKGYA 607

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +      +    +   E     +  +  +   I+ ++     
Sbjct: 608 FGPDDDLQ---QKFEDEFPYPETPDQLRSAKEIKRDMEKPKP 646


>gi|199598792|ref|ZP_03212204.1| Transcription-repair coupling factor (superfamily II helicase)
           [Lactobacillus rhamnosus HN001]
 gi|199590297|gb|EDY98391.1| Transcription-repair coupling factor (superfamily II helicase)
           [Lactobacillus rhamnosus HN001]
          Length = 1175

 Score =  114 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 19/162 (11%), Positives = 57/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G  T ++  EV G+  + ++    ++   L +PV +   +     
Sbjct: 494 ELKPGDYVVHVNHGIGQYTGMETLEVDGVHRD-YITIVYRNNDKLFIPVDQLNLVQKYVS 552

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +             GK      +     Q+   K+ +       E++    + +++   +
Sbjct: 553 A------------DGKTPNVNKLGGTEWQKTKRKVAARIEDIADELIDLYAKREAEKGYA 600

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +      +    +   E     +  +  +   I+ ++     
Sbjct: 601 FGPDDDLQ---QKFEDEFPYPETPDQLRSAKEIKRDMEKPKP 639


>gi|310823503|ref|YP_003955861.1| transcriptional regulator CarD [Stigmatella aurantiaca DW4/3-1]
 gi|27651196|emb|CAD60088.1| HMGA-type transcription factor [Stigmatella aurantiaca DW4/3-1]
 gi|309396575|gb|ADO74034.1| Transcriptional regulator CarD [Stigmatella aurantiaca DW4/3-1]
          Length = 305

 Score =  114 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 52/174 (29%), Positives = 85/174 (48%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
                  G+ +VYP  GV  I+ I+ +EVAG KL F  +  ++D   + VP  K   IG+
Sbjct: 3   EGLQLSVGDRVVYPNQGVCLISAIEVKEVAGQKLTFVTMRREEDGAVVMVPQAKVQAIGV 62

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           RK++    VE+    +R  +      W +RA+    ++  G ++ +AEVV+ L       
Sbjct: 63  RKVAGPAEVEQIYAFLRSDSDKADLDWKQRARTNLDRMTQGGILGLAEVVKGLQVLSELR 122

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSEN 183
                ER+LY++A + +V E+AA  SI E  A + I++ L     +  K T   
Sbjct: 123 PLPTKERELYDNARHLLVTEVAAALSIPEVNAEDSIDIVLFPPGKERPKRTVAE 176


>gi|302534880|ref|ZP_07287222.1| transcription-repair coupling factor [Streptomyces sp. C]
 gi|302443775|gb|EFL15591.1| transcription-repair coupling factor [Streptomyces sp. C]
          Length = 1179

 Score =  114 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ +         ++  
Sbjct: 488 MPTRRRKSIDPLTLEVGDYIVHEQHGVGRYIEMVQRTVQGATREYLL---------VEYA 538

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 539 PAKRGQPGDRLYIPTDQLEQVTKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 598

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 599 LYSARMAAPGHTFGPDTPWQR---ELEDAFPYAETPDQLTTIAEVKEDMEKSVP 649


>gi|330837541|ref|YP_004412182.1| transcriptional regulator, CarD family [Spirochaeta coccoides DSM
           17374]
 gi|329749444|gb|AEC02800.1| transcriptional regulator, CarD family [Spirochaeta coccoides DSM
           17374]
          Length = 161

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 48/160 (30%), Positives = 75/160 (46%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+HIVYP  GVG I  I+E+   G    ++VI      M +K+P+ KA ++G+R +
Sbjct: 2   KFSVGDHIVYPLQGVGIIKCIEERNFQGEPQPYYVIHIAISDMIVKIPIAKAAEMGIRAI 61

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 + A+  +  K       W  R Q     +  G + +IA+VV+ L+      E  
Sbjct: 62  VPPSEAQEAIDSISSKYDPLPVDWKTRYQMNVDLLQQGSIASIAQVVQALYHRSKVKELP 121

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
             ER+LY+ AL  ++ E++      E E   LI   L  K
Sbjct: 122 VQERKLYDGALRLLIDEVSFSLKRPEDEIEKLIFSRLEKK 161


>gi|212703168|ref|ZP_03311296.1| hypothetical protein DESPIG_01209 [Desulfovibrio piger ATCC 29098]
 gi|212673434|gb|EEB33917.1| hypothetical protein DESPIG_01209 [Desulfovibrio piger ATCC 29098]
          Length = 172

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 47/172 (27%), Positives = 83/172 (48%), Gaps = 4/172 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F + + +VYPA GVG I  I  Q + G   +F+++    + + L VPV  A ++G+R L
Sbjct: 1   MFTSEQLVVYPAQGVGQIERIDSQNIGGSACDFYIVRIRANSITLMVPVKNASNVGLRTL 60

Query: 73  SEAHFVERALKLVRGKA---RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
                 E   + +R            W+RR +EY  ++ S DL  +A V+R+L       
Sbjct: 61  VSTKEAEHIWEALRNNPQQTVHTGQNWNRRFREYSERLKSPDLSIVANVLRELLLIGRTK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTS 181
           + S+ ER+L E A++ +  E+  V    + +  + +   L S  +K   +T+
Sbjct: 121 DLSFGERRLLEQAMSLVTGELGEVLKTEQRDLQSELIS-LYSPPAKQPATTA 171


>gi|254384864|ref|ZP_05000200.1| transcriptional-repair coupling factor [Streptomyces sp. Mg1]
 gi|194343745|gb|EDX24711.1| transcriptional-repair coupling factor [Streptomyces sp. Mg1]
          Length = 1187

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ +         ++  
Sbjct: 497 MPTRRRKAIDPLTLEVGDYIVHEQHGVGRYIEMVQRTVQGATREYLL---------VEYA 547

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 548 PAKRGQPGDRLYIPTDQLEQVTKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 607

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 608 LYSARMAAPGHTFGPDTPWQR---ELEDAFPYAETPDQLTTIAEVKEDMEKSVP 658


>gi|72160828|ref|YP_288485.1| transcription-repair coupling factor [Thermobifida fusca YX]
 gi|71914560|gb|AAZ54462.1| transcription-repair coupling factor [Thermobifida fusca YX]
          Length = 1210

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 59/174 (33%), Gaps = 13/174 (7%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        + G+++V+  HG+G   E+  + + G   E+ V         ++  
Sbjct: 518 MPSRRR-GVDPLQLKPGDYVVHEQHGIGRYVEMVSRTIQGATREYLV---------IEYA 567

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       ++   + V G +     M      +  ++          +++R
Sbjct: 568 PSKRGQPGDRLFVPTDQLDEVTRYVGGDSPTLSKMGGSDWAKAKSRARKAVREIAGDLIR 627

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++S    ++     +      V +  +  AI  ++ ++     
Sbjct: 628 LYSARHASPGHAFSPDTPWQR---ELEDAFPYVETPDQLAAIEEVKRDMEKPVP 678


>gi|296271090|ref|YP_003653722.1| transcription-repair coupling factor [Thermobispora bispora DSM
           43833]
 gi|296093877|gb|ADG89829.1| transcription-repair coupling factor [Thermobispora bispora DSM
           43833]
          Length = 1164

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 64/174 (36%), Gaps = 18/174 (10%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +  +++        + G+++V+  HGVG   E+ ++ V G   E+ VI + K    L VP
Sbjct: 476 LPSRRRNMVDPLQLKPGDYVVHEQHGVGRYVEMVQRTVQGATREYLVIEYAKGD-RLYVP 534

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +  ++                 V G+      M     Q+  ++         AE++R
Sbjct: 535 TDQLDEVTRY--------------VGGETPTLNRMGGSDWQKTKSRARKAVREIAAELIR 580

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++S    ++  +         V +  + EAI  ++ ++     
Sbjct: 581 LYSARMASPGFAFSPDTPWQREME---DAFPYVETKDQLEAIEEVKRDMERPVP 631


>gi|229162478|ref|ZP_04290439.1| Transcriptional regulator, CarD [Bacillus cereus R309803]
 gi|228620957|gb|EEK77822.1| Transcriptional regulator, CarD [Bacillus cereus R309803]
          Length = 158

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 82/151 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP HG G I  I+E+E++G K +++VI      M L +P G+ ++  +R ++
Sbjct: 7   FQIGDNIVYPMHGAGIIKAIEEKEISGEKQQYYVIKMSASNMELMIPAGRILNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALAHIMDIFQHGESDRLLTWKQRYKLNTDKIKTGKIQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITENQIKSF 157


>gi|302871953|ref|YP_003840589.1| transcriptional regulator, CarD family [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302574812|gb|ADL42603.1| transcriptional regulator, CarD family [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 168

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 78/161 (48%), Gaps = 4/161 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            ++ G+ I++P HG G I EI E++V     +++V+    + M + VPV  A +IG+R +
Sbjct: 1   MYKVGDTIIHPLHGAGRIVEIVEEKVFDSVQKYYVVKILYNGMKVLVPVKSASEIGIRNV 60

Query: 73  SEAHFVERALKLVRG----KARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
                  R  +L++             +++R +E   K+ SG++  + EV++ L   +  
Sbjct: 61  ISEEEANRVFELLKDNSFKVDINSCGNYNKRIRENQQKLKSGNIYCVVEVLKMLAMREKI 120

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
              S +E+ ++ +A   +V E+     +   E   +++  L
Sbjct: 121 KGLSTNEKMMFNTAKQILVSELGLAKGLDMEEVERIVDSIL 161


>gi|288556410|ref|YP_003428345.1| CarD family transcriptional regulator [Bacillus pseudofirmus OF4]
 gi|288547570|gb|ADC51453.1| CarD family transcriptional regulator [Bacillus pseudofirmus OF4]
          Length = 158

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 81/151 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP HG G I  I+E+E++G K +++VI      M + +P GK +   +R ++
Sbjct: 7   FQIGDNIVYPMHGAGIIKAIEEKEISGKKQQYYVIKMSIGNMQVMIPTGKILSSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  + + +         W +R +    KI +G L   AEVVRDL +   +   + 
Sbjct: 67  DIIALKNIIHIFQHGESDSLLSWKQRYKVNTDKIKTGKLQECAEVVRDLMQMKKEKTLNT 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGFIKGITENQIKSF 157


>gi|121535694|ref|ZP_01667498.1| transcriptional regulator, CarD family [Thermosinus carboxydivorans
           Nor1]
 gi|121305725|gb|EAX46663.1| transcriptional regulator, CarD family [Thermosinus carboxydivorans
           Nor1]
          Length = 164

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 68/150 (45%)

Query: 16  TGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLSEA 75
            G+ +VYP HG G +  ++E EV G K  ++V+      M + +P  +    G+R +   
Sbjct: 4   VGDKVVYPMHGAGIVEALEEHEVLGKKQYYYVLTMFYGGMRVMIPQDQVGQSGLRAVVGE 63

Query: 76  HFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSYSE 135
             + +  +++          W+RR      KI SG ++ +AEVVR+L + +     S  E
Sbjct: 64  TEIAQVKEVLSASPEQDTGNWNRRINNSLTKIKSGSILEVAEVVRNLMKQEVTRRLSTGE 123

Query: 136 RQLYESALNRMVREIAAVNSISEPEAINLI 165
           R+L ++A   ++ E+              +
Sbjct: 124 RRLLDTAKQILISELVLACDKDVDSVEGWV 153


>gi|108760592|ref|YP_633761.1| transcriptional regulator CarD [Myxococcus xanthus DK 1622]
 gi|1022328|emb|CAA91224.1| carD [Myxococcus xanthus]
 gi|108464472|gb|ABF89657.1| transcriptional regulator CarD [Myxococcus xanthus DK 1622]
          Length = 316

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 51/175 (29%), Positives = 87/175 (49%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           +       G+ +VYP  GV  ++ I  +EVAG KL F  +  ++D   + VP GK + IG
Sbjct: 5   SASLQLAVGDRVVYPNQGVCRVSAIDVKEVAGQKLTFVTMRREEDGAVVMVPEGKVLAIG 64

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           +RK++ A  VE     +R  +      W +RA+    ++  G ++ +AEVV+ L      
Sbjct: 65  VRKVASAEDVEAIFTFLRSDSDKADLDWKQRARTNLDRMTQGGIMGLAEVVKGLQVLSEL 124

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSEN 183
                 ER+LY++A + +V E+AA    +E  A + I++ L     +  K T+  
Sbjct: 125 RPLPTKERELYDNARHLLVTEVAAALGTAEVNAEDAIDIVLFPPGRERPKRTAAE 179


>gi|291294864|ref|YP_003506262.1| CarD family transcriptional regulator [Meiothermus ruber DSM 1279]
 gi|290469823|gb|ADD27242.1| transcriptional regulator, CarD family [Meiothermus ruber DSM 1279]
          Length = 164

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 65/157 (41%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
             +R G+ +V P +GVG +  I ++ VAG    ++ + F   +    VPV       +R+
Sbjct: 2   SEYRPGDKVVLPPYGVGVVAGIAQRSVAGSDRAYYQVDFPGTRSKAYVPVEAPQTTRLRR 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                 V   L L++         W+ R ++    +  GD   IA +   L   + +   
Sbjct: 62  ALSPDQVNEILALLQEGRLPLPRQWAARHRKTTEILADGDPFRIATLAGQLRAWELEKGL 121

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
              +RQ    A++ +  EI+ V  I+  EA  L E  
Sbjct: 122 PDLDRQALRRAMHLLAEEISQVLEITLDEARKLFEEA 158


>gi|238062748|ref|ZP_04607457.1| transcription-repair coupling factor [Micromonospora sp. ATCC
           39149]
 gi|237884559|gb|EEP73387.1| transcription-repair coupling factor [Micromonospora sp. ATCC
           39149]
          Length = 1229

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 61/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        + G+H+V+  HG+G   E+ ++ V G   E+ V         ++  
Sbjct: 531 MPSRRRNTIDPLELKAGDHVVHEQHGIGRYVELVQRTVNGASREYLV---------IEYA 581

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+      M     Q+  A+         A++++
Sbjct: 582 PSKRGQPGDRLFVPTDQLDQLSRYVGGEQPTLHRMGGADWQKSKARARKAVKEIAAQLIQ 641

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    +++    ++     +        +  +  AI  ++ ++     
Sbjct: 642 LYAARKASKGHAFAPDSPWQR---ELEDAFPWQETPDQLAAIEEVKRDMEQTVP 692


>gi|294813058|ref|ZP_06771701.1| Transcriptional-repair coupling factor [Streptomyces clavuligerus
           ATCC 27064]
 gi|294325657|gb|EFG07300.1| Transcriptional-repair coupling factor [Streptomyces clavuligerus
           ATCC 27064]
          Length = 1206

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 61/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++        TG++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 516 MPTRRRKTIDPLTLETGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 566

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 567 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 626

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 627 LYSARMAAPGHAFGPDTPWQR---ELEDAFPYAETPDQLSTIAEVKEDMEKTVP 677


>gi|297624690|ref|YP_003706124.1| CarD family transcriptional regulator [Truepera radiovictrix DSM
           17093]
 gi|297165870|gb|ADI15581.1| transcriptional regulator, CarD family [Truepera radiovictrix DSM
           17093]
          Length = 168

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 69/157 (43%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
            ++ ++ G+ +V P +GVG +     + VAG    ++ + F        VPV      G+
Sbjct: 4   AQKTYKHGDQVVLPPYGVGVVAGTTVRTVAGTDHHYYEVEFPNGTSKAFVPVAAPQAAGL 63

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           R       V + L+ +          W+ R +     ++SGD   IA +  +L R D + 
Sbjct: 64  RPALTKAEVHKVLERLSNGRINLPKQWAARHRRVTEILSSGDPYQIATLGSELRRWDLER 123

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIE 166
                +RQ Y  AL  +  EI+AV  I+  EA  +++
Sbjct: 124 GLPDLDRQAYRRALRLLAGEISAVLGITPKEAREMMD 160


>gi|83308694|emb|CAJ01604.1| putative transcriptional factor regulator [Methylocapsa acidiphila]
          Length = 175

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 101/155 (65%), Positives = 123/155 (79%)

Query: 21  VYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLSEAHFVER 80
           VYPAHGVG I  I+EQ VAG KLE FVI+F KDKM LKVP  K   +GMRKL+EA  V++
Sbjct: 2   VYPAHGVGQIIAIEEQVVAGFKLELFVISFIKDKMILKVPTPKVASVGMRKLAEAGVVKK 61

Query: 81  ALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSYSERQLYE 140
           AL  + G+AR+KRTMWSRRAQEY+AKINSGDLIAIAEVVRDL+R+D+QPE+SYSERQLYE
Sbjct: 62  ALDTLAGRARIKRTMWSRRAQEYEAKINSGDLIAIAEVVRDLYRSDAQPEQSYSERQLYE 121

Query: 141 SALNRMVREIAAVNSISEPEAINLIEVNLSSKSSK 175
           +AL+RM REI  V  ++E E++ +IE  L     +
Sbjct: 122 AALDRMAREIVVVQKLTETESLKVIEGQLLKGPRR 156


>gi|55980137|ref|YP_143434.1| hypothetical protein TTHA0168 [Thermus thermophilus HB8]
 gi|55771550|dbj|BAD69991.1| conserved hypothetical protein [Thermus thermophilus HB8]
          Length = 164

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 70/161 (43%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           + FR G+ +V P +GVG +  I ++ V+G+   ++ + F   +    VPV     +G+RK
Sbjct: 2   KEFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRK 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                 V   L L++         W+ R ++    +  G+   IA++   L   + +   
Sbjct: 62  ALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGL 121

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
              +RQ    A++ +  E+A    I+  EA  L E     +
Sbjct: 122 PDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWGEE 162


>gi|15613946|ref|NP_242249.1| transcriptional factor [Bacillus halodurans C-125]
 gi|10173999|dbj|BAB05102.1| transcriptional factor [Bacillus halodurans C-125]
          Length = 164

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 38/164 (23%), Positives = 80/164 (48%), Gaps = 3/164 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+H+VYP HG G + +I+E+E+ G    +FV+ F    + + +P  +    G+RK+
Sbjct: 1   MFKIGDHVVYPFHGAGVVQDIEEKEILGETHSYFVLHFPLTDIKVMLPKHRIQQSGLRKV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE-- 130
            +   V+  +  ++          ++ +++ +  + SG +I  A ++  L +  ++    
Sbjct: 61  IDQSDVDHLIDALQKGPE-TPLSTNQFSKDTENLLKSGSIIDAAHLISGLAKKQAERTNG 119

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
               +R   + A   +  E+  V +ISE +A   I+ +L S S 
Sbjct: 120 LHIQDRNFLQKAKQFIASELIVVKNISEEQAYAFIDEHLPSPSE 163


>gi|326941362|gb|AEA17258.1| CarD-like transcriptional regulator [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 153

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/152 (26%), Positives = 81/152 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP  G G I  I+E+EV+G K +++VI      M L +P G+ ++  +R +
Sbjct: 1   MFQIGDNIVYPMQGAGIIKAIEEKEVSGEKQQYYVIKMSASNMELMIPAGRILNSNIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   +
Sbjct: 61  TDITALAHIMDIFQHGESDRLLTWKQRYKLNTDKIKTGKMQEGAEVVRDLMRIQKEKALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 121 ASEKKMLDNAYEFLISELGLIEGITENQIKSF 152


>gi|258509516|ref|YP_003172267.1| transcription-repair coupling factor [Lactobacillus rhamnosus GG]
 gi|257149443|emb|CAR88416.1| Transcription-repair coupling factor [Lactobacillus rhamnosus GG]
 gi|259650784|dbj|BAI42946.1| transcription-repair coupling factor [Lactobacillus rhamnosus GG]
          Length = 1175

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 18/162 (11%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G  T ++  EV G+  + ++    ++   L +PV +   +     
Sbjct: 494 ELKPGDYVVHVNHGIGQYTGMETLEVDGVHRD-YITIVYRNNDKLFIPVDQLNLVQKYVS 552

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +             GK      +     Q+    + +       E++    + +++   +
Sbjct: 553 A------------DGKTPNVNKLGGTEWQKTKRIVAARIEDIADELIDLYAKREAEKGYA 600

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +      +    +   E     +  +  +   I+ ++     
Sbjct: 601 FGPDDDLQ---QKFEDEFPYPETPDQLRSAKEIKRDMEKPKP 639


>gi|254388765|ref|ZP_05003997.1| transcriptional-repair coupling factor [Streptomyces clavuligerus
           ATCC 27064]
 gi|197702484|gb|EDY48296.1| transcriptional-repair coupling factor [Streptomyces clavuligerus
           ATCC 27064]
          Length = 1187

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 61/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++        TG++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 497 MPTRRRKTIDPLTLETGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 547

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 548 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 607

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 608 LYSARMAAPGHAFGPDTPWQR---ELEDAFPYAETPDQLSTIAEVKEDMEKTVP 658


>gi|46200120|ref|YP_005787.1| transcriptional regulator [Thermus thermophilus HB27]
 gi|46197748|gb|AAS82160.1| transcriptional regulator [Thermus thermophilus HB27]
          Length = 164

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 70/161 (43%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           + FR G+ +V P +GVG +  I ++ V+G+   ++ + F   +    VPV     +G+RK
Sbjct: 2   KEFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRK 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                 V   L L++         W+ R ++    +  G+   IA++   L   + +   
Sbjct: 62  ALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILAEGNPYRIAQMAGQLRAWEVERGL 121

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
              +RQ    A++ +  E+A    I+  EA  L E     +
Sbjct: 122 PDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWGEE 162


>gi|326441399|ref|ZP_08216133.1| transcription-repair coupling factor [Streptomyces clavuligerus
           ATCC 27064]
          Length = 1176

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 61/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++        TG++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 486 MPTRRRKTIDPLTLETGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 536

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 537 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 596

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 597 LYSARMAAPGHAFGPDTPWQR---ELEDAFPYAETPDQLSTIAEVKEDMEKTVP 647


>gi|218898740|ref|YP_002447151.1| transcriptional regulator, CarD family [Bacillus cereus G9842]
 gi|228902146|ref|ZP_04066310.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 4222]
 gi|228966545|ref|ZP_04127598.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|218545939|gb|ACK98333.1| transcriptional regulator, CarD family [Bacillus cereus G9842]
 gi|228793267|gb|EEM40817.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228857572|gb|EEN02068.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 4222]
          Length = 158

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/151 (26%), Positives = 80/151 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E++G K +++VI      M L +P G+  +  +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEISGEKQQYYVIKMSASNMELMIPAGRISNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALVHIMDIFQHGESDRLLTWKQRYKLNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAYEFLISELGLIEGITENQIKSF 157


>gi|228909469|ref|ZP_04073294.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 200]
 gi|228850246|gb|EEM95075.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 200]
          Length = 158

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 80/151 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E+AG K +++VI      M L +P G+  +  +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEIAGEKQQYYVIKMSASNMELMIPAGRISNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALVHIMDIFQHGESDRLLTWKQRYKLNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAYEFLISELGLIEGITENQIKSF 157


>gi|218294627|ref|ZP_03495481.1| transcriptional regulator, CarD family [Thermus aquaticus Y51MC23]
 gi|218244535|gb|EED11059.1| transcriptional regulator, CarD family [Thermus aquaticus Y51MC23]
          Length = 164

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/161 (22%), Positives = 69/161 (42%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           + FR G+ +V P +GVG +  I ++ ++G+   ++ + F   +    VPV     +GMRK
Sbjct: 2   KEFRPGDKVVLPPYGVGVVAGIAQRSISGVSRAYYQVDFPGSRSKAYVPVEAPQSVGMRK 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                 V   L L++         W+ R ++    +  G+   IA++   L   + +   
Sbjct: 62  ALSPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWELERGL 121

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
              +RQ    A+  +  E++    I+  EA  L E     +
Sbjct: 122 PDLDRQALRRAICLLAEEVSQTLEITVQEAKRLFEEAWGEE 162


>gi|229099195|ref|ZP_04230127.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-29]
 gi|229105347|ref|ZP_04235994.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-28]
 gi|229118208|ref|ZP_04247566.1| Transcriptional regulator, CarD [Bacillus cereus Rock1-3]
 gi|228665255|gb|EEL20739.1| Transcriptional regulator, CarD [Bacillus cereus Rock1-3]
 gi|228678059|gb|EEL32289.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-28]
 gi|228684176|gb|EEL38122.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-29]
          Length = 164

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 80/157 (50%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEEKEILGTSRQYCVIRILSKDMQVMLPMDQLQKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DKGTLNDILLEFQNGESDPSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V  +SE +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQDVSEHQATEFLQETIN 163


>gi|229191731|ref|ZP_04318708.1| Transcriptional regulator, CarD [Bacillus cereus ATCC 10876]
 gi|228591725|gb|EEK49567.1| Transcriptional regulator, CarD [Bacillus cereus ATCC 10876]
          Length = 158

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/151 (26%), Positives = 81/151 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E++G K +++VI      M L +P G+ ++  +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEISGEKQQYYVIKMSASNMELMIPTGRILNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALAHIMDIFQHGESDRLLTWKQRYKLNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAYEFLISELGLIEGITENQIKSF 157


>gi|191639457|ref|YP_001988623.1| Transcription-repair coupling factor (TRCF) [Lactobacillus casei
           BL23]
 gi|190713759|emb|CAQ67765.1| Transcription-repair coupling factor (TRCF) [Lactobacillus casei
           BL23]
 gi|205270976|emb|CAP07849.1| transcriptional-repair coupling factor [Lactobacillus casei BL23]
 gi|327383550|gb|AEA55026.1| Transcription-repair coupling factor [Lactobacillus casei LC2W]
 gi|327386742|gb|AEA58216.1| Transcription-repair coupling factor [Lactobacillus casei BD-II]
          Length = 1174

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 19/162 (11%), Positives = 58/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G  T ++  EV G+  + ++    ++   L +PV +   +     
Sbjct: 494 ELKPGDYVVHVNHGIGQYTGMETLEVDGVHRD-YITIVYRNNDKLFIPVDQLNLVQKYVS 552

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +             GK      +     Q+   K+ +       E++    + +++   +
Sbjct: 553 A------------DGKTPSVNKLGGAEWQKTKRKVAARIEDIADELIDLYAKREAEKGFA 600

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +      +   ++   E     +  +  +   I+ ++     
Sbjct: 601 FGPDDDLQ---HKFEAEFPYPETPDQLRSAKEIKHDMEKPKP 639


>gi|239630377|ref|ZP_04673408.1| transcription-repair coupling factor [Lactobacillus paracasei
           subsp. paracasei 8700:2]
 gi|239526660|gb|EEQ65661.1| transcription-repair coupling factor [Lactobacillus paracasei
           subsp. paracasei 8700:2]
          Length = 1174

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 19/162 (11%), Positives = 58/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G  T ++  EV G+  + ++    ++   L +PV +   +     
Sbjct: 494 ELKPGDYVVHVNHGIGQYTGMETLEVDGVHRD-YITIVYRNNDKLFIPVDQLNLVQKYVS 552

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +             GK      +     Q+   K+ +       E++    + +++   +
Sbjct: 553 A------------DGKTPSVNKLGGAEWQKTKRKVAARIEDIADELIDLYAKREAEKGFA 600

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +      +   ++   E     +  +  +   I+ ++     
Sbjct: 601 FGPDDDLQ---HKFEAEFPYPETPDQLRSAKEIKHDMEKPKP 639


>gi|315924877|ref|ZP_07921094.1| CarD family transcriptional regulator [Pseudoramibacter
           alactolyticus ATCC 23263]
 gi|315621776|gb|EFV01740.1| CarD family transcriptional regulator [Pseudoramibacter
           alactolyticus ATCC 23263]
          Length = 159

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 41/154 (26%), Positives = 83/154 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            +  G+ IVYP HG G I  I+E ++      ++ +    + M + +PV KA ++G+R++
Sbjct: 1   MYNIGDKIVYPMHGAGVIKNIQEMDIFEKTQMYYKVTIAAEGMEILIPVDKAEEVGLREI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                +E  L+++        + WS+R Q+   ++ SGD+I +A+V R+L   D +   S
Sbjct: 61  PTHQDLEAMLQVLSQPEDKMTSNWSKRYQDNMDQMKSGDIIDVAKVTRNLMLLDRRKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIE 166
             ++++  +A N ++ E+  ++   + EA  +IE
Sbjct: 121 SGDKKMLMTAKNFLISEMMLIDGKEKEEACKIIE 154


>gi|227533044|ref|ZP_03963093.1| transcription-repair coupling factor (TRCF) [Lactobacillus
           paracasei subsp. paracasei ATCC 25302]
 gi|227189445|gb|EEI69512.1| transcription-repair coupling factor (TRCF) [Lactobacillus
           paracasei subsp. paracasei ATCC 25302]
          Length = 1174

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 19/162 (11%), Positives = 58/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G  T ++  EV G+  + ++    ++   L +PV +   +     
Sbjct: 494 ELKPGDYVVHVNHGIGQYTGMETLEVDGVHRD-YITIVYRNNDKLFIPVDQLNLVQKYVS 552

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +             GK      +     Q+   K+ +       E++    + +++   +
Sbjct: 553 A------------DGKTPSVNKLGGAEWQKTKRKVAARIEDIADELIDLYAKREAEKGFA 600

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +      +   ++   E     +  +  +   I+ ++     
Sbjct: 601 FGPDDDLQ---HKFEAEFPYPETPDQLRSAKEIKHDMEKPKP 639


>gi|301067528|ref|YP_003789551.1| transcription-repair coupling factor (superfamily II helicase)
           [Lactobacillus casei str. Zhang]
 gi|300439935|gb|ADK19701.1| Transcription-repair coupling factor (superfamily II helicase)
           [Lactobacillus casei str. Zhang]
          Length = 1174

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 19/162 (11%), Positives = 58/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G  T ++  EV G+  + ++    ++   L +PV +   +     
Sbjct: 494 ELKPGDYVVHVNHGIGQYTGMETLEVDGVHRD-YITIVYRNNDKLFIPVDQLNLVQKYVS 552

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +             GK      +     Q+   K+ +       E++    + +++   +
Sbjct: 553 A------------DGKTPSVNKLGGAEWQKTKRKVAARIEDIADELIDLYAKREAEKGFA 600

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +      +   ++   E     +  +  +   I+ ++     
Sbjct: 601 FGPDDDLQ---HKFEAEFPYPETPDQLRSAKEIKHDMEKPKP 639


>gi|30021746|ref|NP_833377.1| CarD-like transcriptional regulator [Bacillus cereus ATCC 14579]
 gi|206969394|ref|ZP_03230349.1| transcriptional regulator, CarD family [Bacillus cereus AH1134]
 gi|218230882|ref|YP_002368460.1| transcriptional regulator, CarD family [Bacillus cereus B4264]
 gi|228953921|ref|ZP_04115959.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228959831|ref|ZP_04121505.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|229047328|ref|ZP_04192927.1| Transcriptional regulator, CarD [Bacillus cereus AH676]
 gi|229071154|ref|ZP_04204380.1| Transcriptional regulator, CarD [Bacillus cereus F65185]
 gi|229080862|ref|ZP_04213379.1| Transcriptional regulator, CarD [Bacillus cereus Rock4-2]
 gi|229111070|ref|ZP_04240629.1| Transcriptional regulator, CarD [Bacillus cereus Rock1-15]
 gi|229128920|ref|ZP_04257896.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-Cer4]
 gi|229146213|ref|ZP_04274588.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST24]
 gi|229151843|ref|ZP_04280042.1| Transcriptional regulator, CarD [Bacillus cereus m1550]
 gi|229179932|ref|ZP_04307278.1| Transcriptional regulator, CarD [Bacillus cereus 172560W]
 gi|296504148|ref|YP_003665848.1| CarD-like transcriptional regulator [Bacillus thuringiensis BMB171]
 gi|29897301|gb|AAP10578.1| CarD-like transcriptional regulator [Bacillus cereus ATCC 14579]
 gi|206736435|gb|EDZ53593.1| transcriptional regulator, CarD family [Bacillus cereus AH1134]
 gi|218158839|gb|ACK58831.1| transcriptional regulator, CarD family [Bacillus cereus B4264]
 gi|228603613|gb|EEK61088.1| Transcriptional regulator, CarD [Bacillus cereus 172560W]
 gi|228631656|gb|EEK88286.1| Transcriptional regulator, CarD [Bacillus cereus m1550]
 gi|228637272|gb|EEK93727.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST24]
 gi|228654625|gb|EEL10487.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-Cer4]
 gi|228672433|gb|EEL27718.1| Transcriptional regulator, CarD [Bacillus cereus Rock1-15]
 gi|228702440|gb|EEL54909.1| Transcriptional regulator, CarD [Bacillus cereus Rock4-2]
 gi|228712094|gb|EEL64043.1| Transcriptional regulator, CarD [Bacillus cereus F65185]
 gi|228724070|gb|EEL75416.1| Transcriptional regulator, CarD [Bacillus cereus AH676]
 gi|228799825|gb|EEM46768.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228805741|gb|EEM52322.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|296325200|gb|ADH08128.1| CarD-like transcriptional regulator [Bacillus thuringiensis BMB171]
          Length = 158

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 40/151 (26%), Positives = 81/151 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E++G K +++VI      M L +P G+ ++  +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEISGEKQQYYVIKMSASNMELMIPAGRILNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALAHIMDIFQHGESDRLLTWKQRYKLNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAYEFLISELGLIEGITENQIKSF 157


>gi|116495978|ref|YP_807712.1| transcription-repair coupling factor [Lactobacillus casei ATCC 334]
 gi|116106128|gb|ABJ71270.1| transcription-repair coupling factor [Lactobacillus casei ATCC 334]
          Length = 1174

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 19/162 (11%), Positives = 58/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G  T ++  EV G+  + ++    ++   L +PV +   +     
Sbjct: 494 ELKPGDYVVHVNHGIGQYTGMETLEVDGVHRD-YITIVYRNNDKLFIPVDQLNLVQKYVS 552

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +             GK      +     Q+   K+ +       E++    + +++   +
Sbjct: 553 A------------DGKTPSVNKLGGAEWQKTKRKVAARIEDIADELIDLYAKREAEKGFA 600

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +      +   ++   E     +  +  +   I+ ++     
Sbjct: 601 FGPDDDLQ---HKFEAEFPYPETPDQLRSAKEIKHDMEKPKP 639


>gi|227824939|ref|ZP_03989771.1| transcriptional regulator [Acidaminococcus sp. D21]
 gi|226905438|gb|EEH91356.1| transcriptional regulator [Acidaminococcus sp. D21]
          Length = 162

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 40/159 (25%), Positives = 84/159 (52%), Gaps = 2/159 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ ++YP HG   I +++++ + G ++++FV       M + VP G    +G+R +
Sbjct: 4   MFTVGDKVLYPMHGAAVIRDVEQKVIDGRQIDYFVFDMLLSNMKVMVPAGNVEKVGIRPI 63

Query: 73  SEAHFVERALKLVRGKA--RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
            +   + +  ++++ +   R+KR  W+RR   Y  K+ +G +  +A+VVR L   +   +
Sbjct: 64  VDKSVMPKVEEVLKARPENRMKRITWNRRYNMYIDKMKTGSIFEVADVVRTLAVQEEDKK 123

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
            S  ER+L  +A   ++ E+  V S+ E ++   +E  +
Sbjct: 124 LSTGERRLLSTAKQILLSEVMLVESVDEEKSEAWLEKFI 162


>gi|326778864|ref|ZP_08238129.1| transcription-repair coupling factor [Streptomyces cf. griseus
           XylebKG-1]
 gi|326659197|gb|EGE44043.1| transcription-repair coupling factor [Streptomyces cf. griseus
           XylebKG-1]
          Length = 1177

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 59/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ +         ++  
Sbjct: 487 MPARRRKTIDPLTLEVGDYIVHEQHGVGRYVEMVQRTVQGATREYLL---------VEYA 537

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +   +         A++++
Sbjct: 538 PAKRGQPGDRLYIPTDQLEQVTKYVGGEAPTLHRLGGADWTKTKQRAKKAVKEIAADLIK 597

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 598 LYSARMAAPGHAFGADTPWQR---ELEDAFPYAETPDQLSTIAEVKEDMEKTVP 648


>gi|228940730|ref|ZP_04103293.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228973650|ref|ZP_04134232.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980206|ref|ZP_04140520.1| Transcriptional regulator, CarD [Bacillus thuringiensis Bt407]
 gi|228779564|gb|EEM27817.1| Transcriptional regulator, CarD [Bacillus thuringiensis Bt407]
 gi|228786111|gb|EEM34108.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228818974|gb|EEM65036.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           berliner ATCC 10792]
          Length = 158

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 81/151 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+EV+G K +++VI      M L +P G+ ++  +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEVSGEKQQYYVIKMSASNMELMIPAGRILNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALAHIMDIFQHGESDRLLTWKQRYKLNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAYEFLISELGLIEGITENQIKSF 157


>gi|220904723|ref|YP_002480035.1| CarD family transcriptional regulator [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219869022|gb|ACL49357.1| transcriptional regulator, CarD family [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 171

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 80/158 (50%), Gaps = 3/158 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F   + +VYPA GVG I  I  Q + G+  +F+++    + + L VPV  A  +G+R L
Sbjct: 1   MFTPNDLVVYPAQGVGKIESIDSQTIGGIACDFYIVRIQANNVTLMVPVNNAAHVGLRTL 60

Query: 73  SEAHFVERALKLVR---GKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           +     ER L+ +R   GK       W+RR +EY  ++ S +L  + EV+R+L       
Sbjct: 61  TTTEEAERILEELRSSTGKVVHTGQNWNRRFREYSERLKSPELAVVTEVLRELLLIGRTK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEV 167
           E S+ ER+L E A+  +  E+A V  + E    + +  
Sbjct: 121 ELSFGERRLQEQAMGLVTGELAEVLKVEEDSLRDELLE 158


>gi|117929120|ref|YP_873671.1| transcription-repair coupling factor [Acidothermus cellulolyticus
           11B]
 gi|117649583|gb|ABK53685.1| transcription-repair coupling factor [Acidothermus cellulolyticus
           11B]
          Length = 1192

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 60/179 (33%), Gaps = 22/179 (12%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD-----KDKM 55
           +  ++++       R G+ +V+  HGVG    +  +E+ G   E+ VI +      +   
Sbjct: 501 LPSRRRKSIDPLELRPGDFVVHEQHGVGRFVGMATREIGGATREYLVIEYAPSRRGQPGD 560

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP      +      EA  ++R               W+RR      +         
Sbjct: 561 RLWVPTDSLDQVTRYVGGEAPTLDRI----------GGADWARR----KGRARKAVREIA 606

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           AE+++      + P  ++     ++     +      V +  +   I  ++ ++     
Sbjct: 607 AELIQLYSARMASPGHAFGPDTPWQR---ELEEAFPYVETPDQLRTIEEVKADMERPVP 662


>gi|182438215|ref|YP_001825934.1| putative transcriptional-repair coupling factor [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|178466731|dbj|BAG21251.1| putative transcriptional-repair coupling factor [Streptomyces
           griseus subsp. griseus NBRC 13350]
          Length = 1177

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 59/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ +         ++  
Sbjct: 487 MPARRRKTIDPLTLEVGDYIVHEQHGVGRYVEMVQRTVQGATREYLL---------VEYA 537

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +   +         A++++
Sbjct: 538 PAKRGQPGDRLYIPTDQLEQVTKYVGGEAPTLHRLGGADWTKTKQRAKKAVKEIAADLIK 597

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 598 LYSARMAAPGHAFGADTPWQR---ELEDAFPYAETPDQLSTIAEVKEDMEKTVP 648


>gi|303238352|ref|ZP_07324887.1| transcriptional regulator, CarD family [Acetivibrio cellulolyticus
           CD2]
 gi|302594056|gb|EFL63769.1| transcriptional regulator, CarD family [Acetivibrio cellulolyticus
           CD2]
          Length = 159

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/158 (26%), Positives = 79/158 (50%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            +  G+ IVYP HG G I  I+E+E+ G K  ++V+      M + +P      IG+R++
Sbjct: 1   MYNVGDRIVYPMHGAGIIESIEEREILGSKQSYYVVRIPIGDMKVMIPTKNVTGIGIREV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                 +R   ++  +     + W++R +E   KI SG++  +A+VVR L   + +   S
Sbjct: 61  ISERDADRVFSVLGAENNSANSNWNKRYRENMVKIKSGNIYEVADVVRSLMVREKEKGLS 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
             ER++  SA   ++ E+    +++  E   +I   L+
Sbjct: 121 TGERKMLSSAKQILISELVLAKNMNAIEIEKIISKFLN 158


>gi|163941254|ref|YP_001646138.1| CarD family transcriptional regulator [Bacillus weihenstephanensis
           KBAB4]
 gi|229012829|ref|ZP_04169997.1| Transcriptional regulator, CarD [Bacillus mycoides DSM 2048]
 gi|229061220|ref|ZP_04198570.1| Transcriptional regulator, CarD [Bacillus cereus AH603]
 gi|229134451|ref|ZP_04263264.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST196]
 gi|229168365|ref|ZP_04296090.1| Transcriptional regulator, CarD [Bacillus cereus AH621]
 gi|163863451|gb|ABY44510.1| transcriptional regulator, CarD family [Bacillus weihenstephanensis
           KBAB4]
 gi|228615191|gb|EEK72291.1| Transcriptional regulator, CarD [Bacillus cereus AH621]
 gi|228649072|gb|EEL05094.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST196]
 gi|228718091|gb|EEL69731.1| Transcriptional regulator, CarD [Bacillus cereus AH603]
 gi|228748431|gb|EEL98288.1| Transcriptional regulator, CarD [Bacillus mycoides DSM 2048]
          Length = 158

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 82/151 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP HG G I  I+E+E++G K +++VI      M + +P+GK +   +R ++
Sbjct: 7   FQIGDNIVYPMHGAGIIKAIEEKEISGEKRQYYVIKMSASNMEVMIPMGKILSSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DIKALTNIIDIFQHGESDRLLTWKQRYKLNTDKIKTGKIQEGAEVVRDLLRMQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITENQIKSF 157


>gi|75760996|ref|ZP_00741000.1| CarD-like transcriptional regulator [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|74491513|gb|EAO54725.1| CarD-like transcriptional regulator [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
          Length = 167

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 44/152 (28%), Positives = 83/152 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI      M + +P GK ++  +R +
Sbjct: 15  MFQIGDNIVYPMHGAGIIEAIEEKEFSGEKQQYYVIKMSISNMQVMIPTGKILNSNIRPV 74

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + + +   K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 75  TDILALKHIIHIFQHEESCKLLPWKQRHKVNTDKIKTGEIQEGAEVVRDLMRMKKEKTLN 134

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 135 TSEKKLLDDAYKFLVSELELIKGITENQIKSF 166


>gi|330465805|ref|YP_004403548.1| transcription-repair coupling factor [Verrucosispora maris
           AB-18-032]
 gi|328808776|gb|AEB42948.1| transcription-repair coupling factor [Verrucosispora maris
           AB-18-032]
          Length = 1232

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 61/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        R G+H+V+  HG+G   E+ ++ V G   E+ V         ++  
Sbjct: 535 MPSRRRNTIDPLELRAGDHVVHEQHGIGRYVELVQRTVNGASREYLV---------IEYA 585

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+      M     Q+  A+         A++++
Sbjct: 586 PSKRGQPGDRLFVPTDQLDQLSRYVGGEQPTLHKMGGSDWQKSKARARKAVKEIAAQLIQ 645

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    ++     ++     +        +  +  AI+ ++ ++     
Sbjct: 646 LYAARKASKGHNFGPDTPWQR---ELEDAFPWQETPDQLAAIDEVKRDMEQSVP 696


>gi|291445280|ref|ZP_06584670.1| transcriptional-repair coupling factor [Streptomyces roseosporus
           NRRL 15998]
 gi|291348227|gb|EFE75131.1| transcriptional-repair coupling factor [Streptomyces roseosporus
           NRRL 15998]
          Length = 1184

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 59/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ +         ++  
Sbjct: 494 MPARRRKTIDPLTLEVGDYIVHEQHGVGRYVEMVQRTVQGATREYLL---------VEYA 544

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +   +         A++++
Sbjct: 545 PAKRGQPGDRLYIPTDQLEQVTKYVGGEAPTLHRLGGADWTKTKQRAKKAVKEIAADLIK 604

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 605 LYSARMAAPGHAFGADTPWQR---ELEDAFPYAETPDQLSTIAEVKEDMEKTVP 655


>gi|89894787|ref|YP_518274.1| hypothetical protein DSY2041 [Desulfitobacterium hafniense Y51]
 gi|89334235|dbj|BAE83830.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 174

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/172 (24%), Positives = 86/172 (50%), Gaps = 3/172 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ ++YP +G G I  I+E+EV G+K +++++      M + +PVGKA D+G+R++
Sbjct: 1   MFQVGDKVLYPMYGAGIIDSIEEKEVLGVKGQYYLLNIPHVNMEIMIPVGKAEDLGIRQV 60

Query: 73  SEAHFVERALKLVRGKAR---VKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
             +  V+  L+          +  +           K+ SGD+   +E++RDL R  +  
Sbjct: 61  VNSEVVDDVLRFFFEGDTDPVMFESNNRFYRDINKKKMKSGDIYQESEIIRDLTRKSNLH 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTS 181
           +    +  +  +AL  +  EI  V  I   +A+ +++  ++    + EK  +
Sbjct: 121 KLGMEDNNMLHTALQLVTSEIVQVKGIEMEKAVEMLQSVINQAKEEKEKQEA 172


>gi|297559048|ref|YP_003678022.1| transcription-repair coupling factor [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296843496|gb|ADH65516.1| transcription-repair coupling factor [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 1201

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 61/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        + G+++V+  HGVG   E+  ++V G   E+ +         ++  
Sbjct: 504 MPSRRRGTVDPLQLKPGDYVVHEQHGVGRYLEMVSRQVQGATREYLL---------IEYA 554

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +    + V G+A     M      +  ++          +++R
Sbjct: 555 PSKRGQPGDRLFVPTEQLGEVTRYVGGEAPTLSKMGGAEWSKAKSRARKVVREIAGDLIR 614

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +      V +  +  AI+ ++ ++S    
Sbjct: 615 LYSARQASPGHAFGPDTPWQR---ELEDAFPYVETPDQLAAIDEVKKDMSRSVP 665


>gi|320449429|ref|YP_004201525.1| transcriptional regulator [Thermus scotoductus SA-01]
 gi|320149598|gb|ADW20976.1| transcriptional regulator [Thermus scotoductus SA-01]
          Length = 164

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 69/161 (42%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           + FR G+ +V P +GVG +  I ++ V+G+   ++ + F   +    VPV     +GMRK
Sbjct: 2   KEFRPGDKVVLPPYGVGVVAGIAQRSVSGISRAYYQVDFPGSRSKAYVPVEAPQSVGMRK 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                 V   L L++         W+ R ++    +  G+   IA++   L   + +   
Sbjct: 62  ALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWELERGL 121

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
              +RQ    A+  +  E++    I+  EA  L E     +
Sbjct: 122 PDLDRQALRRAIYLLAEEVSQTLEITVQEAKRLFEEAWGEE 162


>gi|239941833|ref|ZP_04693770.1| putative transcriptional-repair coupling factor [Streptomyces
           roseosporus NRRL 15998]
 gi|239988293|ref|ZP_04708957.1| putative transcriptional-repair coupling factor [Streptomyces
           roseosporus NRRL 11379]
          Length = 1177

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 59/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ +         ++  
Sbjct: 487 MPARRRKTIDPLTLEVGDYIVHEQHGVGRYVEMVQRTVQGATREYLL---------VEYA 537

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +   +         A++++
Sbjct: 538 PAKRGQPGDRLYIPTDQLEQVTKYVGGEAPTLHRLGGADWTKTKQRAKKAVKEIAADLIK 597

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 598 LYSARMAAPGHAFGADTPWQR---ELEDAFPYAETPDQLSTIAEVKEDMEKTVP 648


>gi|328951535|ref|YP_004368870.1| transcriptional regulator, CarD family [Marinithermus
           hydrothermalis DSM 14884]
 gi|328451859|gb|AEB12760.1| transcriptional regulator, CarD family [Marinithermus
           hydrothermalis DSM 14884]
          Length = 164

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 37/158 (23%), Positives = 68/158 (43%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           + +R G+ +V P +GVG +  I ++ VAG+   ++ + F   +    VPV     +G+R 
Sbjct: 2   KQYRPGDKVVLPPYGVGVVAGIAKRTVAGVGRSYYQVEFPGTRSKAFVPVESPGQVGLRP 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                 V   L+ ++         W+ R +     +  GD   IA +   L R + +   
Sbjct: 62  ALSREEVGEILERLKNGRVSLPKQWAARHRRVTEILAEGDPYRIAVLAGQLRRWEVERGL 121

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
              +RQ +  A+N +  E++    I+  EA  L E   
Sbjct: 122 PDLDRQAFRRAVNLLAEEVSQALEITVEEARQLFEDAW 159


>gi|40062705|gb|AAR37618.1| transcriptional regulator, CarD family [uncultured marine bacterium
           314]
          Length = 223

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 64/173 (36%), Positives = 102/173 (58%), Gaps = 6/173 (3%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
              ++ +   +++VYP HGVG I  I + ++  + + F+ +  +K+K+ L +P+      
Sbjct: 53  PNEKKLYNVKDYVVYPKHGVGKIISIDKAKMGDIDITFYKVLIEKEKLTLSIPIN--QQS 110

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRT-D 126
            +R +S    + +A  +++ K R+KRTMWSRRAQEYD KINSG L  +AEVVRDL++  D
Sbjct: 111 HLRHVSSISQINKAASILKSKPRIKRTMWSRRAQEYDQKINSGKLYELAEVVRDLNKKTD 170

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
              E+SYSERQL+E A NR+  E+  V      +A   ++  L  K +  +K 
Sbjct: 171 IIAEQSYSERQLFEKAYNRLKSELEVVLG---EKAQQKMDKALKFKENSLQKE 220


>gi|228922354|ref|ZP_04085661.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228837409|gb|EEM82743.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 158

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 81/151 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E++G K +++VI      M L +P GK ++  +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEISGEKQQYYVIKMSASNMELMIPAGKILNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALAHIMDIFQHGESDRLLTWKQRYKLNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAYEFLISELGLIEGITENQIKSF 157


>gi|229018847|ref|ZP_04175694.1| Transcriptional regulator, CarD [Bacillus cereus AH1273]
 gi|229025088|ref|ZP_04181515.1| Transcriptional regulator, CarD [Bacillus cereus AH1272]
 gi|228736198|gb|EEL86766.1| Transcriptional regulator, CarD [Bacillus cereus AH1272]
 gi|228742468|gb|EEL92621.1| Transcriptional regulator, CarD [Bacillus cereus AH1273]
          Length = 158

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 82/151 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP HG G I  I+E+E++G K +++VI      M + +P+GK ++  +R ++
Sbjct: 7   FQIGDNIVYPMHGAGIIKAIEEKEISGEKQQYYVIKMSASNMEVMIPMGKILNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  TLKALTHIIDVFQHGESDRLLTWKQRYKLNTDKIKTGKIQEGAEVVRDLLRMQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITENQIKSF 157


>gi|257057197|ref|YP_003135029.1| transcription-repair coupling factor Mfd [Saccharomonospora viridis
           DSM 43017]
 gi|256587069|gb|ACU98202.1| transcription-repair coupling factor Mfd [Saccharomonospora viridis
           DSM 43017]
          Length = 1199

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 62/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        ++G+++V+  HG+G   E+  + V G   E+ V         ++  
Sbjct: 497 MPSRRRNAVDPLALKSGDYVVHDQHGIGRFVEMVRRTVGGATREYLV---------IEYA 547

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       ++   + V G+      M     ++  A+         AE+V+
Sbjct: 548 PSKRGHPGDRLFVPTDQLDEVSRYVGGETPTLNKMGGADWKKTKARARKAVKEIAAELVQ 607

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++S    ++     +        +  +  AI+ ++ ++     
Sbjct: 608 LYAARQAAPGHAFSPDTPWQR---ELEDAFPFTETADQLAAIDEVKRDMERDVP 658


>gi|328882973|emb|CCA56212.1| Transcription-repair coupling factor [Streptomyces venezuelae ATCC
           10712]
          Length = 1221

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 61/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ +         ++  
Sbjct: 531 MPAKRRKTIDPLTLEVGDYIVHEQHGVGRYVEMVQRTVQGATREYLL---------VEYA 581

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 582 PAKRGQPGDRLYIPTDQLEQVTKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 641

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  +++    ++     +        +  +   I  ++ ++     
Sbjct: 642 LYSARMAAPGHAFAPDTPWQR---ELEDAFPYAETPDQLSTIAEVKEDMEKTVP 692


>gi|312793424|ref|YP_004026347.1| CarD family transcriptional regulator [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312876058|ref|ZP_07736047.1| transcriptional regulator, CarD family [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311797256|gb|EFR13596.1| transcriptional regulator, CarD family [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|312180564|gb|ADQ40734.1| transcriptional regulator, CarD family [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 168

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 38/161 (23%), Positives = 79/161 (49%), Gaps = 4/161 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            ++ G+ I++P HG G I EI E++V     +++V+    + M + VPV  A +IG+R +
Sbjct: 1   MYKVGDTIIHPLHGAGRIVEIVEEKVFDSVQKYYVVKILYNGMKVLVPVKSASEIGIRNV 60

Query: 73  SEAHFVERALKLVRG----KARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
                  R  +L++             +++R +E   K+ SG++  + EV++ L   +  
Sbjct: 61  ISEEEANRVFELLKDNSFKVDINSCGNYNKRIRENQQKLKSGNIYCVVEVLKMLAMREKV 120

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
              S +E+ ++ +A   +V E+     I+  E   +++  L
Sbjct: 121 KGLSTNEKMMFNTAKQILVSELGLAKGIAIEEVERMVDSIL 161


>gi|282866318|ref|ZP_06275364.1| transcription-repair coupling factor [Streptomyces sp. ACTE]
 gi|282558904|gb|EFB64460.1| transcription-repair coupling factor [Streptomyces sp. ACTE]
          Length = 1176

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 61/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++       + G++IV+  HGVG   E+ ++ V G   E+ +         ++  
Sbjct: 486 MPARRRKSIDPLTLQAGDYIVHEQHGVGRYIEMVQRTVQGATREYLL---------VEYA 536

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +   +         A++++
Sbjct: 537 PAKRGQPGDRLYIPTDQLEQVTKYVGGEAPTLHRLGGADWTKTKQRAKKAVKEIAADLIK 596

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  +++    ++     +        +  +   I  ++ ++     
Sbjct: 597 LYSARMAAPGHTFAPDTPWQR---ELEDAFPYAETPDQLSTIAEVKEDMEKSVP 647


>gi|15616497|ref|NP_244803.1| transcriptional regulator [Bacillus halodurans C-125]
 gi|10176560|dbj|BAB07654.1| transcriptional regulator [Bacillus halodurans C-125]
          Length = 153

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 40/152 (26%), Positives = 78/152 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+H+VYP HG G I  I+E+E+AG + ++FVI    + M + +P  K     +R +
Sbjct: 1   MFQIGDHVVYPMHGAGIIKAIEEKEIAGERKQYFVIKMSINNMDVMIPADKISSTNIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   +++ + + +     +   W  R +    K+ +G +   AEVVRDL R   +   +
Sbjct: 61  TDLTALKQIIHIFQHGESEQLLPWKERYKMNADKMKTGHIQEGAEVVRDLMRIKKEKALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++ + A   +  E+  +  I+E    + 
Sbjct: 121 PSEKKMLDDAREFLNSELGLIEGITENHIKSF 152


>gi|224368792|ref|YP_002602953.1| transcriptional regulator (CarD family protein) [Desulfobacterium
           autotrophicum HRM2]
 gi|223691508|gb|ACN14791.1| transcriptional regulator (CarD family protein) [Desulfobacterium
           autotrophicum HRM2]
          Length = 153

 Score =  111 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 45/151 (29%), Positives = 85/151 (56%), Gaps = 1/151 (0%)

Query: 21  VYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLSEAHFVER 80
           VYPAHGVG I  I+ +E+ G  + F+++    + M + +P      +G+R++ +   V  
Sbjct: 3   VYPAHGVGCIESIESKEINGENMNFYMMKIVDNGMVIMIPTANVESVGLREVIKQKDVPE 62

Query: 81  ALKLVRGK-ARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSYSERQLY 139
             ++++ K   + +  W+RR +EY  KI +G +  IAEV RDL +   + + S+ ER+L 
Sbjct: 63  VYRIMQEKGPDLDKQTWNRRYREYMDKIKTGSIYDIAEVFRDLFQLKLEKDLSFGERKLL 122

Query: 140 ESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           ++A N +V+E++   ++ E   +  IE   +
Sbjct: 123 DTAQNLLVQELSMAKNMDEAAMMTEIEQLFN 153


>gi|163942446|ref|YP_001647330.1| CarD family transcriptional regulator [Bacillus weihenstephanensis
           KBAB4]
 gi|163864643|gb|ABY45702.1| transcriptional regulator, CarD family [Bacillus weihenstephanensis
           KBAB4]
          Length = 159

 Score =  111 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 44/158 (27%), Positives = 81/158 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R +
Sbjct: 1   MFQIGDKIVYPMHGAGIIEAIEEKEILGTTRQYCVIRIISKDMQVMLPINQLQKSGIRYI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++  L             W +R      K+ +G+L   AEVVRDL R + +   +
Sbjct: 61  VDKGTLDGILLEFHHGESDPSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            SE+Q+ ++A   ++ E+A V ++SE +A   ++  ++
Sbjct: 121 ASEKQMLDNARKMVISEVALVQNVSEHQATEFLQDTIN 158


>gi|228923471|ref|ZP_04086756.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228836197|gb|EEM81553.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 164

 Score =  111 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 83/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEEKEILGTSRQYCVIRIISKDMQVMLPMDQLKKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L+  AEVVRDL R + +   + 
Sbjct: 67  DRGTLDDILLEFQNGESDPSLSWKQRYTMNMEKMKNGNLLDSAEVVRDLLRRNKERTLNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V ++SE +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVSEHQATEYLQDTIN 163


>gi|222529236|ref|YP_002573118.1| CarD family transcriptional regulator [Caldicellulosiruptor bescii
           DSM 6725]
 gi|312622517|ref|YP_004024130.1| CarD family transcriptional regulator [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|222456083|gb|ACM60345.1| transcriptional regulator, CarD family [Caldicellulosiruptor bescii
           DSM 6725]
 gi|312202984|gb|ADQ46311.1| transcriptional regulator, CarD family [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 168

 Score =  111 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 79/161 (49%), Gaps = 4/161 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            ++ G+ I++P HG G I EI E++V     +++V+    + M + VPV  A +IG+R +
Sbjct: 1   MYKVGDTIIHPLHGAGRIVEIVEEKVFDSVQKYYVVKILYNGMKVLVPVKSASEIGIRNV 60

Query: 73  SEAHFVERALKLVRG----KARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
                  R  +L++             +++R +E   K+ SG++  + EV++ L   +  
Sbjct: 61  ISEEEANRVFELLKDNSFKVDINGCGNYNKRIRENQQKLKSGNIYCVVEVLKMLAMREKV 120

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
              S +E+ ++ +A   +V E+     ++  E   +++  L
Sbjct: 121 KGLSTNEKMMFNTAKQILVSELGLAKGLAIEEVERMVDNIL 161


>gi|297193946|ref|ZP_06911344.1| transcriptional-repair coupling factor [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|297152012|gb|EFH31470.1| transcriptional-repair coupling factor [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 1070

 Score =  111 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 62/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ +         ++  
Sbjct: 380 MPTRRRKTIDPLTLEAGDYIVHEQHGVGRYLEMVQRTVQGATREYLL---------VEYA 430

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 431 PAKRGQPGDRLYIPTDQLEQVTKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 490

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +    A V +  +   I  ++ ++     
Sbjct: 491 LYSARMAAPGHAFGPDTPWQR---ELEDAFAYVETPDQLSTIAEVKEDMEKTVP 541


>gi|228994492|ref|ZP_04154342.1| Transcriptional regulator, CarD [Bacillus pseudomycoides DSM 12442]
 gi|228765250|gb|EEM13954.1| Transcriptional regulator, CarD [Bacillus pseudomycoides DSM 12442]
          Length = 167

 Score =  111 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/148 (27%), Positives = 81/148 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI      M + +P GK +   +R +
Sbjct: 15  MFQIGDNIVYPMHGAGIIEAIEEKEFSGEKQQYYVIKMSISNMQVLIPTGKILSSSIRPV 74

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + +     +   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 75  TDILALKHIIHIFQHGESDRLLPWKQRYKVNTDKIKTGEIQEGAEVVRDLMRMKKEKALN 134

Query: 133 YSERQLYESALNRMVREIAAVNSISEPE 160
            SE+++ ++A   ++ E+  +  I+E +
Sbjct: 135 TSEKKMLDNAHEFLISELGLIKGITENQ 162


>gi|312127692|ref|YP_003992566.1| CarD family transcriptional regulator [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777711|gb|ADQ07197.1| transcriptional regulator, CarD family [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 168

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 79/161 (49%), Gaps = 4/161 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            ++ G+ I++P HG G I EI E++V     +++V+    + M + VPV  A +IG+R +
Sbjct: 1   MYKVGDTIIHPLHGAGRIVEIVEEKVFDSVQKYYVVKILYNGMKVLVPVKSASEIGIRNV 60

Query: 73  SEAHFVERALKLVRG----KARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
                  R  +L++             +++R +E   K+ SG++  + EV++ L   +  
Sbjct: 61  ISEEEANRVFELLKDNSFKVDINGCGNYNKRIRENQQKLKSGNIYCVVEVLKMLAMREKV 120

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
              S +E+ ++ +A   +V E+     ++  E   +++  L
Sbjct: 121 KGLSTNEKMMFNTAKQILVSELGLAKGLAIEEVERMVDSIL 161


>gi|228901595|ref|ZP_04065773.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 4222]
 gi|228908832|ref|ZP_04072664.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 200]
 gi|228850842|gb|EEM95664.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 200]
 gi|228858007|gb|EEN02489.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 4222]
          Length = 158

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 44/152 (28%), Positives = 83/152 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI      M + +P GK ++  +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGEKQQYYVIKMSISNMQVMIPTGKILNSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + + +   K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  TDILALKHIIHIFQHEESCKLLPWKQRHKVNTDKIKTGEIQEGAEVVRDLMRMKKEKTLN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDAYKFLVSELELIKGITENQIKSF 157


>gi|229031301|ref|ZP_04187307.1| Transcriptional regulator, CarD [Bacillus cereus AH1271]
 gi|228730059|gb|EEL81033.1| Transcriptional regulator, CarD [Bacillus cereus AH1271]
          Length = 158

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 80/151 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E+AG K +++VI      M + +P G+ +   +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEIAGKKQQYYVIKMSGSNMEVMIPAGRILSSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   L + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITAIAHILNIFQHGESDRLLTWKQRYKLNTDKIKTGKIQEGAEVVRDLLRMQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITESQIKSF 157


>gi|30022787|ref|NP_834418.1| CarD family transcriptional regulator [Bacillus cereus ATCC 14579]
 gi|229129995|ref|ZP_04258959.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-Cer4]
 gi|29898346|gb|AAP11619.1| CarD-like transcriptional regulator [Bacillus cereus ATCC 14579]
 gi|228653439|gb|EEL09313.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-Cer4]
          Length = 164

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEEKEILGTSRQYCVIRIISKDMQVMLPMDQLKKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DRGTLDDILLEFQNGESDPSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERTLNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V ++SE +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVSEHQATEFLQDTIN 163


>gi|302340584|ref|YP_003805790.1| transcriptional regulator, CarD family [Spirochaeta smaragdinae DSM
           11293]
 gi|301637769|gb|ADK83196.1| transcriptional regulator, CarD family [Spirochaeta smaragdinae DSM
           11293]
          Length = 171

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 47/159 (29%), Positives = 78/159 (49%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+  +H+VYP  GVG IT+I+E+ + G K  ++VI  +   M + +P  K  + G+R + 
Sbjct: 13  FKVNQHVVYPLQGVGIITDIQERVLKGKKTLYYVIYLELSDMTVMIPTDKTDERGIRAIV 72

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
                E+AL+L+  +       W  R Q     + SG +  IA VVR L+      E   
Sbjct: 73  PKEEAEKALQLISEEYEPVTADWKMRYQMNLDLLRSGSINDIATVVRALYHRSKVKELPI 132

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            ER+LY+ A+  ++ E+       + +   LI   L S+
Sbjct: 133 QERKLYDDAMKILIDEVTCSLGKKKSDVEELIFERLESE 171


>gi|229135557|ref|ZP_04264340.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST196]
 gi|229169450|ref|ZP_04297156.1| Transcriptional regulator, CarD [Bacillus cereus AH621]
 gi|228614008|gb|EEK71127.1| Transcriptional regulator, CarD [Bacillus cereus AH621]
 gi|228647899|gb|EEL03951.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST196]
          Length = 162

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 81/157 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 5   FQIGDKIVYPMHGAGIIEAIEEKEILGTTRQYCVIRIISKDMQVMLPINQLQKSGIRYIV 64

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L             W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 65  DKGTLDGILLEFHHGESDPSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 124

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   ++ E+A V ++SE +A   ++  ++
Sbjct: 125 SEKQMLDNARKMVISEVALVQNVSEHQATEFLQDTIN 161


>gi|75758584|ref|ZP_00738703.1| CarD-like transcriptional regulator [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|74493930|gb|EAO57027.1| CarD-like transcriptional regulator [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
          Length = 167

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 44/152 (28%), Positives = 81/152 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K ++FVI      M + +P GK ++  +R +
Sbjct: 15  MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQQYFVIKMSISNMQVMIPTGKILNSNIRPV 74

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++  + +   +   K   W +R +    K+ +G++   AEVVRDL R   +   +
Sbjct: 75  IDILALKHIIHIFHHEESCKLLPWKQRHKVNTDKVKTGEIQEGAEVVRDLMRMKKEKALN 134

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 135 TSEKKLLDDAYRFLVSELELIKGITENQIKSF 166


>gi|219669222|ref|YP_002459657.1| CarD family transcriptional regulator [Desulfitobacterium hafniense
           DCB-2]
 gi|219539482|gb|ACL21221.1| transcriptional regulator, CarD family [Desulfitobacterium
           hafniense DCB-2]
          Length = 174

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 86/172 (50%), Gaps = 3/172 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ ++YP +G G I  I+E+EV G+K +++++      M + +PVGKA D+G+R++
Sbjct: 1   MFQVGDKVLYPMYGAGIIDSIEEKEVLGVKGQYYLLNIPHVNMEIMIPVGKAEDLGIRQV 60

Query: 73  SEAHFVERALKLVRGKAR---VKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
             +  V+  L+          +  +           K+ SGD+   +E++RDL R  +  
Sbjct: 61  VNSEVVDDVLRFFFEGDTDPVMFESNNRFYRDINKKKMKSGDIYQESEIIRDLTRKSNLH 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKSTS 181
           +    +  +  +AL  +  EI  V  +   +A+ +++  ++    + EK  +
Sbjct: 121 KLGMEDNNMLHTALQLVTSEIVQVKGVEMEKAVEMLQSVINQAKDEKEKQEA 172


>gi|218235392|ref|YP_002369513.1| transcriptional regulator, CarD family [Bacillus cereus B4264]
 gi|228960989|ref|ZP_04122619.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|229112178|ref|ZP_04241720.1| Transcriptional regulator, CarD [Bacillus cereus Rock1-15]
 gi|229152915|ref|ZP_04281097.1| Transcriptional regulator, CarD [Bacillus cereus m1550]
 gi|218163349|gb|ACK63341.1| transcriptional regulator, CarD family [Bacillus cereus B4264]
 gi|228630528|gb|EEK87175.1| Transcriptional regulator, CarD [Bacillus cereus m1550]
 gi|228671294|gb|EEL26596.1| Transcriptional regulator, CarD [Bacillus cereus Rock1-15]
 gi|228798706|gb|EEM45689.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 164

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEEKEILGTSRQYCVIRIISKDMQVMLPMDQLKKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DRGTLDDILLEFQNGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERTLNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V ++SE +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVSEHQATEFLQDTIN 163


>gi|297200238|ref|ZP_06917635.1| transcription-repair coupling factor [Streptomyces sviceus ATCC
           29083]
 gi|197717008|gb|EDY61042.1| transcription-repair coupling factor [Streptomyces sviceus ATCC
           29083]
          Length = 1190

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 500 MPARRRKTIDPLTLEAGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 550

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 551 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 610

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 611 LYSARMAAPGHTFGPDTPWQR---ELEDAFPYAETPDQLTTIAEVKEDMEKSVP 661


>gi|229080349|ref|ZP_04212874.1| Transcriptional regulator, CarD [Bacillus cereus Rock4-2]
 gi|228703018|gb|EEL55479.1| Transcriptional regulator, CarD [Bacillus cereus Rock4-2]
          Length = 156

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/152 (28%), Positives = 79/152 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K  ++VI      M + +P GK +   +R +
Sbjct: 4   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQLYYVIKMSISNMQIMIPKGKILSSNIRPV 63

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   + R + + +     +   W +R +    KI +G++   AEV+RDL R   +   +
Sbjct: 64  IDILTLTRIIHIFQHGESGELMPWKQRYKVNTDKIKTGEIQEGAEVIRDLIRIKKEKALN 123

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 124 TSEKKLLDDAYKFLVSELELIKGITEKQIKSF 155


>gi|89893788|ref|YP_517275.1| hypothetical protein DSY1042 [Desulfitobacterium hafniense Y51]
 gi|219668161|ref|YP_002458596.1| CarD family transcriptional regulator [Desulfitobacterium hafniense
           DCB-2]
 gi|89333236|dbj|BAE82831.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219538421|gb|ACL20160.1| transcriptional regulator, CarD family [Desulfitobacterium
           hafniense DCB-2]
          Length = 161

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/160 (25%), Positives = 82/160 (51%), Gaps = 2/160 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ I YP +G G I  IKE+EV G K  ++ +     K+ + +P+ +  DIG+R++
Sbjct: 1   MFQVGDKIFYPLYGAGIIEAIKEKEVLGKKQFYYFLNIPHIKLKIMIPIERTHDIGIREV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQE--YDAKINSGDLIAIAEVVRDLHRTDSQPE 130
            +   ++  L  +        +  ++R +     +KI +GD+    EV+RDL R     +
Sbjct: 61  VKPDVLQHVLDDLYNGTTDPLSDNNQRYRRDMNKSKIKTGDIYKGTEVIRDLMRKSKVKK 120

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            S  ++ + E+AL  +  E   V  + + +A++L+   ++
Sbjct: 121 LSAEDKAMLENALQILTSEFIQVRGVCKEQAVHLLNEVIN 160


>gi|228905590|ref|ZP_04069538.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 4222]
 gi|228854065|gb|EEM98775.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 4222]
          Length = 158

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/152 (26%), Positives = 82/152 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI      M + +P GK +   +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQQYYVIKMSIRNMQVMIPTGKILSSSIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + +     +   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  TDILALKHIIHIFQHGESDRLLPWKQRHKVNTDKIKTGEIQEGAEVVRDLMRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            S++++ ++A   ++ E+  +  I+E +  + 
Sbjct: 126 TSDKKMLDNAHEFLISELGLIKGITENQIKSF 157


>gi|206969561|ref|ZP_03230515.1| transcriptional regulator, CarD family [Bacillus cereus AH1134]
 gi|228954994|ref|ZP_04117011.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|229147285|ref|ZP_04275636.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST24]
 gi|229181033|ref|ZP_04308368.1| Transcriptional regulator, CarD [Bacillus cereus 172560W]
 gi|296505181|ref|YP_003666881.1| CarD family transcriptional regulator [Bacillus thuringiensis
           BMB171]
 gi|206735249|gb|EDZ52417.1| transcriptional regulator, CarD family [Bacillus cereus AH1134]
 gi|228602590|gb|EEK60076.1| Transcriptional regulator, CarD [Bacillus cereus 172560W]
 gi|228636186|gb|EEK92665.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST24]
 gi|228804721|gb|EEM51323.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|296326233|gb|ADH09161.1| CarD family transcriptional regulator [Bacillus thuringiensis
           BMB171]
          Length = 164

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEEKEILGTSRQYCVIRIISKDMQVMLPMDQLKKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DRGTLDDILLEFQNGESDPSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERTLNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V +++E +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVTEHQATEFLQDTIN 163


>gi|218898141|ref|YP_002446552.1| transcriptional regulator, CarD family [Bacillus cereus G9842]
 gi|218543299|gb|ACK95693.1| transcriptional regulator, CarD family [Bacillus cereus G9842]
          Length = 153

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/152 (28%), Positives = 83/152 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI      M + +P GK ++  +R +
Sbjct: 1   MFQIGDNIVYPMHGAGIIEAIEEKEFSGEKQQYYVIKMSISNMQVMIPTGKILNSNIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + + +   K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 61  TDILALKHIIHIFQHEKSCKLLPWKQRHKVNTDKIKTGEIQEGAEVVRDLMRMKKEKTLN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 121 TSEKKLLDDAYKFLVSELELIKGITENQIKSF 152


>gi|229007995|ref|ZP_04165557.1| Transcriptional regulator, CarD [Bacillus mycoides Rock1-4]
 gi|228753269|gb|EEM02745.1| Transcriptional regulator, CarD [Bacillus mycoides Rock1-4]
          Length = 167

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/148 (28%), Positives = 81/148 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI      M + +P GK +   +R +
Sbjct: 15  MFQIGDNIVYPMHGAGIIEAIEEKEFSGEKQQYYVIKMSISNMQVLIPTGKILSSSIRPV 74

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + +     +   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 75  TDILALKHIIHIFQHGESDRLLPWKQRYKVNTDKIKTGEIQEGAEVVRDLMRMKKEKALN 134

Query: 133 YSERQLYESALNRMVREIAAVNSISEPE 160
            SE+++ E+A   ++ E+  +  I+E +
Sbjct: 135 TSEKKMLENAHEFLISELGLIKGITENQ 162


>gi|320010356|gb|ADW05206.1| transcription-repair coupling factor [Streptomyces flavogriseus
           ATCC 33331]
          Length = 1176

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 59/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++       + G+ IV+  HGVG   E+ ++ V G   E+ +         ++  
Sbjct: 486 MPARRRKSIDPLTLQAGDFIVHEQHGVGRYIEMVQRTVQGATREYLL---------VEYA 536

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +   +         A++++
Sbjct: 537 PAKRGQPGDRLYIPTDQLEQVTKYVGGEAPTLHRLGGADWTKTKQRAKKAVKEIAADLIK 596

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 597 LYSARMAAPGHAFGPDTPWQR---ELEDAFPYAETPDQLSTIAEVKEDMEKSVP 647


>gi|229013922|ref|ZP_04171049.1| Transcriptional regulator, CarD [Bacillus mycoides DSM 2048]
 gi|229062401|ref|ZP_04199717.1| Transcriptional regulator, CarD [Bacillus cereus AH603]
 gi|228716872|gb|EEL68559.1| Transcriptional regulator, CarD [Bacillus cereus AH603]
 gi|228747392|gb|EEL97268.1| Transcriptional regulator, CarD [Bacillus mycoides DSM 2048]
          Length = 162

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 81/157 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 5   FQIGDKIVYPMHGAGIIEAIEEKEILGTTRQYCVIRIISKDMQVMLPMNQLQKSGIRYIV 64

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L             W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 65  DKGTLDGILLEFHHGESDPSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 124

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   ++ E+A V ++SE +A   ++  ++
Sbjct: 125 SEKQMLDNARKMVISEVALVQNVSEHQATEFLQDTIN 161


>gi|229019949|ref|ZP_04176742.1| Transcriptional regulator, CarD [Bacillus cereus AH1273]
 gi|229026183|ref|ZP_04182547.1| Transcriptional regulator, CarD [Bacillus cereus AH1272]
 gi|228735111|gb|EEL85742.1| Transcriptional regulator, CarD [Bacillus cereus AH1272]
 gi|228741333|gb|EEL91540.1| Transcriptional regulator, CarD [Bacillus cereus AH1273]
          Length = 164

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 81/157 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEEKEILGTTRQYCVIRIINKDMQVMLPMDQLQKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L             W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DKGTLDGILLEFHHGESDPSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   ++ E+A V ++SE +A   ++  ++
Sbjct: 127 SEKQMLDNARKMVISEVALVQNVSEHQATEFLQDTIN 163


>gi|324327548|gb|ADY22808.1| transcriptional regulator, CarD family protein [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 158

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/151 (27%), Positives = 82/151 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP HG G I  I+E+E+AG K +++VI      M + +P GK ++  +R ++
Sbjct: 7   FQIGDNIVYPMHGAGIIKAIEEKEIAGKKQQYYVIKMSASNMEIMIPEGKILNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALIHIMDIFQHGESDRLLTWKQRYKLNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITENQIKSF 157


>gi|228941895|ref|ZP_04104439.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228974826|ref|ZP_04135389.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228981418|ref|ZP_04141717.1| Transcriptional regulator, CarD [Bacillus thuringiensis Bt407]
 gi|228778301|gb|EEM26569.1| Transcriptional regulator, CarD [Bacillus thuringiensis Bt407]
 gi|228784886|gb|EEM32902.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228817728|gb|EEM63809.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|326942500|gb|AEA18396.1| CarD family transcriptional regulator [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 164

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEEKEILGTSRQYCVIRIISKDMQVMLPMNQLKKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DRGTLDDILLEFQNGESDPSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V +++E +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVTEHQATEFLQDTIN 163


>gi|329941162|ref|ZP_08290441.1| transcriptional-repair coupling factor [Streptomyces
           griseoaurantiacus M045]
 gi|329299693|gb|EGG43592.1| transcriptional-repair coupling factor [Streptomyces
           griseoaurantiacus M045]
          Length = 1176

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 61/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++        TG++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 486 MPARRRKTIDPLTLETGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 536

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 537 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 596

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 597 LYSARMAAPGHAFGGDTPWQR---ELEDAFPYAETPDQLTTIAEVKDDMEKSVP 647


>gi|226311543|ref|YP_002771437.1| hypothetical protein BBR47_19560 [Brevibacillus brevis NBRC 100599]
 gi|226094491|dbj|BAH42933.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 167

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/156 (26%), Positives = 78/156 (50%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  G+ + YP HG G I  ++E+E  G K  ++V+     ++ + VPV K   +G+RK+
Sbjct: 1   MFLVGDKVFYPIHGAGVIEAMEEKEFLGEKHLYYVLNMSLKELNIMVPVEKMSALGIRKV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            EA  +E  L  +    R      ++R + +  K+ SGD+   +EV+RDL     +    
Sbjct: 61  VEADILENVLAAMLEGQRDTALNAAQRYKLHTEKMKSGDIYEQSEVIRDLVGMSKEKVLG 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
            S++ + ++A   ++ EI  V  +   +A  +++  
Sbjct: 121 TSDKVMLDNAQQLLISEIELVKDVDTQQATEMLKQA 156


>gi|325291324|ref|YP_004267505.1| transcriptional regulator, CarD family [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324966725|gb|ADY57504.1| transcriptional regulator, CarD family [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 162

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/162 (24%), Positives = 79/162 (48%), Gaps = 2/162 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ I+YP HG+  I  ++++E+ G +   +++   K  M + +PV KA  IG+RK+
Sbjct: 1   MFQVGDKILYPMHGICIIDAVEKKELFGQQELCYILNIQKANMKITIPVDKATKIGVRKV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRA--QEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
                +E  L              ++R   +    K  +G++    E++RDL R   + +
Sbjct: 61  VGPEILENILNSFNLGDTDSNIFENQRYCKEINKKKFKTGNINQGTEIIRDLTRKSRRTK 120

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
               +  + ++A    V E+  V  ++  +A+ L++  L+SK
Sbjct: 121 LGQDDTNMLDNARRVFVSELMEVKGLALEQAVYLLDEALNSK 162


>gi|229048423|ref|ZP_04193990.1| Transcriptional regulator, CarD [Bacillus cereus AH676]
 gi|228722938|gb|EEL74316.1| Transcriptional regulator, CarD [Bacillus cereus AH676]
          Length = 164

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEEKEILGTSRQYCVIRIISKDMQVMLPMDQLKKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DRGTLDDILLEFQNGESDPSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V +++E +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVTEHQATEFLQDTIN 163


>gi|325970599|ref|YP_004246790.1| CarD family transcriptional regulator [Spirochaeta sp. Buddy]
 gi|324025837|gb|ADY12596.1| transcriptional regulator, CarD family [Spirochaeta sp. Buddy]
          Length = 167

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/164 (28%), Positives = 76/164 (46%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
              +  F  GEH+VYP  GVG I  I+E+   G    ++VI  D   M + +PV K+ ++
Sbjct: 4   PQEKVQFAVGEHVVYPLQGVGVIKRIEERTFRGAVTMYYVIYLDISDMTVMIPVEKSKEM 63

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
           G+R + E    + A+  +  K       W  R Q     +  G + +IA+VV+ L+    
Sbjct: 64  GIRPIVEQKEAQSAIDSISSKYEPMPVDWKARYQMNVDLLKQGSIASIAKVVQALYHRSK 123

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             E    ER+LY++AL  ++ E A      + E   L+   L  
Sbjct: 124 IKELPVQERKLYDNALRLLIDETAFSLKKDKKEIELLVFSRLEK 167


>gi|309812806|ref|ZP_07706544.1| transcription-repair coupling factor [Dermacoccus sp. Ellin185]
 gi|308433223|gb|EFP57117.1| transcription-repair coupling factor [Dermacoccus sp. Ellin185]
          Length = 1209

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 61/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        + G+H+V+  HGVG   E+ ++ V G   E+ V         L+  
Sbjct: 503 MPSRRRNVVDPLQLKPGDHVVHEQHGVGRFVEMMQRTVGGATREYLV---------LEYA 553

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+      M         +K          E++R
Sbjct: 554 ASKRGQPGDRLFVPTDQLDQVTRYVGGEMPTLSKMGGSDWAATKSKARRHVKQIAGELIR 613

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  +++    ++     +    A V +  +  +I  ++ ++     
Sbjct: 614 LYSARQATPGHAFAPDTPWQR---ELEDAFAYVETPDQLSSIEEVKADMEKTVP 664


>gi|229173800|ref|ZP_04301340.1| Transcriptional regulator, CarD [Bacillus cereus MM3]
 gi|228609650|gb|EEK66932.1| Transcriptional regulator, CarD [Bacillus cereus MM3]
          Length = 156

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/152 (28%), Positives = 79/152 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K  ++VI      M + +P GK +   +R +
Sbjct: 4   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQLYYVIKMSLSNMQIMIPKGKILSSNIRPV 63

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   + R + + +     +   W +R +    KI +G++   AEV+RDL R   +   +
Sbjct: 64  IDILTLTRIIHIFQHGESGELMPWKQRYKVNTDKIKTGEIQEGAEVIRDLIRIKKEKALN 123

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 124 TSEKKLLDDAYKFLVSELELIKGITEKQMKSF 155


>gi|229030844|ref|ZP_04186866.1| Transcriptional regulator, CarD [Bacillus cereus AH1271]
 gi|228730493|gb|EEL81451.1| Transcriptional regulator, CarD [Bacillus cereus AH1271]
          Length = 158

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/152 (28%), Positives = 79/152 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K  ++VI      M + +P GK +   +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQLYYVIKMSLSNMQIMIPKGKILSSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   + R + + +     +   W +R +    KI +G++   AEV+RDL R   +   +
Sbjct: 66  IDILTLTRIIHIFQHGESGELMPWKQRYKVNTDKIKTGEIQEGAEVIRDLIRIKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDAYKFLVSELELIKGITEKQIKSF 157


>gi|269125277|ref|YP_003298647.1| transcription-repair coupling factor [Thermomonospora curvata DSM
           43183]
 gi|268310235|gb|ACY96609.1| transcription-repair coupling factor [Thermomonospora curvata DSM
           43183]
          Length = 1168

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 59/174 (33%), Gaps = 18/174 (10%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        R G+++V+  HGVG   E+  + V G   E+ V+ + +    L VP
Sbjct: 480 MPSRRRGGIDPLQLRPGDYVVHEQHGVGRYVEMVSRTVQGATREYLVLEYARGD-RLFVP 538

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +  +I                 V G++     +      +  A+          E++R
Sbjct: 539 TDQLEEITRY--------------VGGESPTLHRLGGADWAKSKARARKAVRQIAGELIR 584

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +  AI  ++ ++     
Sbjct: 585 LYSARMATPGHAFGPDTPWQR---ELEDAFPYTETADQLAAIEEVKADMEKPVP 635


>gi|229163710|ref|ZP_04291657.1| Transcriptional regulator, CarD [Bacillus cereus R309803]
 gi|228619772|gb|EEK76651.1| Transcriptional regulator, CarD [Bacillus cereus R309803]
          Length = 164

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 81/157 (51%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEEKEILGTLRQYCVIRILSKDMQVMLPMDQLQKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DKGTLNDILLEFQQGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V ++SE +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVSEHQATEFLQDTIN 163


>gi|229073067|ref|ZP_04206256.1| Transcriptional regulator, CarD [Bacillus cereus F65185]
 gi|228710053|gb|EEL62038.1| Transcriptional regulator, CarD [Bacillus cereus F65185]
          Length = 158

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/152 (28%), Positives = 79/152 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K  ++VI      M + +P GK +   +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQLYYVIKMSISNMQIMIPKGKILSSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   + R + + +     +   W +R +    KI +G++   AEV+RDL R   +   +
Sbjct: 66  IDILTLTRIIHIFQHGESGELMPWKQRYKVNTDKIKTGEIQEGAEVIRDLIRIKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDAYKFLVSELELIKGITEKQIKSF 157


>gi|29830092|ref|NP_824726.1| transcriptional-repair coupling factor [Streptomyces avermitilis
           MA-4680]
 gi|29607202|dbj|BAC71261.1| putative transcriptional-repair coupling factor [Streptomyces
           avermitilis MA-4680]
          Length = 1176

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 486 MPARRRKTIDPLTLEAGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 536

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 537 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 596

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 597 LYSARMAAPGHAFGSDTPWQR---ELEDAFPYAETPDQLTTIAEVKEDMEKTVP 647


>gi|218290671|ref|ZP_03494762.1| transcription-repair coupling factor [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218239336|gb|EED06534.1| transcription-repair coupling factor [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 1183

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 26/163 (15%), Positives = 60/163 (36%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           Q    G+++V+  HG+G    IK  EV G + ++  +++      L VPV +   I    
Sbjct: 501 QELNVGDYVVHVNHGIGRYMGIKTLEVDGRRNDYLYLSYAGGDS-LYVPVDQIDQIQRYI 559

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            S              K     ++ S   Q+   ++         ++++   + ++ P  
Sbjct: 560 GSG------------EKEPKLHSLGSSEWQKTKNRVKKSVRDIAGDLLKLYAKREATPGH 607

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S    +++    M        +  +  AI  I+ ++     
Sbjct: 608 AFSPDTPWQADFENM---FPYEETPDQLRAIAEIKRDMEKPRP 647


>gi|228905766|ref|ZP_04069681.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 4222]
 gi|228853883|gb|EEM98626.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 4222]
          Length = 158

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/152 (28%), Positives = 81/152 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K ++FVI      M + +P GK ++  +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQQYFVIKMSISNMQVMIPTGKILNSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++  + +   +   K   W +R +    K+ +G++   AEVVRDL R   +   +
Sbjct: 66  IDILALKHIIHIFHHEESCKLLPWKQRHKVNTDKVKTGEIQEGAEVVRDLMRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDAYRFLVSELELIKGITENQIKSF 157


>gi|159036485|ref|YP_001535738.1| transcription-repair coupling factor [Salinispora arenicola
           CNS-205]
 gi|157915320|gb|ABV96747.1| transcription-repair coupling factor [Salinispora arenicola
           CNS-205]
          Length = 1218

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 59/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +  +++        R G+H+V+  HG+G   E+ ++ V G   E+ V         ++  
Sbjct: 517 LPSRRRNTIDPLELRAGDHVVHEQHGIGRYVELVQRTVNGASREYLV---------IEYA 567

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+      M     Q+  A+         A++++
Sbjct: 568 PSKRGQPGDRLFVPTDQLDQLSRYVGGEQPTLHKMGGSDWQKSKARARKAVREIAAQLIQ 627

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +     +     ++     +        +  +  AI  ++ ++     
Sbjct: 628 LYAARKASKGHPFGPDTPWQR---ELEDAFPWQETPDQLAAIEEVKRDMEQTVP 678


>gi|206973195|ref|ZP_03234117.1| transcriptional regulator, CarD family [Bacillus cereus AH1134]
 gi|229191421|ref|ZP_04318406.1| Transcriptional regulator, CarD [Bacillus cereus ATCC 10876]
 gi|206732079|gb|EDZ49279.1| transcriptional regulator, CarD family [Bacillus cereus AH1134]
 gi|228592103|gb|EEK49937.1| Transcriptional regulator, CarD [Bacillus cereus ATCC 10876]
          Length = 158

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/152 (29%), Positives = 81/152 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K ++FVI      M + +P GK ++  +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQQYFVIKMSISNMQVMIPTGKILNSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++  + +   +   K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  IDILALKHIIHIFHHEESCKLLPWKQRHKVNTDKIKTGEIQEGAEVVRDLMRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDAYRFLVSELELIKGITENQIKSF 157


>gi|297566998|ref|YP_003685970.1| CarD family transcriptional regulator [Meiothermus silvanus DSM
           9946]
 gi|296851447|gb|ADH64462.1| transcriptional regulator, CarD family [Meiothermus silvanus DSM
           9946]
          Length = 163

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/161 (30%), Positives = 74/161 (45%), Gaps = 2/161 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F  GE +VYPAHG G I  + E+ V G K  ++V+        + VPVG A    +R  
Sbjct: 1   MFAIGEAVVYPAHGAGRIVGLDERSVLGEKRIYYVLELLGQAHTVMVPVGVAQA-CLRPP 59

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                VER L  ++       T+W +R +E +  + SGD   +A +   L R       S
Sbjct: 60  LAGAAVERLLDELK-TEVKLPTIWMQRHREEEKILASGDPYQVAALAGTLFRYQRGKTLS 118

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            SER ++E AL  +  E+A +  +S  EA   +   L  + 
Sbjct: 119 LSERGVFEKALAMLASELALIWGVSLDEAKARVLARLEDQE 159


>gi|229191260|ref|ZP_04318247.1| Transcriptional regulator, CarD [Bacillus cereus ATCC 10876]
 gi|228592177|gb|EEK50009.1| Transcriptional regulator, CarD [Bacillus cereus ATCC 10876]
          Length = 158

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/152 (29%), Positives = 84/152 (55%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI     KM + +P GK ++  +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGEKQQYYVIKMSISKMQVMIPTGKILNSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + + +   K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  TDILALKHIIHIFQHEESCKLLPWKQRHKVNTDKIKTGEIQEGAEVVRDLMRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDAYKFLVSELELIKGITEKQIKSF 157


>gi|228910571|ref|ZP_04074385.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 200]
 gi|228849135|gb|EEM93975.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 200]
          Length = 164

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEEKEILGTSRQYCVIRIISKDMQVMLPMDQLKKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DRGTLDDILLEFQNGEADPSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V +++E +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVTEHQATEFLQDTIN 163


>gi|229106940|ref|ZP_04237040.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-28]
 gi|229118992|ref|ZP_04248336.1| Transcriptional regulator, CarD [Bacillus cereus Rock1-3]
 gi|228664467|gb|EEL19964.1| Transcriptional regulator, CarD [Bacillus cereus Rock1-3]
 gi|228676495|gb|EEL31241.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-28]
          Length = 158

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/152 (27%), Positives = 83/152 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI      M + +P+GK +   +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQQYYVIKMSISNMQVMIPMGKILSSSIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + +     K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  TDILALKHIMHIFQHGESDKLLPWKQRYKVNTDKIKTGEIQDGAEVVRDLMRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 126 TSEKKMLDNAHEFLISELGLIKGITENQIKSF 157


>gi|258510200|ref|YP_003183634.1| transcription-repair coupling factor [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257476926|gb|ACV57245.1| transcription-repair coupling factor [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 1183

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 26/163 (15%), Positives = 60/163 (36%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           Q    G+++V+  HG+G    IK  EV G + ++  +++      L VPV +   I    
Sbjct: 501 QELNVGDYVVHVNHGIGRYMGIKTLEVDGRRNDYLYLSYAGGDS-LYVPVDQIDQIQRYI 559

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            S              K     ++ S   Q+   ++         ++++   + ++ P  
Sbjct: 560 GSG------------EKEPKLHSLGSSEWQKTKNRVKKSVRDIAGDLLKLYAKREATPGH 607

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S    +++    M        +  +  AI  I+ ++     
Sbjct: 608 AFSPDTPWQADFENM---FPYEETPDQLRAIAEIKRDMEKPRP 647


>gi|288555760|ref|YP_003427695.1| CarD family transcriptional regulator [Bacillus pseudofirmus OF4]
 gi|288546920|gb|ADC50803.1| CarD family transcriptional regulator [Bacillus pseudofirmus OF4]
          Length = 162

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/159 (23%), Positives = 80/159 (50%), Gaps = 3/159 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+H+VYP HG GTI +I+E++V G    ++++ F    + L +P  +    G+RK+
Sbjct: 1   MFKVGDHVVYPYHGAGTIQDIEEKDVLGETHSYYILHFPLVDVKLMLPENRIDQSGLRKV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE-- 130
            +   +E  ++ ++       +  S  ++E +  + SG++I  A ++  L +  S+    
Sbjct: 61  IDQQELEVLVEALQNGPETPPST-SHFSRETENLLKSGNIIDAAHLISSLSKKQSERANG 119

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
               +R   + A   +  E+  +N ++E +A   I+  L
Sbjct: 120 LHIQDRNHLQKARQMIASELVLMNDMTEEQAYEFIDSAL 158


>gi|154253521|ref|YP_001414345.1| transcription-repair coupling factor [Parvibaculum lavamentivorans
           DS-1]
 gi|154157471|gb|ABS64688.1| transcription-repair coupling factor [Parvibaculum lavamentivorans
           DS-1]
          Length = 1171

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/176 (14%), Positives = 55/176 (31%), Gaps = 21/176 (11%)

Query: 3   FQQKRD----AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLK 58
            ++KR             G+ +V+  HG+G    ++  EV G   +  ++        L 
Sbjct: 483 RRKKRAENFLTEASSLSPGDLVVHVDHGIGRFERLQTIEVMGAPHDCLLL-IYHGGDKLY 541

Query: 59  VPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEV 118
           +PV     +           +     +             R +E   +  +G+LI I   
Sbjct: 542 LPVENIELLSRY------GSDDLDAQLDRLGGTGWQARKARLKE-RIREMAGELIKI-AA 593

Query: 119 VRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            R+L    +   +          A +          +  + +AI+ +  +L+    
Sbjct: 594 ARELKTAPAMEPQPG--------AYDEFCARFPFTETEDQEQAIDAVLEDLARGRP 641


>gi|229174309|ref|ZP_04301842.1| Transcriptional regulator, CarD [Bacillus cereus MM3]
 gi|228609166|gb|EEK66455.1| Transcriptional regulator, CarD [Bacillus cereus MM3]
          Length = 158

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/151 (26%), Positives = 79/151 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E+ G K +++VI      M + +P G+ +   +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEITGEKQQYYVIKMSGSNMEVMIPAGRILSSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   L + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITAIAHILDIFQHGESDRLLTWKQRYKLNTDKIKTGKIQEGAEVVRDLLRMQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITESQIKSF 157


>gi|290959824|ref|YP_003491006.1| transcriptional-repair coupling factor [Streptomyces scabiei 87.22]
 gi|260649350|emb|CBG72465.1| putative transcriptional-repair coupling factor [Streptomyces
           scabiei 87.22]
          Length = 1177

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 486 MPARRRKTIDPLTLEAGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 536

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 537 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 596

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 597 LYSARMAAPGHAFGADTPWQR---ELEDAFPYAETPDQLTTIAEVKEDMEKTVP 647


>gi|126650362|ref|ZP_01722590.1| transcriptional regulator, CarD family protein [Bacillus sp.
           B14905]
 gi|126593012|gb|EAZ86994.1| transcriptional regulator, CarD family protein [Bacillus sp.
           B14905]
          Length = 158

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 81/151 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F  G++IVYP HGVG I  I+E+E++G K +++VI      M + +P GK +   +R ++
Sbjct: 7   FEIGDNIVYPMHGVGIIKAIEEKEISGEKQQYYVIKMLIGNMQIMIPTGKILSSSIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  + + +     +   W +R +    KIN+G +    EVVRDL R   +   + 
Sbjct: 67  DIIALKHIINIFQHGESDRLLPWKQRYKVNTDKINTGKIQECTEVVRDLIRMKKEQGLNS 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+  +  + 
Sbjct: 127 SEKKMLDNAHEFLISELVLIKGITVNQIKSF 157


>gi|323490992|ref|ZP_08096186.1| transcription-repair coupling factor [Planococcus donghaensis
           MPA1U2]
 gi|323395348|gb|EGA88200.1| transcription-repair coupling factor [Planococcus donghaensis
           MPA1U2]
          Length = 1177

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 61/163 (37%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G++IV+  HG+G    I+  E  G+  ++  I   K    L VPV K   I    
Sbjct: 498 SEIKPGDYIVHIHHGIGRFVGIETLESGGVHKDYLHI-VYKADDKLFVPVDKIDLIQKYI 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE             K      M     ++   K+++       ++++     ++    
Sbjct: 557 ASE------------EKEPKLHKMGGAEWKKTRTKVSAAVQDIADDLIKLYAEREALRGF 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++SE Q  +    +   E     +  +  +IN ++ ++ ++  
Sbjct: 605 AFSEEQDMQR---QFEAEFPYEETTDQLRSINEVKRDMENERP 644


>gi|145593442|ref|YP_001157739.1| transcription-repair coupling factor [Salinispora tropica CNB-440]
 gi|145302779|gb|ABP53361.1| transcription-repair coupling factor [Salinispora tropica CNB-440]
          Length = 1216

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +  +++        R G+H+V+  HG+G   E+ ++ V G   E+ V         ++  
Sbjct: 515 LPSRRRNTIDPLELRAGDHVVHEQHGIGRYVELVQRTVNGASREYLV---------IEYA 565

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+      M     Q+  A+         A++++
Sbjct: 566 PSKRGQPGDRLFVPTDQLDQLSRYVGGEQPTLHKMGGSDWQKSKARARKAVREIAAQLIQ 625

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    S+     ++     +        +  +  AI  ++ ++     
Sbjct: 626 LYAARKASKGHSFGPDTPWQR---ELEDAFPWQETPDQLAAIEEVKRDMEQTVP 676


>gi|157691253|ref|YP_001485715.1| transcription regulator CarD [Bacillus pumilus SAFR-032]
 gi|157680011|gb|ABV61155.1| CarD family transcriptional regulator [Bacillus pumilus SAFR-032]
          Length = 153

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/152 (26%), Positives = 75/152 (49%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +  K +++VI      M + +P  K     +R +
Sbjct: 1   MFQIGDNIVYPMHGAGIIEAIEEKEFSDEKQQYYVIKMSISHMKVMIPTRKISGSRIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   +   + + +     +   W  R      KI +GD+   AEVVRDL R   +   +
Sbjct: 61  TDLLALNNVMHVFQHGESDQLLTWKERHTINTNKIKTGDIQDGAEVVRDLMRMKKEKALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++ + A   ++ E+  +  I+E +  + 
Sbjct: 121 ASEKKMLDEAHEFLLSELEVIEGITEKQIKSF 152


>gi|294629781|ref|ZP_06708341.1| transcription-repair coupling factor [Streptomyces sp. e14]
 gi|292833114|gb|EFF91463.1| transcription-repair coupling factor [Streptomyces sp. e14]
          Length = 1184

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 493 MPARRRKTIDPLTLEAGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 543

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 544 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 603

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 604 LYSARMAAPGHAFGADTPWQR---ELEDAFPYAETPDQLTTIAEVKEDMEKSVP 654


>gi|328949054|ref|YP_004366391.1| CarD family transcriptional regulator [Treponema succinifaciens DSM
           2489]
 gi|328449378|gb|AEB15094.1| transcriptional regulator, CarD family [Treponema succinifaciens
           DSM 2489]
          Length = 206

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/169 (27%), Positives = 75/169 (44%)

Query: 11  RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMR 70
           +  F   + +VYP+ GVG ITEI +++       ++ I  +   M + VPV ++ D+G+R
Sbjct: 5   KTEFSVNQKVVYPSQGVGKITEIFKKDFNNEPTYYYKIYLEVSDMNVMVPVSRSKDLGIR 64

Query: 71  KLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
            +      + AL  +        + W  R Q     +  G +  IA +VR L+      E
Sbjct: 65  AIVSKDEAQTALNSISDDFEPPTSDWKLRYQMNLDLLKKGTIGDIAAIVRCLYHRSKVKE 124

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
               ER+LY++A   +  EIA    IS  E   ++   L     K EK 
Sbjct: 125 LPILERKLYDNAKKLLEDEIAEAFGISNKEVEAMLHEKLEPLGLKIEKK 173


>gi|229015358|ref|ZP_04172376.1| Transcriptional regulator, CarD [Bacillus mycoides DSM 2048]
 gi|228745937|gb|EEL95922.1| Transcriptional regulator, CarD [Bacillus mycoides DSM 2048]
          Length = 158

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/152 (26%), Positives = 83/152 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI      M + +P+GK +   +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQQYYVIKMSISNMQVMIPMGKILSSSIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + +     +   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  TDILALKHIIHIFQHGESDRLLPWKQRYKVNTDKIKTGEIQEGAEVVRDLIRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 126 TSEKKMLDNAHEFLISELGLIKGITENQIKSF 157


>gi|229073467|ref|ZP_04206599.1| Transcriptional regulator, CarD [Bacillus cereus F65185]
 gi|228709655|gb|EEL61697.1| Transcriptional regulator, CarD [Bacillus cereus F65185]
          Length = 158

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/152 (29%), Positives = 82/152 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K ++FVI      M + +P GK ++  +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQQYFVIKMSISNMQVMIPTGKILNSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + +   +   K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  TDILALKHIIHIFHHEESCKLLPWKQRHKVNTDKIKTGEIQEGAEVVRDLMRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDAYRFLVSELELIKGITENQIKSF 157


>gi|256787262|ref|ZP_05525693.1| transcriptional-repair coupling factor [Streptomyces lividans TK24]
 gi|289771157|ref|ZP_06530535.1| transcription-repair coupling factor [Streptomyces lividans TK24]
 gi|289701356|gb|EFD68785.1| transcription-repair coupling factor [Streptomyces lividans TK24]
          Length = 1184

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 62/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++        TG++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 494 MPARRRKTIDPLTLETGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 544

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 545 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 604

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +      V +  +   I  ++ ++     
Sbjct: 605 LYSARMAAPGHAFGSDTPWQR---ELEDAFPYVETPDQLTTIAEVKDDMEKTVP 655


>gi|21221548|ref|NP_627327.1| transcriptional-repair coupling factor [Streptomyces coelicolor
           A3(2)]
 gi|10241792|emb|CAC09550.1| putative transcriptional-repair coupling factor [Streptomyces
           coelicolor A3(2)]
          Length = 1184

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 62/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++        TG++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 494 MPARRRKTIDPLTLETGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 544

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 545 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 604

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +      V +  +   I  ++ ++     
Sbjct: 605 LYSARMAAPGHAFGSDTPWQR---ELEDAFPYVETPDQLTTIAEVKDDMEKTVP 655


>gi|52142365|ref|YP_084467.1| CarD family transcriptional regulator [Bacillus cereus E33L]
 gi|51975834|gb|AAU17384.1| possible transcriptional regulator, CarD family [Bacillus cereus
           E33L]
          Length = 158

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/152 (28%), Positives = 79/152 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K  ++VI      M + +P GK +   +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQLYYVIKMSISNMQIMIPKGKILSSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++  + +   +   K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  IDILALKHIIHIFHHEESCKLLPWKQRHKVNTDKIKTGEIQEGAEVVRDLMRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDAYKFLVSELELIKGITENQIKSF 157


>gi|75760847|ref|ZP_00740862.1| CarD-like transcriptional regulator [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218899872|ref|YP_002448283.1| transcriptional regulator, CarD family [Bacillus cereus G9842]
 gi|228903236|ref|ZP_04067369.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 4222]
 gi|228967819|ref|ZP_04128833.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|229072221|ref|ZP_04205428.1| Transcriptional regulator, CarD [Bacillus cereus F65185]
 gi|229076225|ref|ZP_04209192.1| Transcriptional regulator, CarD [Bacillus cereus Rock4-18]
 gi|229081972|ref|ZP_04214463.1| Transcriptional regulator, CarD [Bacillus cereus Rock4-2]
 gi|229193002|ref|ZP_04319958.1| Transcriptional regulator, CarD [Bacillus cereus ATCC 10876]
 gi|74491661|gb|EAO54862.1| CarD-like transcriptional regulator [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218545825|gb|ACK98219.1| transcriptional regulator, CarD family [Bacillus cereus G9842]
 gi|228590449|gb|EEK48312.1| Transcriptional regulator, CarD [Bacillus cereus ATCC 10876]
 gi|228701349|gb|EEL53844.1| Transcriptional regulator, CarD [Bacillus cereus Rock4-2]
 gi|228706874|gb|EEL59080.1| Transcriptional regulator, CarD [Bacillus cereus Rock4-18]
 gi|228710878|gb|EEL62846.1| Transcriptional regulator, CarD [Bacillus cereus F65185]
 gi|228791869|gb|EEM39457.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228856410|gb|EEN00937.1| Transcriptional regulator, CarD [Bacillus thuringiensis IBL 4222]
          Length = 164

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 82/157 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP HG G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMHGAGIIEAIEEKEILGTSRQYCVIRIISKDMQVMLPMEQLKKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DRGTLDDILLEFQNGESDPSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERTLNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           SE+Q+ ++A   M+ E+A V +++E +A   ++  ++
Sbjct: 127 SEKQMLDNARKMMISEVALVQNVTEHQATEFLQDTIN 163


>gi|16077580|ref|NP_388394.1| transcriptional regulator [Bacillus subtilis subsp. subtilis str.
           168]
 gi|81345932|sp|P96659|YDEB_BACSU RecName: Full=Uncharacterized protein ydeB
 gi|1881322|dbj|BAA19349.1| ydeB [Bacillus subtilis]
 gi|2632813|emb|CAB12320.1| putative transcriptional regulator [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 153

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/152 (25%), Positives = 79/152 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E    K +++VI      M + +P  K +   +R +
Sbjct: 1   MFQIGDNIVYPMHGAGIIEAIEEKEFLEEKQQYYVIRMSISNMTVMIPTSKILSSNIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + +     +   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 61  TDILALKHIMHIFQHGESDRLLPWKQRYKINTDKIKTGEIQEGAEVVRDLMRMKKEKALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 121 ASEKKMLDNAYEFLISELEVIKGITEKQIKSF 152


>gi|121535095|ref|ZP_01666912.1| transcription-repair coupling factor [Thermosinus carboxydivorans
           Nor1]
 gi|121306345|gb|EAX47270.1| transcription-repair coupling factor [Thermosinus carboxydivorans
           Nor1]
          Length = 1109

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 65/174 (37%), Gaps = 18/174 (10%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
             + ++    +  + G+++V+  HG+G    ++  EV G+  ++F+I +  +   + VP 
Sbjct: 415 AAKGQQITYFRDLKVGDYVVHVNHGIGKYAGVETLEVGGVHRDYFLIRYAGED-KIYVPT 473

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            +   +     +E       L  + G                  K  S    A+A++ ++
Sbjct: 474 DQVHLLQKYIGAEGEVPR--LHRMGGTE--------------WQKATSRAKAAVADLAKE 517

Query: 122 LHRTDSQPEKSYSERQLYESALNR-MVREIAAVNSISEPEAINLIEVNLSSKSS 174
           L    +  + +       ++   +          +  + +AI+ I+ ++ +   
Sbjct: 518 LIALYAARQVTPGFAFEPDTPWQKEFEEAFPYEETPDQLQAISEIKRDMEAPRP 571


>gi|111018698|ref|YP_701670.1| CarD family transcriptional regulator [Rhodococcus jostii RHA1]
 gi|110818228|gb|ABG93512.1| probable transcriptional regulator, CarD family protein
           [Rhodococcus jostii RHA1]
          Length = 171

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/155 (24%), Positives = 68/155 (43%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
              G+  +YP HG  T+T++  +    +  E+      ++ + +++PV KA  IG+R   
Sbjct: 3   LNIGDIFLYPHHGSVTVTKLTTRMFNDLPTEYVQFEVAQNGLSIEIPVAKAESIGVRNAI 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               V R   ++RG      + WSRR +    K+  G +  ++EV+RDL         S 
Sbjct: 63  NNDEVGRVFDILRGPTVDDPSNWSRRFKANQEKLTVGGIFTVSEVIRDLMTRSQVKPLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
            E++  E A+  ++ E+         E    IE  
Sbjct: 123 GEKRQLEHAMQLVISELVLAMKSDPDETRRRIEAI 157


>gi|172056088|ref|YP_001812548.1| transcription-repair coupling factor [Exiguobacterium sibiricum
           255-15]
 gi|171988609|gb|ACB59531.1| transcription-repair coupling factor [Exiguobacterium sibiricum
           255-15]
          Length = 1171

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 63/182 (34%), Gaps = 25/182 (13%)

Query: 2   TFQQKRDAMR---------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDK 52
             ++K+             Q  +TG+++V+  HG+G    IK  +VAG   ++  + +  
Sbjct: 475 ARRRKQTTKLTNAERIKSYQELKTGDYVVHIHHGIGRYHGIKTIDVAGNHQDYLHLIYAG 534

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
           +   L VPV +   I     +E            GK      +     ++  AK+     
Sbjct: 535 EDS-LYVPVDQIDLIQKYVGAE------------GKEPKIYKLGGMEWKKVKAKVQKSVE 581

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
               E+++     ++    ++ E      A            ++ +  +I  I+ ++   
Sbjct: 582 DIADELIKLYAAREAAVGFAFPEDDDSTQA---FEASFPYEETVDQLRSIEEIKKDMERP 638

Query: 173 SS 174
             
Sbjct: 639 RP 640


>gi|229077167|ref|ZP_04209871.1| Transcriptional regulator, CarD [Bacillus cereus Rock4-18]
 gi|229100763|ref|ZP_04231596.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-29]
 gi|228682650|gb|EEL36695.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-29]
 gi|228706186|gb|EEL58471.1| Transcriptional regulator, CarD [Bacillus cereus Rock4-18]
          Length = 158

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/152 (27%), Positives = 79/152 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K  ++VI      M + +P GK +   +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQLYYVIKMSISNMQVMIPTGKILSSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +   +++ +     +   W +R +    KI +G++   AEV+RDL R   +   +
Sbjct: 66  IDILALTHIIQIFQHGESDELLPWKQRHKVNTDKIKTGEIQEGAEVIRDLIRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDAYKFLVSELELIKGITEKQIKSF 157


>gi|311898036|dbj|BAJ30444.1| putative transcription-repair-coupling factor [Kitasatospora setae
           KM-6054]
          Length = 1202

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 58/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++          G+++V+  HGVG   E+ ++ V G   E+ V         L+  
Sbjct: 506 MPSRRRNAIDPLALAAGDYVVHEQHGVGRYVEMVQRTVQGATREYLV---------LEYA 556

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  K V G+A     +      +   +         A++++
Sbjct: 557 PAKRGHPGDRLFVPTDQLDQVTKYVGGEAPTLHRLGGADWAKTKQRAKKAVKEIAADLIK 616

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 617 LYSARMAAPGHAFGPDTPWQR---ELEDAFPYAETPDQLTTIGEVKADMEKSVP 667


>gi|163939058|ref|YP_001643942.1| CarD family transcriptional regulator [Bacillus weihenstephanensis
           KBAB4]
 gi|163861255|gb|ABY42314.1| transcriptional regulator, CarD family [Bacillus weihenstephanensis
           KBAB4]
          Length = 153

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/152 (27%), Positives = 84/152 (55%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI      M + +P+GK +   +R +
Sbjct: 1   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQQYYVIKMSISNMQVMIPMGKILSSSIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  +++ +     K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 61  TDILALKHIIQIFQHGESDKLLPWKQRYKVNTDKIKTGEIQEGAEVVRDLMRMKKEKALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 121 TSEKKMLDNAHEFLISELGLIKGITENQIKSF 152


>gi|269219241|ref|ZP_06163095.1| transcription-repair coupling factor [Actinomyces sp. oral taxon
           848 str. F0332]
 gi|269211388|gb|EEZ77728.1| transcription-repair coupling factor [Actinomyces sp. oral taxon
           848 str. F0332]
          Length = 1194

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 25/182 (13%), Positives = 60/182 (32%), Gaps = 25/182 (13%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVA---GMKLEFFVIAFDK----- 52
           M  ++K     Q  + G+++V+  HGVG   ++ ++ +      + E+ V+ +       
Sbjct: 495 MPARRKNAVDLQALKPGDYVVHEHHGVGRFVKMAKRSIGASRETQREYLVLEYASTRRGA 554

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
               L VP      +                   G+A     M      +  A   +   
Sbjct: 555 PPDQLWVPTDSLDQVSRYAG--------------GEAPSLNKMGGSDWAKTKAGARAATK 600

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
               E+VR      +     +S    ++     +    A V +  + + I+ ++ ++   
Sbjct: 601 QIAQELVRLYAARQAAKGFQFSPDTPWQR---ELEDSFAYVETPDQLQTIDEVKADMEKP 657

Query: 173 SS 174
           + 
Sbjct: 658 TP 659


>gi|56963460|ref|YP_175191.1| CarD family transcriptional regulator [Bacillus clausii KSM-K16]
 gi|56909703|dbj|BAD64230.1| CarD family transcriptional regulator [Bacillus clausii KSM-K16]
          Length = 165

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/160 (25%), Positives = 79/160 (49%), Gaps = 3/160 (1%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
             F+ G+ +VYP HG GTI E++E++V G    +F++ F    + L +P  +    G+RK
Sbjct: 2   SMFKVGDKVVYPYHGAGTIQEVEEKDVLGETHLYFILHFPLVDITLMLPESRIEQSGLRK 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE- 130
           +  +  +E+  K ++       +  S+ +++ +  + +G +I  A +V  L +  ++   
Sbjct: 62  VIPSSDLEKVAKALQNGPDTPPST-SQFSRDTENLLKTGSIIDAAHLVSSLSKKQAERSN 120

Query: 131 -KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
                +R   + A   +  E+ AV   SE +A   I+ NL
Sbjct: 121 GLHIQDRHHLQKARQVLASELVAVQDFSEEQAYEFIDNNL 160


>gi|317124068|ref|YP_004098180.1| transcription-repair coupling factor [Intrasporangium calvum DSM
           43043]
 gi|315588156|gb|ADU47453.1| transcription-repair coupling factor [Intrasporangium calvum DSM
           43043]
          Length = 1208

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/174 (16%), Positives = 64/174 (36%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        R G+H+V+  HGVG   E+ ++ VAG   E+ V         ++  
Sbjct: 506 MPSRRRNQVDPLQLRPGDHVVHEQHGVGRFVEMMQRTVAGATREYLV---------IEYA 556

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  K V G+      M         ++         A+++R
Sbjct: 557 ASKRGQPGDRLYVPTDQLDQVTKYVGGEEPTLNKMGGSDWTRTKSRAKRYVKQIAADLIR 616

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    ++S    ++     +    A V +  +  +I+ ++ ++  +  
Sbjct: 617 LYSARQATKGHAFSADTPWQR---ELEDAFAYVETPDQLSSIDEVKADMEKQVP 667


>gi|221308340|ref|ZP_03590187.1| hypothetical protein Bsubs1_02893 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221312662|ref|ZP_03594467.1| hypothetical protein BsubsN3_02869 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221317585|ref|ZP_03598879.1| hypothetical protein BsubsJ_02828 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221321861|ref|ZP_03603155.1| hypothetical protein BsubsS_02899 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|291482932|dbj|BAI84007.1| hypothetical protein BSNT_00885 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 158

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 79/153 (51%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
             F+ G++IVYP HG G I  I+E+E    K +++VI      M + +P  K +   +R 
Sbjct: 5   DMFQIGDNIVYPMHGAGIIEAIEEKEFLEEKQQYYVIRMSISNMTVMIPTSKILSSNIRP 64

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
           +++   ++  + + +     +   W +R +    KI +G++   AEVVRDL R   +   
Sbjct: 65  VTDILALKHIMHIFQHGESDRLLPWKQRYKINTDKIKTGEIQEGAEVVRDLMRMKKEKAL 124

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINL 164
           + SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 125 NASEKKMLDNAYEFLISELEVIKGITEKQIKSF 157


>gi|229002840|ref|ZP_04160720.1| Transcriptional regulator, CarD [Bacillus mycoides Rock3-17]
 gi|228758404|gb|EEM07571.1| Transcriptional regulator, CarD [Bacillus mycoides Rock3-17]
          Length = 158

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/148 (28%), Positives = 81/148 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI      M + +P GK +   +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGEKQQYYVIKMSISNMQVLIPTGKILSSSIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + +     +   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  TDILALKHIIHIFQHGESDRLLPWKQRYKVNTDKIKTGEIQEGAEVVRDLMRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPE 160
            SE+++ E+A   ++ E+  +  I+E +
Sbjct: 126 TSEKKMLENAHEFLISELGLIKGITENQ 153


>gi|284989494|ref|YP_003408048.1| transcription-repair coupling factor [Geodermatophilus obscurus DSM
           43160]
 gi|284062739|gb|ADB73677.1| transcription-repair coupling factor [Geodermatophilus obscurus DSM
           43160]
          Length = 1179

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 21/174 (12%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        + G+ +V+  HG+G   E+  + V G + ++ +         ++  
Sbjct: 486 MPARRRNAVDLVQLQPGDLVVHEHHGIGRYIEMVSRTVNGGQRDYLI---------VEYA 536

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K      R       +++  + V G+A     +     Q+   +         AE++R
Sbjct: 537 PSKRNQPPDRLFVPTDALDQLTRYVGGEAPALSKLGGADWQKTKGQARRAVKQIAAELIR 596

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    +Y    +++     +        +  +  AI+ ++ ++     
Sbjct: 597 LYSARMATRGHAYGPDTVWQR---ELEDAFPFQETPDQLAAIDEVKTDMQHPVP 647


>gi|307324345|ref|ZP_07603553.1| transcription-repair coupling factor [Streptomyces violaceusniger
           Tu 4113]
 gi|306890076|gb|EFN21054.1| transcription-repair coupling factor [Streptomyces violaceusniger
           Tu 4113]
          Length = 1236

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 59/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G+ IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 546 MPARRRKTIDPLTLEAGDFIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 596

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A+++R
Sbjct: 597 PAKRGQPGDRLFVPTDQLEQVTKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIR 656

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 657 LYSARMAAPGHAFGADTPWQR---ELEDAFPYAETPDQLTTIAEVKEDMEKSVP 707


>gi|8131942|gb|AAF73146.1|AF149031_1 unknown [Sinorhizobium meliloti]
          Length = 162

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 111/161 (68%), Positives = 132/161 (81%)

Query: 28  GTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRG 87
           G I  I+EQEVAGMKLE FVI F+KDKM LKVPV KA+ IGMRKLSE  FV+RALK+V+G
Sbjct: 1   GQIVAIEEQEVAGMKLELFVIDFEKDKMRLKVPVAKAVGIGMRKLSETDFVDRALKVVQG 60

Query: 88  KARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMV 147
           KARVKRTMWSRRAQEYDAKINSGDLI+IAEVVRDL+R ++QPE+SYSERQLYE+AL+RM 
Sbjct: 61  KARVKRTMWSRRAQEYDAKINSGDLISIAEVVRDLYRAENQPEQSYSERQLYEAALDRMA 120

Query: 148 REIAAVNSISEPEAINLIEVNLSSKSSKTEKSTSENQDKAA 188
           REIAAVN +SE EA+ L+E NL+    + +    ++    A
Sbjct: 121 REIAAVNRMSETEAVRLVEANLNKGPKRGKAIEEDDAQDEA 161


>gi|229132055|ref|ZP_04260918.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST196]
 gi|228651455|gb|EEL07427.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST196]
          Length = 158

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/152 (27%), Positives = 84/152 (55%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI      M + +P+GK +   +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQQYYVIKMSISNMQVMIPMGKILSSSIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  +++ +     K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  TDILALKHIIQIFQHGESDKLLPWKQRYKVNTDKIKTGEIQEGAEVVRDLMRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 126 TSEKKMLDNAHEFLISELGLIKGITENQIKSF 157


>gi|302519736|ref|ZP_07272078.1| transcription-repair coupling factor [Streptomyces sp. SPB78]
 gi|302428631|gb|EFL00447.1| transcription-repair coupling factor [Streptomyces sp. SPB78]
          Length = 1178

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 62/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++        TG++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 487 MPVRRRKSIDPLTLETGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 537

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 538 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 597

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I+ ++ ++     
Sbjct: 598 LYSARMAAPGHAFGPDTPWQR---ELEDAFPYAETPDQLTTISEVKSDMEKTVP 648


>gi|318060504|ref|ZP_07979227.1| transcription-repair coupling factor [Streptomyces sp. SA3_actG]
 gi|318077247|ref|ZP_07984579.1| transcription-repair coupling factor [Streptomyces sp. SA3_actF]
          Length = 1178

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 62/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++        TG++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 487 MPVRRRKSIDPLTLETGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 537

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 538 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 597

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I+ ++ ++     
Sbjct: 598 LYSARMAAPGHAFGPDTPWQR---ELEDAFPYAETPDQLTTISEVKSDMEKTVP 648


>gi|228966014|ref|ZP_04127081.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228793684|gb|EEM41220.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           sotto str. T04001]
          Length = 158

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 43/152 (28%), Positives = 82/152 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI      M + +P GK ++  +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGEKQQYYVIKMSISNMQVMIPTGKILNSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + + +   K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  TDILALKHIIHIFQHEESCKLLPWKQRHKVNTDKIKTGEIQEGAEVVRDLMRMKKEKTLN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L +     +V E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDVYKFLVSELELIKGITENQIKSF 157


>gi|333026450|ref|ZP_08454514.1| putative transcriptional-repair coupling factor [Streptomyces sp.
           Tu6071]
 gi|332746302|gb|EGJ76743.1| putative transcriptional-repair coupling factor [Streptomyces sp.
           Tu6071]
          Length = 1181

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 62/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++        TG++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 490 MPVRRRKSIDPLTLETGDYIVHVQHGVGRYIEMVQRTVQGATREYLV---------VEYA 540

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 541 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 600

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I+ ++ ++     
Sbjct: 601 LYSARMAAPGHAFGPDTPWQR---ELEDAFPYAETPDQLTTISEVKSDMEKTVP 651


>gi|239981759|ref|ZP_04704283.1| transcriptional-repair coupling factor [Streptomyces albus J1074]
 gi|291453617|ref|ZP_06593007.1| transcriptional-repair coupling factor [Streptomyces albus J1074]
 gi|291356566|gb|EFE83468.1| transcriptional-repair coupling factor [Streptomyces albus J1074]
          Length = 1177

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 63/174 (36%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++        +G++IV+  HGVG   E+ ++ V G   E+ +         ++  
Sbjct: 487 MPTRRRKTIDPLTLESGDYIVHEQHGVGRYIEMVQRTVQGATREYLL---------VEYA 537

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 538 PAKRGQPGDRLYIPTDQLEQVTKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 597

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++ +   ++     +      + +  +   I  ++ ++     
Sbjct: 598 LYSARMAAPGHAFGQDTPWQR---ELEDAFPYMETPDQLSTIAEVKDDMEKTVP 648


>gi|312194532|ref|YP_004014593.1| transcription-repair coupling factor [Frankia sp. EuI1c]
 gi|311225868|gb|ADP78723.1| transcription-repair coupling factor [Frankia sp. EuI1c]
          Length = 1215

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 60/174 (34%), Gaps = 18/174 (10%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G+ +V+ AHGVG   E+  + VAG K E+ V+ + K    L VP
Sbjct: 521 MPSRRRKGIDPLALAVGDLVVHEAHGVGRYIEMVTRTVAGAKREYLVLEYAKGD-RLYVP 579

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
                 +                 V G+A     +      +  ++          E++R
Sbjct: 580 TDALEQVTRY--------------VGGEAPTLDRIGGADWAKRKSRARKAVKEIAGELIR 625

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +  AI+ ++ ++     
Sbjct: 626 LYSARMAAPGYAFGPDNPWQR---ELEDAFPFRETPDQLSAIDEVKRDMERAVP 676


>gi|228924323|ref|ZP_04087573.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228835349|gb|EEM80740.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 158

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 46/152 (30%), Positives = 83/152 (54%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K ++FVI     KM + +P GK ++  +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQQYFVIKMSISKMQVMIPTGKIVNSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + +   +   K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  TDILALKHIIHIFHHEESCKLLPWKQRHKVNTDKIKTGEIQEGAEVVRDLMRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDAYRFLVSELELIKGITENQIKSF 157


>gi|313679234|ref|YP_004056973.1| CarD family transcriptional regulator [Oceanithermus profundus DSM
           14977]
 gi|313151949|gb|ADR35800.1| transcriptional regulator, CarD family [Oceanithermus profundus DSM
           14977]
          Length = 164

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 36/161 (22%), Positives = 71/161 (44%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           + +R G+ +V P +GVG +  I ++ VAG+   ++ + F   +    VPV     +G+R 
Sbjct: 2   KEYRPGDKVVLPPYGVGVVAGIAQRTVAGIGRSYYQVEFPGSRSKAFVPVESPQQVGLRP 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                 V + L+ ++         W+ R +     ++ G+   IA +   L R D++   
Sbjct: 62  ALTRDEVPQILEHLKHGQLPLPKQWAARHRRVTEILSEGNPHRIAILAGQLRRWDAERGL 121

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
              +RQ +  A+N +  E+A    I+  E   + E     +
Sbjct: 122 PDLDRQAFRRAINLLAEEVAQALEITVSETRVVFEEAWGEE 162


>gi|295694758|ref|YP_003587996.1| transcription-repair coupling factor [Bacillus tusciae DSM 2912]
 gi|295410360|gb|ADG04852.1| transcription-repair coupling factor [Bacillus tusciae DSM 2912]
          Length = 1174

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           Q  + G+++V+  HG+G    I+  E+ G+  ++           L VP+ +   +    
Sbjct: 494 QDLKVGDYVVHVNHGIGQYMGIQTLEIEGIHKDYL-YIRYAGNDKLYVPIDQIDQVQKYI 552

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
             E             K      +      +   ++ S       E+V+   +  + P  
Sbjct: 553 GGE------------DKQPKLYHLGGTEWAKVKNRVRSSIRDIAEELVKLYAQRMASPGH 600

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S    ++     M        +  + +AI  I+ ++     
Sbjct: 601 AFSPDTPWQKEFEAM---FPYRETPDQLKAIEEIKRDMEQPRP 640


>gi|332298572|ref|YP_004440494.1| transcriptional regulator, CarD family [Treponema brennaborense DSM
           12168]
 gi|332181675|gb|AEE17363.1| transcriptional regulator, CarD family [Treponema brennaborense DSM
           12168]
          Length = 217

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 44/160 (27%), Positives = 75/160 (46%)

Query: 11  RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMR 70
           +  F   + IVYP+ GVG ITEI E++     L ++VI  +   M + VPV +  ++G+R
Sbjct: 11  KMTFEVNQKIVYPSQGVGKITEITEKKFKDNVLPYYVIYLEVSDMTVMVPVNRVEELGIR 70

Query: 71  KLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
            +       +A++++  +     + W  R Q     +  G +  IA +VR L+      E
Sbjct: 71  AIVSQQEALQAIEMMGEEVEPVTSDWKLRYQMNLDLLKKGSVSDIATIVRCLYHRSKVKE 130

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
               ER+LY+SA   +  EI+     +  E   L+   L 
Sbjct: 131 LPILERKLYDSAKKLLEDEISFALEKTPKEVETLLLAKLE 170


>gi|302542946|ref|ZP_07295288.1| transcription-repair coupling factor [Streptomyces hygroscopicus
           ATCC 53653]
 gi|302460564|gb|EFL23657.1| transcription-repair coupling factor [Streptomyces himastatinicus
           ATCC 53653]
          Length = 1177

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 59/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G+ IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 487 MPARRRKTIDPLTLEAGDFIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 537

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 538 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 597

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 598 LYSARMAAPGHAFGADTPWQR---ELEDAFPYAETPDQLTTIGEVKEDMEKSVP 648


>gi|229119116|ref|ZP_04248445.1| Transcriptional regulator, CarD [Bacillus cereus Rock1-3]
 gi|228664336|gb|EEL19848.1| Transcriptional regulator, CarD [Bacillus cereus Rock1-3]
          Length = 158

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 42/152 (27%), Positives = 80/152 (52%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E++G K  ++VI      M + +P GK +   +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKELSGKKQLYYVIKMSISNMQVMIPTGKILSSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   +   +++ +     +   W +R +    KI +G++   AEV+RDL R   +   +
Sbjct: 66  IDILALTHIIQIFQHGESDELLPWKQRHKVNTDKIKTGEIQKGAEVIRDLIRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   +V E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDAYKFLVSELELIKGITEKQIKSF 157


>gi|311743167|ref|ZP_07716975.1| transcription-repair coupling factor [Aeromicrobium marinum DSM
           15272]
 gi|311313847|gb|EFQ83756.1| transcription-repair coupling factor [Aeromicrobium marinum DSM
           15272]
          Length = 1169

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 62/179 (34%), Gaps = 22/179 (12%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAF-----DKDKM 55
           M  ++++         G+H+V+  HGVG   E+  + V G   E+ VI +      +   
Sbjct: 486 MPTRRRKQVDPLELSPGDHVVHEQHGVGRYVELVNRVVQGAAREYLVIEYGSSKRGQPAD 545

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L +P+ +   I      E+  ++R             + W+ R      K         
Sbjct: 546 RLFLPMDQLDQISRYVGGESPTLDRL----------GGSDWTNR----KNKARKAVRQIA 591

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            E+++      S    ++     +++    +    A V +  +   I  ++ ++     
Sbjct: 592 GELIKLYAARQSTQGHAFGPDTPWQA---ELEDAFAYVETPDQLSTIEEVKRDMERVVP 647


>gi|304439404|ref|ZP_07399316.1| CarD family transcriptional regulator [Peptoniphilus duerdenii ATCC
           BAA-1640]
 gi|304372186|gb|EFM25780.1| CarD family transcriptional regulator [Peptoniphilus duerdenii ATCC
           BAA-1640]
          Length = 160

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 44/142 (30%), Positives = 81/142 (57%), Gaps = 1/142 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            +  G+ +VYP HG G I +I+++E+ G    ++++     +M + VPV +A +IG+R +
Sbjct: 1   MYSIGDKVVYPMHGAGVIVDIEKKEILGEIRNYYILKMPIQEMKVMVPVEQAEEIGVRPI 60

Query: 73  SEAHFVERALKLVR-GKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                ++  L+ ++  K     + W+RR +    KI +GD++ IA+VVR L R D++   
Sbjct: 61  YGTEEMKEVLETLQSDKKLDMPSNWNRRFRFSTEKIKTGDIVEIAKVVRCLVRMDNEKNL 120

Query: 132 SYSERQLYESALNRMVREIAAV 153
           S  ER+L  +A   +V E+A +
Sbjct: 121 STGERKLLNNAKKIIVSEMALI 142


>gi|321314162|ref|YP_004206449.1| putative transcriptional regulator [Bacillus subtilis BSn5]
 gi|320020436|gb|ADV95422.1| putative transcriptional regulator [Bacillus subtilis BSn5]
          Length = 158

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 79/153 (51%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
             F+ G++IVYP HG G I  I+E+E    K +++VI      M + +P  K +   +R 
Sbjct: 5   DMFQIGDNIVYPMHGAGIIEAIEEKEFLEEKQQYYVIRMSISNMTVMIPTRKILSSNIRP 64

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
           +++   ++  + + +     +   W +R +    KI +G++   AEVVRDL R   +   
Sbjct: 65  VTDILALKHIMHIFQHGESDRLLPWKQRYKINTDKIKTGEIQEGAEVVRDLMRMKKEKAL 124

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINL 164
           + SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 125 NASEKKMLDNAYEFLISELEVIKGITEKQIKSF 157


>gi|239930800|ref|ZP_04687753.1| transcriptional-repair coupling factor [Streptomyces ghanaensis
           ATCC 14672]
 gi|291439165|ref|ZP_06578555.1| transcriptional-repair coupling factor [Streptomyces ghanaensis
           ATCC 14672]
 gi|291342060|gb|EFE69016.1| transcriptional-repair coupling factor [Streptomyces ghanaensis
           ATCC 14672]
          Length = 1185

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G+HIV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 494 MPARRRKTIDPLTLEAGDHIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 544

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 545 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 604

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 605 LYSARMAAPGHAFGADTPWQR---ELEDAFPYAETPDQLTTIAEVKEDMEKSVP 655


>gi|295838353|ref|ZP_06825286.1| transcription-repair coupling factor [Streptomyces sp. SPB74]
 gi|295826975|gb|EDY42784.2| transcription-repair coupling factor [Streptomyces sp. SPB74]
          Length = 1108

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 62/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++        TG++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 490 MPVRRRKSIDPLTLETGDYIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 540

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 541 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 600

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I+ ++ ++     
Sbjct: 601 LYSARMAAPGHAFGPDTPWQR---ELEDAFPYAETPDQLTTISEVKSDMEKTVP 651


>gi|118475824|ref|YP_892975.1| transcription-repair coupling factor [Bacillus thuringiensis str.
           Al Hakam]
 gi|118415049|gb|ABK83468.1| transcription-repair coupling factor [Bacillus thuringiensis str.
           Al Hakam]
          Length = 1207

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 513 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 571

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 572 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 619

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 620 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 675


>gi|226360810|ref|YP_002778588.1| hypothetical protein ROP_13960 [Rhodococcus opacus B4]
 gi|226239295|dbj|BAH49643.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 169

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 69/155 (44%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
              G+  +YP HG  T+T++  +    +  E+      +  + +++PV KA  +G+R   
Sbjct: 3   LNIGDIFLYPHHGSVTVTKLTTRMFKDLPTEYVQFEVAQTGLSIEIPVAKAEALGVRNAI 62

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               VER   ++RG      + WSRR +    K+  G +  ++EV+RDL     +   S 
Sbjct: 63  SNDEVERVFDILRGPTVDDPSNWSRRYKANQEKLTVGGIFTVSEVIRDLMTRAQEKPLSA 122

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVN 168
            E++  E A+  ++ E+         +    IE  
Sbjct: 123 GEKRQLEHAMQLVISELVLAMKSDPDDTRRRIEEI 157


>gi|118478884|ref|YP_896035.1| CarD family transcriptional regulator [Bacillus thuringiensis str.
           Al Hakam]
 gi|118418109|gb|ABK86528.1| transcriptional regulator, CarD family [Bacillus thuringiensis str.
           Al Hakam]
          Length = 167

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 81/151 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E+AG K +++VI      M + +P GK ++  +R ++
Sbjct: 16  FQIGDNIVYPMQGAGIIKAIEEKEIAGEKQQYYVIKMSASNMEIMIPEGKILNSNIRPVT 75

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 76  DIKALIHIIDIFQHGESDRLLTWKQRYKVNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 135

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 136 SEKKMLDNAHEFLISELGLIEGITENQIKSF 166


>gi|302560241|ref|ZP_07312583.1| transcription-repair coupling factor [Streptomyces griseoflavus
           Tu4000]
 gi|302477859|gb|EFL40952.1| transcription-repair coupling factor [Streptomyces griseoflavus
           Tu4000]
          Length = 1187

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G+HIV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 496 MPARRRKTIDPLTLEAGDHIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 546

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 547 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 606

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 607 LYSARMAAPGHAFGADSPWQR---ELEDAFPYAETPDQLTTIAEVKEDMEKSVP 657


>gi|194015928|ref|ZP_03054543.1| CarD family transcriptional regulator [Bacillus pumilus ATCC 7061]
 gi|194012283|gb|EDW21850.1| CarD family transcriptional regulator [Bacillus pumilus ATCC 7061]
          Length = 153

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 39/152 (25%), Positives = 74/152 (48%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +  K +++VI      M + +P  K     +R +
Sbjct: 1   MFQIGDNIVYPMHGAGIIEAIEEKEFSDEKQQYYVINMSISHMKVMIPTRKISGSRIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   +   + + +     +   W  R      KI +G +   AEVVRDL R   +   +
Sbjct: 61  TDILALNNVMDIFQHGESDQIPTWKERHTINTNKIKTGSIQDGAEVVRDLMRMKKEKALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++ + A   ++ E+  +  I+E +  + 
Sbjct: 121 ASEKKMLDDAHEFLLSELEVIKGITEKQIKSF 152


>gi|228943459|ref|ZP_04105903.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228976286|ref|ZP_04136757.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228783390|gb|EEM31498.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228816239|gb|EEM62420.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           berliner ATCC 10792]
          Length = 158

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 44/152 (28%), Positives = 84/152 (55%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +G K +++VI     KM + +P GK ++  +R +
Sbjct: 6   MFQIGDNIVYPMHGAGIIEAIEEKEFSGKKQQYYVIKMSISKMQVMIPKGKILNSNIRPV 65

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + + +   K   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 66  TDILALKHIIHIFQHEESCKLLPWKQRHKVNTDKIKTGEIQEGAEVVRDLMRMKKEKALN 125

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L + A   ++ E+  +  I+E +  + 
Sbjct: 126 TSEKKLLDDAYKFLISELELIKGITENQIKSF 157


>gi|220918135|ref|YP_002493439.1| transcriptional regulator, CarD family [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219955989|gb|ACL66373.1| transcriptional regulator, CarD family [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 404

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 38/164 (23%), Positives = 76/164 (46%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
                + G+ +VYP  GV  +   + +++AG KLE   +  ++D   + VP GK   IG+
Sbjct: 26  AADELKPGDRVVYPNQGVCAVVGWEVKDIAGQKLELVRMTREEDGAAVMVPKGKVPSIGL 85

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           R+++    +E     +          W  R ++   ++ +G ++ +AEVV+ LH      
Sbjct: 86  RRVATGAQMEGVFHYLGAVYDDPELDWKVRHRDNADRLIAGGVLGVAEVVKGLHSLSRLR 145

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
                ER+ Y++A + +V E++    +    A + I+  L   +
Sbjct: 146 PLPTKEREQYDNARHLLVHEVSVSLGVPPGLAEDYIDYALMPPA 189


>gi|297157723|gb|ADI07435.1| transcription-repair coupling factor [Streptomyces bingchenggensis
           BCW-1]
          Length = 1200

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++       + G+ IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 486 MPARRRKTIDPLSLQAGDFIVHEQHGVGRYIEMVQRTVQGATREYLV---------VEYA 536

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 537 PAKRGQPGDRLFVPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 596

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 597 LYSARMAAPGHAFGADTPWQR---ELEDAFPYAETPDQLTTIGEVKEDMEKSVP 647


>gi|90021441|ref|YP_527268.1| transcription-repair coupling protein Mfd [Saccharophagus degradans
           2-40]
 gi|89951041|gb|ABD81056.1| transcription-repair coupling factor [Saccharophagus degradans
           2-40]
          Length = 1153

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G  +V+  HGVG    ++  E  G K EF V+ +   +  L VPV     I    
Sbjct: 482 TELKIGAPVVHIEHGVGRYLGLQTIEFDGQKDEFLVLEYAN-EAKLYVPVANLHFISRYS 540

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E                    + S + Q+   K         AE++    +  ++   
Sbjct: 541 GAEDSSAP------------LNRLGSDQWQKAKRKAAEKLRDVAAELLEIYAKRQAREGF 588

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            Y+     + A            ++ + +AI+ +  ++ S   
Sbjct: 589 QYT---YPKDAYEIFAESFPFEETVDQQQAIDAVRQDMISAQP 628


>gi|134097431|ref|YP_001103092.1| transcription-repair coupling factor [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291004579|ref|ZP_06562552.1| transcription-repair coupling factor [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133910054|emb|CAM00166.1| transcription-repair coupling factor [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 1195

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 59/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        + G+ +V+  HG+G   E+ ++ V G   E+ V         L+  
Sbjct: 494 MPSRRRNAVDPLALKAGDFVVHEQHGIGKYVEMVQRTVGGATREYLV---------LEYA 544

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       ++   + V G+      +     +   AK         AE+V+
Sbjct: 545 SSKRGQPGDRLFVPTDQLDEVSRYVGGELPTLNKLGGSDWKNTKAKARKAVKEIAAELVQ 604

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 S P  ++     ++     +        +  +  AI+ ++ ++     
Sbjct: 605 LYAARQSAPGHAFGADTPWQR---ELEDAFPYTETGDQLAAIDEVKADMQRAVP 655


>gi|126729844|ref|ZP_01745657.1| transcription-repair coupling factor [Sagittula stellata E-37]
 gi|126709963|gb|EBA09016.1| transcription-repair coupling factor [Sagittula stellata E-37]
          Length = 1159

 Score =  107 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 50/176 (28%), Gaps = 22/176 (12%)

Query: 2   TFQQKRD---AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLK 58
             ++K +      Q    G+ +V+  HG+G    ++    AG   E  ++ +  +   L 
Sbjct: 468 AKRRKAENFLTEHQSLSPGDLVVHVDHGIGRYMGMEVITAAGSPHECLLLQYA-EDAKLY 526

Query: 59  VPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEV 118
           +PV     +           E  L  + G A           Q   AK+          +
Sbjct: 527 LPVENIELLSKY-----GHDEGLLDRLGGGA----------WQAKKAKLKERIREMADRL 571

Query: 119 VRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +R       +             A            +  +  AI  +  +L S   
Sbjct: 572 IRIAAERALRKAPML---DPPPGAYESFAARFPYSETDDQLAAIEDVMDDLQSGQP 624


>gi|317120949|ref|YP_004100952.1| transcription-repair coupling factor [Thermaerobacter marianensis
           DSM 12885]
 gi|315590929|gb|ADU50225.1| transcription-repair coupling factor [Thermaerobacter marianensis
           DSM 12885]
          Length = 1219

 Score =  107 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 21/177 (11%), Positives = 56/177 (31%), Gaps = 20/177 (11%)

Query: 2   TFQQKRDAMRQG----FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCL 57
           T   + +          + G+++V+  HG+G    ++  E+ G+  ++  I +      L
Sbjct: 499 TAADRAETQALERLVDLKPGDYVVHVHHGIGRFLGLRTMEIQGVHRDYLTIQYAGGD-RL 557

Query: 58  KVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAE 117
            VP  +   +     +E H    A             + S    +   ++         E
Sbjct: 558 YVPTDQIELVQKYVGAEGHQPRLA------------KLGSGEWNKVKQRVKESVRELAGE 605

Query: 118 VVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++       +    ++     ++    +         +  + EAI  I+ ++     
Sbjct: 606 LLALYAARQTLRGHAFGPDTPWQR---QFEDAFPYQETPDQLEAIAAIKADMERPVP 659


>gi|254724194|ref|ZP_05185979.1| transcription-repair coupling factor [Bacillus anthracis str.
           A1055]
          Length = 1176

 Score =  107 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|228992334|ref|ZP_04152265.1| Transcriptional regulator, CarD [Bacillus pseudomycoides DSM 12442]
 gi|228767359|gb|EEM15991.1| Transcriptional regulator, CarD [Bacillus pseudomycoides DSM 12442]
          Length = 158

 Score =  107 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 81/151 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E++G K +++VI      M + +P GK +   +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEISGEKQQYYVIKMSASNMEVMIPTGKILSSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   + R + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALTRIIDIFQHGESDRLLTWKQRYKVNTDKIKTGKIQEGAEVVRDLMRMQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIKGITENQMKSF 157


>gi|229027900|ref|ZP_04184055.1| Transcription-repair-coupling factor [Bacillus cereus AH1271]
 gi|228733414|gb|EEL84241.1| Transcription-repair-coupling factor [Bacillus cereus AH1271]
          Length = 1176

 Score =  107 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|228912793|ref|ZP_04076441.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228846853|gb|EEM91857.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 1176

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|229159227|ref|ZP_04287252.1| Transcription-repair-coupling factor [Bacillus cereus R309803]
 gi|228624242|gb|EEK81043.1| Transcription-repair-coupling factor [Bacillus cereus R309803]
          Length = 1176

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|196036345|ref|ZP_03103742.1| transcription-repair coupling factor [Bacillus cereus W]
 gi|196041756|ref|ZP_03109046.1| transcription-repair coupling factor [Bacillus cereus NVH0597-99]
 gi|196047377|ref|ZP_03114590.1| transcription-repair coupling factor [Bacillus cereus 03BB108]
 gi|218901255|ref|YP_002449089.1| transcription-repair coupling factor [Bacillus cereus AH820]
 gi|225862106|ref|YP_002747484.1| transcription-repair coupling factor [Bacillus cereus 03BB102]
 gi|228925307|ref|ZP_04088404.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228931556|ref|ZP_04094463.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228943860|ref|ZP_04106246.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229089185|ref|ZP_04220467.1| Transcription-repair-coupling factor [Bacillus cereus Rock3-42]
 gi|229119716|ref|ZP_04248978.1| Transcription-repair-coupling factor [Bacillus cereus 95/8201]
 gi|229182448|ref|ZP_04309700.1| Transcription-repair-coupling factor [Bacillus cereus BGSC 6E1]
 gi|301051789|ref|YP_003790000.1| transcription-repair coupling factor [Bacillus anthracis CI]
 gi|195990975|gb|EDX54946.1| transcription-repair coupling factor [Bacillus cereus W]
 gi|196021779|gb|EDX60473.1| transcription-repair coupling factor [Bacillus cereus 03BB108]
 gi|196027376|gb|EDX65993.1| transcription-repair coupling factor [Bacillus cereus NVH0597-99]
 gi|218538935|gb|ACK91333.1| transcription-repair coupling factor [Bacillus cereus AH820]
 gi|225786910|gb|ACO27127.1| transcription-repair coupling factor [Bacillus cereus 03BB102]
 gi|228601028|gb|EEK58596.1| Transcription-repair-coupling factor [Bacillus cereus BGSC 6E1]
 gi|228663741|gb|EEL19319.1| Transcription-repair-coupling factor [Bacillus cereus 95/8201]
 gi|228694148|gb|EEL47829.1| Transcription-repair-coupling factor [Bacillus cereus Rock3-42]
 gi|228815817|gb|EEM62052.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228828108|gb|EEM73835.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228834354|gb|EEM79894.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|300373958|gb|ADK02862.1| transcription-repair coupling factor [Bacillus cereus biovar
           anthracis str. CI]
          Length = 1176

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|30260244|ref|NP_842621.1| transcription-repair coupling factor [Bacillus anthracis str. Ames]
 gi|47525306|ref|YP_016655.1| transcription-repair coupling factor [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49183087|ref|YP_026339.1| transcription-repair coupling factor [Bacillus anthracis str.
           Sterne]
 gi|65317513|ref|ZP_00390472.1| COG1197: Transcription-repair coupling factor (superfamily II
           helicase) [Bacillus anthracis str. A2012]
 gi|165872560|ref|ZP_02217192.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0488]
 gi|167635067|ref|ZP_02393384.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0442]
 gi|167641515|ref|ZP_02399763.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0193]
 gi|170688877|ref|ZP_02880079.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0465]
 gi|170707542|ref|ZP_02897995.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0389]
 gi|177655328|ref|ZP_02936857.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0174]
 gi|190568951|ref|ZP_03021852.1| transcription-repair coupling factor [Bacillus anthracis
           Tsiankovskii-I]
 gi|227812727|ref|YP_002812736.1| transcription-repair coupling factor [Bacillus anthracis str. CDC
           684]
 gi|229603766|ref|YP_002864705.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0248]
 gi|254682320|ref|ZP_05146181.1| transcription-repair coupling factor [Bacillus anthracis str.
           CNEVA-9066]
 gi|254735455|ref|ZP_05193163.1| transcription-repair coupling factor [Bacillus anthracis str.
           Western North America USA6153]
 gi|254744643|ref|ZP_05202322.1| transcription-repair coupling factor [Bacillus anthracis str.
           Kruger B]
 gi|254756348|ref|ZP_05208377.1| transcription-repair coupling factor [Bacillus anthracis str.
           Vollum]
 gi|254762404|ref|ZP_05214246.1| transcription-repair coupling factor [Bacillus anthracis str.
           Australia 94]
 gi|30253565|gb|AAP24107.1| transcription-repair coupling factor [Bacillus anthracis str. Ames]
 gi|47500454|gb|AAT29130.1| transcription-repair coupling factor [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49177014|gb|AAT52390.1| transcription-repair coupling factor [Bacillus anthracis str.
           Sterne]
 gi|164711688|gb|EDR17233.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0488]
 gi|167510500|gb|EDR85898.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0193]
 gi|167529541|gb|EDR92291.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0442]
 gi|170127538|gb|EDS96412.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0389]
 gi|170667101|gb|EDT17862.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0465]
 gi|172080169|gb|EDT65262.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0174]
 gi|190559875|gb|EDV13859.1| transcription-repair coupling factor [Bacillus anthracis
           Tsiankovskii-I]
 gi|227004902|gb|ACP14645.1| transcription-repair coupling factor [Bacillus anthracis str. CDC
           684]
 gi|229268174|gb|ACQ49811.1| transcription-repair coupling factor [Bacillus anthracis str.
           A0248]
          Length = 1176

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|302551963|ref|ZP_07304305.1| transcription-repair coupling factor [Streptomyces
           viridochromogenes DSM 40736]
 gi|302469581|gb|EFL32674.1| transcription-repair coupling factor [Streptomyces
           viridochromogenes DSM 40736]
          Length = 1177

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G++IV+  HGVG   E+ ++ V G   E+ V         ++  
Sbjct: 486 MPARRRKTIDPLTLEAGDYIVHEQHGVGRYIEMVQRVVQGATREYLV---------VEYA 536

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +E+  K V G+A     +      +  A+         A++++
Sbjct: 537 PAKRGQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIK 596

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +   I  ++ ++     
Sbjct: 597 LYSARMAAPGHAFGADTPWQR---ELEDAFPYAETPDQLTTIAEVKEDMEKTVP 647


>gi|52145163|ref|YP_081665.1| transcription-repair coupling factor [Bacillus cereus E33L]
 gi|51978632|gb|AAU20182.1| transcription-repair coupling factor [Bacillus cereus E33L]
          Length = 1176

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|228998394|ref|ZP_04157985.1| Transcriptional regulator, CarD [Bacillus mycoides Rock3-17]
 gi|229005881|ref|ZP_04163575.1| Transcriptional regulator, CarD [Bacillus mycoides Rock1-4]
 gi|228755345|gb|EEM04696.1| Transcriptional regulator, CarD [Bacillus mycoides Rock1-4]
 gi|228761315|gb|EEM10270.1| Transcriptional regulator, CarD [Bacillus mycoides Rock3-17]
          Length = 158

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/151 (26%), Positives = 80/151 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E++G K +++VI      M + +P GK +   +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEISGEKQQYYVIKMSASNMEVMIPTGKILSSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALTHIIDIFQHGESDRLLTWKQRYKVNTDKIKTGKIQEGAEVVRDLMRMQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIKGITENQMKSF 157


>gi|296128756|ref|YP_003636006.1| transcription-repair coupling factor [Cellulomonas flavigena DSM
           20109]
 gi|296020571|gb|ADG73807.1| transcription-repair coupling factor [Cellulomonas flavigena DSM
           20109]
          Length = 1214

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/178 (15%), Positives = 60/178 (33%), Gaps = 16/178 (8%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAG----MKLEFFVIAFDKDKMC 56
           M  +++        R G+ +V+  HGVG   E+ ++ +         E+ V+ +   K  
Sbjct: 513 MPSRRRNVVDPLQLRPGDFVVHEQHGVGRFVELVQRTIGSGAAAATREYLVVEYASSK-- 570

Query: 57  LKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIA 116
                      G R       +++  K V G+A     M     Q+   +         A
Sbjct: 571 -------RGQPGDRLYVPTDQLDQVTKYVGGEAPTLNRMGGADWQKTKGRARKAVKEIAA 623

Query: 117 EVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           E++R      + P  ++     ++     +    A V +  +   I  ++ ++     
Sbjct: 624 ELIRLYSARMATPGHAFGPDTPWQR---ELEDAFAYVETPDQLATIEEVKADMEKTVP 678


>gi|42779132|ref|NP_976379.1| transcription-repair coupling factor [Bacillus cereus ATCC 10987]
 gi|206977924|ref|ZP_03238811.1| transcription-repair coupling factor [Bacillus cereus H3081.97]
 gi|217957629|ref|YP_002336171.1| transcription-repair coupling factor [Bacillus cereus AH187]
 gi|222093823|ref|YP_002527872.1| transcription-repair coupling factor [Bacillus cereus Q1]
 gi|229136900|ref|ZP_04265528.1| Transcription-repair-coupling factor [Bacillus cereus BDRD-ST26]
 gi|42735047|gb|AAS38987.1| transcription-repair coupling factor [Bacillus cereus ATCC 10987]
 gi|206743830|gb|EDZ55250.1| transcription-repair coupling factor [Bacillus cereus H3081.97]
 gi|217067660|gb|ACJ81910.1| transcription-repair coupling factor [Bacillus cereus AH187]
 gi|221237870|gb|ACM10580.1| transcription-repair coupling factor [Bacillus cereus Q1]
 gi|228646565|gb|EEL02771.1| Transcription-repair-coupling factor [Bacillus cereus BDRD-ST26]
          Length = 1176

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|47569902|ref|ZP_00240569.1| transcription-repair coupling factor [Bacillus cereus G9241]
 gi|228983309|ref|ZP_04143523.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|229194444|ref|ZP_04321248.1| Transcription-repair-coupling factor [Bacillus cereus m1293]
 gi|47553436|gb|EAL11820.1| transcription-repair coupling factor [Bacillus cereus G9241]
 gi|228589034|gb|EEK47048.1| Transcription-repair-coupling factor [Bacillus cereus m1293]
 gi|228776423|gb|EEM24775.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 1176

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|324324043|gb|ADY19303.1| transcription-repair coupling factor [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 1176

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|229153832|ref|ZP_04281963.1| Transcription-repair-coupling factor [Bacillus cereus ATCC 4342]
 gi|228629636|gb|EEK86332.1| Transcription-repair-coupling factor [Bacillus cereus ATCC 4342]
          Length = 1176

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|49479988|ref|YP_034406.1| transcription-repair coupling factor [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|49331544|gb|AAT62190.1| transcription-repair coupling factor [Bacillus thuringiensis
           serovar konkukian str. 97-27]
          Length = 1178

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 484 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 542

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 543 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 590

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 591 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 646


>gi|229075538|ref|ZP_04208525.1| Transcriptional regulator, CarD [Bacillus cereus Rock4-18]
 gi|229098087|ref|ZP_04229035.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-29]
 gi|229104182|ref|ZP_04234854.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-28]
 gi|229117105|ref|ZP_04246484.1| Transcriptional regulator, CarD [Bacillus cereus Rock1-3]
 gi|228666273|gb|EEL21736.1| Transcriptional regulator, CarD [Bacillus cereus Rock1-3]
 gi|228679199|gb|EEL33404.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-28]
 gi|228685278|gb|EEL39208.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-29]
 gi|228707517|gb|EEL59703.1| Transcriptional regulator, CarD [Bacillus cereus Rock4-18]
          Length = 158

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 82/151 (54%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E+AG K +++VI    + M + +P GK ++  +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEIAGKKQQYYVIKMSANNMEIMIPEGKILNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALIHIIDIFQHGESDRLLTWKQRYKVNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITENQIKSF 157


>gi|228956495|ref|ZP_04118292.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228803185|gb|EEM50006.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 1183

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 489 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 547

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 548 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 595

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 596 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 651


>gi|229142859|ref|ZP_04271302.1| Transcription-repair-coupling factor [Bacillus cereus BDRD-ST24]
 gi|228640622|gb|EEK97009.1| Transcription-repair-coupling factor [Bacillus cereus BDRD-ST24]
          Length = 1183

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 489 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 547

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 548 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 595

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 596 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 651


>gi|229197758|ref|ZP_04324477.1| Transcriptional regulator, CarD [Bacillus cereus m1293]
 gi|228585703|gb|EEK43802.1| Transcriptional regulator, CarD [Bacillus cereus m1293]
          Length = 158

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 80/151 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E+AG K +++VI      M + +P GK +   +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEIAGKKQQYYVIKMSASNMEIMIPEGKILSSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALIHIINIFQHGESDRLLTWKQRYKLNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITENQIKSF 157


>gi|256824567|ref|YP_003148527.1| transcription-repair coupling factor Mfd [Kytococcus sedentarius
           DSM 20547]
 gi|256687960|gb|ACV05762.1| transcription-repair coupling factor Mfd [Kytococcus sedentarius
           DSM 20547]
          Length = 1244

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 61/180 (33%), Gaps = 24/180 (13%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD-----KDKM 55
           M  ++++         G+ IV+  HGVG   E+ ++ V G   E+ V+ +      +   
Sbjct: 544 MPSRRRKMVDPLQLNPGDFIVHEQHGVGRFIEMVQRTVGGATREYLVLEYASSKRGQPAD 603

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP  +   I      EA      L  + G                 +K  S     +
Sbjct: 604 RLFVPTDQLDQITRYVGGEAPS----LNRLGGAD--------------WSKTKSKARKHV 645

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNR-MVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++  +L +  S    +       +S   R +    A + +  +  +I  ++ ++     
Sbjct: 646 KQIANELIQLYSARMATQGHAFAPDSPWQRELEDTFAYIETTDQLSSIEEVKADMEKSVP 705


>gi|228937356|ref|ZP_04100003.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228976812|ref|ZP_04137225.1| Transcription-repair-coupling factor [Bacillus thuringiensis Bt407]
 gi|228782908|gb|EEM31073.1| Transcription-repair-coupling factor [Bacillus thuringiensis Bt407]
 gi|228822314|gb|EEM68295.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 1183

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 489 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 547

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 548 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 595

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 596 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 651


>gi|75759615|ref|ZP_00739701.1| Transcription-repair coupling factor [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|74492906|gb|EAO56036.1| Transcription-repair coupling factor [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
          Length = 1186

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 492 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 550

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 551 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 598

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 599 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 654


>gi|161506855|ref|YP_001576809.1| transcriptional repair coupling factor [Lactobacillus helveticus
           DPC 4571]
 gi|160347844|gb|ABX26518.1| transcriptional repair coupling factor [Lactobacillus helveticus
           DPC 4571]
          Length = 1165

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G+K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGVKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 ASE------------GKTPHINKLGGSEWAKIKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I  I+ ++     
Sbjct: 596 AFSPDDDLQ---KQFEDAFPYAETPDQLRSIKEIKEDMEKPKP 635


>gi|159899175|ref|YP_001545422.1| transcription-repair coupling factor [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159892214|gb|ABX05294.1| transcription-repair coupling factor [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 1207

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 58/179 (32%), Gaps = 22/179 (12%)

Query: 2   TFQQKRDAM------RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
           T  +K+          Q  + G+++V+  HG+     +   E +G + EF V+ +     
Sbjct: 488 TRARKQRTESDRTAFLQSLKVGDYVVHIEHGIAQYEGLSRIEASGAEREFLVLRYA-SGD 546

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VPV +   +     +      +      G +  +R     RA   +      DL A 
Sbjct: 547 KLYVPVDQVDRVSRYIGAGEG---KPTLTRLGTSDWERAKRKVRADVEELATELLDLYAA 603

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++V     +     +              +        +  +  AI  ++ ++ +   
Sbjct: 604 RQLVEGFAYSSDTSWQ------------RELEDSFPYTETDDQLRAIEEVKSDMENTRP 650


>gi|323465804|gb|ADX69491.1| Transcriptional repair coupling factor [Lactobacillus helveticus
           H10]
          Length = 1165

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 56/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G+K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGVKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 ASE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         ++ +  +I  I+ ++     
Sbjct: 596 AFSPDDDLQ---KQFEDAFPYAETLDQLRSIKEIKEDMEKPKP 635


>gi|229083372|ref|ZP_04215723.1| Transcription-repair-coupling factor [Bacillus cereus Rock3-44]
 gi|228699937|gb|EEL52571.1| Transcription-repair-coupling factor [Bacillus cereus Rock3-44]
          Length = 1176

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|42523769|ref|NP_969149.1| putative CarD-like transcriptional regulator [Bdellovibrio
           bacteriovorus HD100]
 gi|39575976|emb|CAE80142.1| putative CarD-like transcriptional regulator [Bdellovibrio
           bacteriovorus HD100]
          Length = 164

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/150 (28%), Positives = 79/150 (52%), Gaps = 3/150 (2%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           Q F  G++ VYP +GV  +  I+ +E+ G K  F+ +      + + +P       G+R 
Sbjct: 2   QTFDVGDNAVYPGYGVVKVVSIETKEMLGTKTTFYNMQLVDTGLKIMIPTTNVKSAGLRP 61

Query: 72  LSEAHFVERALKLVRGKA-RVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
           +       R + +++ K  ++    W+RR +EY  KI +G +  IAEV+RDL    +  E
Sbjct: 62  IISKSEASRVVGILKEKDIKIDNQTWNRRYREYMEKIKTGSVFEIAEVLRDLFLLKADKE 121

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPE 160
            S+ ER++ +SA + +++E+    + S+ E
Sbjct: 122 LSFGERKMLDSARSLLLKEL--TLATSQEE 149


>gi|228970242|ref|ZP_04130902.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228789477|gb|EEM37396.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|326937845|gb|AEA13741.1| transcription-repair coupling factor [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 1176

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|229039959|ref|ZP_04189723.1| Transcription-repair-coupling factor [Bacillus cereus AH676]
 gi|229107740|ref|ZP_04237377.1| Transcription-repair-coupling factor [Bacillus cereus Rock1-15]
 gi|296500886|ref|YP_003662586.1| transcription-repair coupling factor [Bacillus thuringiensis
           BMB171]
 gi|228675713|gb|EEL30920.1| Transcription-repair-coupling factor [Bacillus cereus Rock1-15]
 gi|228727367|gb|EEL78560.1| Transcription-repair-coupling factor [Bacillus cereus AH676]
 gi|296321938|gb|ADH04866.1| transcription-repair coupling factor [Bacillus thuringiensis
           BMB171]
          Length = 1176

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|49479453|ref|YP_037723.1| CarD family transcriptional regulator [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|206976148|ref|ZP_03237057.1| transcriptional regulator, CarD family [Bacillus cereus H3081.97]
 gi|217961056|ref|YP_002339624.1| transcriptional regulator, CarD family [Bacillus cereus AH187]
 gi|222097108|ref|YP_002531165.1| transcriptional regulator, card family [Bacillus cereus Q1]
 gi|228986740|ref|ZP_04146870.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229140266|ref|ZP_04268823.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST26]
 gi|49331009|gb|AAT61655.1| transcriptional regulator, CarD family [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|206745602|gb|EDZ57000.1| transcriptional regulator, CarD family [Bacillus cereus H3081.97]
 gi|217063672|gb|ACJ77922.1| transcriptional regulator, CarD family [Bacillus cereus AH187]
 gi|221241166|gb|ACM13876.1| transcriptional regulator, CarD family [Bacillus cereus Q1]
 gi|228643199|gb|EEK99473.1| Transcriptional regulator, CarD [Bacillus cereus BDRD-ST26]
 gi|228773071|gb|EEM21507.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 158

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 81/151 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E+AG K +++VI      M + +P GK ++  +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEIAGKKQQYYVIKMSASNMEIMIPEGKILNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALIHIIDIFQHGESDRLLTWKQRYKVNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITENQIKSF 157


>gi|218231044|ref|YP_002364903.1| transcription-repair coupling factor [Bacillus cereus B4264]
 gi|218159001|gb|ACK58993.1| transcription-repair coupling factor [Bacillus cereus B4264]
          Length = 1176

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|15612632|ref|NP_240935.1| transcription-repair coupling factor (TRCF) [Bacillus halodurans
           C-125]
 gi|10172681|dbj|BAB03788.1| transcription-repair coupling factor (TRCF) [Bacillus halodurans
           C-125]
          Length = 1181

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/163 (12%), Positives = 57/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+ +V+  HG+G    I+  E+ G+  ++  I +  +   L VPV +   +    
Sbjct: 499 SELKVGDLVVHTNHGIGKYLGIETLEINGVHKDYLHIRYAGND-KLYVPVEQIDQVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E             K     ++     ++   ++ S       ++++     ++    
Sbjct: 558 GAE------------DKDPKLYSLGKSDWKKVKRRVQSSVEDIADDLIKLYAEREASKGF 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +++     E A            +  +  AI  I+ ++  +  
Sbjct: 606 AFAPDG-PEQAE--FEASFPYQETEDQLRAIQEIKEDMEKERP 645


>gi|295425671|ref|ZP_06818358.1| transcription-repair coupling factor [Lactobacillus amylolyticus
           DSM 11664]
 gi|295064687|gb|EFG55608.1| transcription-repair coupling factor [Lactobacillus amylolyticus
           DSM 11664]
          Length = 1165

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G+K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGVKRD-YITITYQHGDQLFVPADQLRLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++      +S+   
Sbjct: 548 ASE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLINLYAARESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +       V +  +  +I  I+ ++     
Sbjct: 596 AFSPDDELQR---KFDDAFPYVETPDQLRSIKEIKADMEKPKP 635


>gi|83588954|ref|YP_428963.1| transcription-repair coupling factor [Moorella thermoacetica ATCC
           39073]
 gi|83571868|gb|ABC18420.1| transcription-repair coupling factor [Moorella thermoacetica ATCC
           39073]
          Length = 1183

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 60/174 (34%), Gaps = 18/174 (10%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
             +  + +     + G+++V+  HG+G    +++ +V G+K ++ +I +      L VPV
Sbjct: 492 PREGSKISSFTDLKEGDYVVHVHHGIGRYLGLQQLDVGGVKKDYLLIQYAGKD-RLYVPV 550

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            +   +              L  + G                  K+ S    A+ E+ ++
Sbjct: 551 DQVSLVQKY--VGGEGHVPRLYRLGGNE--------------WNKVKSRVQEAVQEMAQE 594

Query: 122 LHRTDSQPEKSYSERQLYESALNR-MVREIAAVNSISEPEAINLIEVNLSSKSS 174
           L    ++ E         ++   R          +  +  AI  ++ ++     
Sbjct: 595 LLDLYARREAIPGHAFGPDTPWQREFEEAFPYTETPDQLRAIAEVKADMEKPRP 648


>gi|260102336|ref|ZP_05752573.1| transcription-repair coupling factor [Lactobacillus helveticus DSM
           20075]
 gi|260083845|gb|EEW67965.1| transcription-repair coupling factor [Lactobacillus helveticus DSM
           20075]
          Length = 1165

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G+K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGVKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 ASE------------GKTPHINKLGGSEWAKIKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I  I+ ++     
Sbjct: 596 AFSPDDDLQ---KQFEDAFPYAETPDQLRSIKEIKEDMEKPKP 635


>gi|229148463|ref|ZP_04276720.1| Transcription-repair-coupling factor [Bacillus cereus m1550]
 gi|228635005|gb|EEK91577.1| Transcription-repair-coupling factor [Bacillus cereus m1550]
          Length = 1176

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|30018324|ref|NP_829955.1| transcription-repair coupling factor [Bacillus cereus ATCC 14579]
 gi|229125571|ref|ZP_04254604.1| Transcription-repair-coupling factor [Bacillus cereus BDRD-Cer4]
 gi|29893864|gb|AAP07156.1| Transcription-repair coupling factor [Bacillus cereus ATCC 14579]
 gi|228657888|gb|EEL13693.1| Transcription-repair-coupling factor [Bacillus cereus BDRD-Cer4]
          Length = 1176

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|47567932|ref|ZP_00238639.1| CarD-like transcriptional regulator [Bacillus cereus G9241]
 gi|47555410|gb|EAL13754.1| CarD-like transcriptional regulator [Bacillus cereus G9241]
          Length = 158

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 80/151 (52%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E+AG K +++VI      M + +P GK +   +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEIAGEKQQYYVIKMSASNMEIMIPEGKILSSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DITALIHIIDIFQHGESDRLLTWKQRYKLNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITENQIKSF 157


>gi|228898807|ref|ZP_04063090.1| Transcription-repair-coupling factor [Bacillus thuringiensis IBL
           4222]
 gi|228860832|gb|EEN05209.1| Transcription-repair-coupling factor [Bacillus thuringiensis IBL
           4222]
          Length = 1176

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|228919004|ref|ZP_04082384.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228840653|gb|EEM85914.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 1176

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|229067818|ref|ZP_04201136.1| Transcription-repair-coupling factor [Bacillus cereus F65185]
 gi|228715302|gb|EEL67160.1| Transcription-repair-coupling factor [Bacillus cereus F65185]
          Length = 1176

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|322807864|emb|CBZ05439.1| transcription-repair coupling factor [Clostridium botulinum H04402
           065]
          Length = 1168

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/168 (17%), Positives = 57/168 (33%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +       + G+ +V+  HG+G    IK+ E+ G K ++           L VPV +   
Sbjct: 494 KIKSFTELKPGDFVVHANHGIGVFKGIKQLELQGNKKDYL-ELIYHSDDKLYVPVEQLDM 552

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     SE            GK      + S    +   K+         ++V+      
Sbjct: 553 VQRYIGSE------------GKKPKVSKLGSSEWTKTKNKVKKSIEEIAEDLVKLYAIRA 600

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           S     YS+  +++    +   E     +  +  AI  I+ ++ S   
Sbjct: 601 SLKGYKYSDDTVWQ---KQFEEEFPYEETPDQLLAIEDIKKDMESPKP 645


>gi|206972595|ref|ZP_03233538.1| transcription-repair coupling factor [Bacillus cereus AH1134]
 gi|228950602|ref|ZP_04112737.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|229176654|ref|ZP_04304059.1| Transcription-repair-coupling factor [Bacillus cereus 172560W]
 gi|206732497|gb|EDZ49676.1| transcription-repair coupling factor [Bacillus cereus AH1134]
 gi|228606821|gb|EEK64237.1| Transcription-repair-coupling factor [Bacillus cereus 172560W]
 gi|228809077|gb|EEM55561.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
          Length = 1176

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|218895189|ref|YP_002443600.1| transcription-repair coupling factor [Bacillus cereus G9842]
 gi|218545395|gb|ACK97789.1| transcription-repair coupling factor [Bacillus cereus G9842]
          Length = 1176

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|332971077|gb|EGK10047.1| transcription-repair coupling factor [Desmospora sp. 8437]
          Length = 1181

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 22/168 (13%), Positives = 62/168 (36%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +    Q  + G+++V+  HG+G     +  +V G+  ++ +I +  +   L VP+ +   
Sbjct: 493 KIKDYQELQPGDYVVHVNHGIGRYAGTETLDVGGIHKDYLLIQYAGND-KLYVPIEQIDQ 551

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     SE             K     ++      +   K+ S      +++++   +  
Sbjct: 552 VQKYLGSE------------EKTPKVYSLGGSEWSKVKNKVRSSVQDIASDLIKLYAKRQ 599

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           S+   ++S    Y+   + +        +  +  +I  I+ ++     
Sbjct: 600 SERGHAFSPDTPYQREFDAL---FPYEETADQLRSIEEIKKDMEKTQP 644


>gi|165870992|ref|ZP_02215643.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0488]
 gi|167641498|ref|ZP_02399747.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0193]
 gi|170709170|ref|ZP_02899595.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0389]
 gi|164713203|gb|EDR18729.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0488]
 gi|167510580|gb|EDR85977.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0193]
 gi|170125925|gb|EDS94827.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0389]
          Length = 153

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/152 (26%), Positives = 81/152 (53%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP  G G I  I+E+E+AG K +++VI      M + +P GK ++  +R +
Sbjct: 1   MFQIGDNIVYPMQGAGIIKAIEEKEIAGEKQQYYVIKMSASNMEIMIPEGKILNSNIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   +
Sbjct: 61  TDIKALIHIIDIFQHGESDRLLTWKQRYKVNTDKIKTGKMQEGAEVVRDLMRIQKEKALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 121 ASEKKMLDNAHEFLISELGLIEGITENQIKSF 152


>gi|229188339|ref|ZP_04315388.1| Transcription-repair-coupling factor [Bacillus cereus ATCC 10876]
 gi|228595138|gb|EEK52908.1| Transcription-repair-coupling factor [Bacillus cereus ATCC 10876]
          Length = 1176

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|328463460|gb|EGF35111.1| transcription-repair coupling factor [Lactobacillus helveticus MTCC
           5463]
          Length = 1055

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G+K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGVKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 ASE------------GKTPHINKLGGSEWAKIKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I  I+ ++     
Sbjct: 596 AFSPDDDLQ---KQFEDAFPYAETPDQLRSIKEIKEDMEKPKP 635


>gi|228963154|ref|ZP_04124324.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228796539|gb|EEM43977.1| Transcription-repair-coupling factor [Bacillus thuringiensis
           serovar sotto str. T04001]
          Length = 1067

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 373 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 431

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 432 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 479

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 480 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 535


>gi|320161444|ref|YP_004174668.1| transcription-repair coupling factor [Anaerolinea thermophila
           UNI-1]
 gi|319995297|dbj|BAJ64068.1| transcription-repair coupling factor [Anaerolinea thermophila
           UNI-1]
          Length = 1129

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 21/167 (12%), Positives = 58/167 (34%), Gaps = 16/167 (9%)

Query: 8   DAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDI 67
           +A    F+ G++IV+  +G+G    +  + V G++ E+      +    + VPV +A  +
Sbjct: 450 EAEYTDFKVGDYIVHVDYGIGRFAGLSRRTVDGVEREYL-AIEYEGGDTIFVPVYQADRL 508

Query: 68  GMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127
                        +L  + G                  ++    L    E++    +   
Sbjct: 509 TRY--VGPSGETPSLTHLGGTE----------WASVKQRVRESVLEVAQELLELYAKRQV 556

Query: 128 QPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
               ++S   +++     +      + +  + +AI  ++ ++     
Sbjct: 557 AKGHAFSPDTMWQ---KELEASFPYIETEDQIKAIQAVKRDMERPRP 600


>gi|220932952|ref|YP_002509860.1| transcription-repair coupling factor [Halothermothrix orenii H 168]
 gi|219994262|gb|ACL70865.1| transcription-repair coupling factor [Halothermothrix orenii H 168]
          Length = 1170

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 19/168 (11%), Positives = 57/168 (33%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           + +     + G+++V+  HG+G    +K   V G   ++ V+ +  +   L VP  +   
Sbjct: 496 KISSIDELQVGDYVVHENHGIGKYLGVKTLAVQGQHKDYLVLKYAGED-KLYVPTDQFNL 554

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     +              K      +     ++   K+          ++      +
Sbjct: 555 VQKYIGA------------DNKPPKLYKLGGNDWKKVKQKVKESVKEMAIGLLELYAERE 602

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +    S+S+  +++              +  + +AI  ++ ++ S + 
Sbjct: 603 TIKGYSFSDDTVWQ---KEFEEAFPYEETPDQLKAIEEVKNDMESATP 647


>gi|229074115|ref|ZP_04207162.1| Transcription-repair-coupling factor [Bacillus cereus Rock4-18]
 gi|229094775|ref|ZP_04225781.1| Transcription-repair-coupling factor [Bacillus cereus Rock3-29]
 gi|229113728|ref|ZP_04243164.1| Transcription-repair-coupling factor [Bacillus cereus Rock1-3]
 gi|228669725|gb|EEL25131.1| Transcription-repair-coupling factor [Bacillus cereus Rock1-3]
 gi|228688643|gb|EEL42515.1| Transcription-repair-coupling factor [Bacillus cereus Rock3-29]
 gi|228709009|gb|EEL61135.1| Transcription-repair-coupling factor [Bacillus cereus Rock4-18]
          Length = 1176

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETDDQLRSIEEIKKDMERGRP 644


>gi|229170904|ref|ZP_04298507.1| Transcription-repair-coupling factor [Bacillus cereus MM3]
 gi|228612570|gb|EEK69789.1| Transcription-repair-coupling factor [Bacillus cereus MM3]
          Length = 1176

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|229015456|ref|ZP_04172457.1| Transcription-repair-coupling factor [Bacillus cereus AH1273]
 gi|228745840|gb|EEL95841.1| Transcription-repair-coupling factor [Bacillus cereus AH1273]
          Length = 1176

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|228905850|ref|ZP_04069748.1| Transcription-repair-coupling factor [Bacillus thuringiensis IBL
           200]
 gi|228853790|gb|EEM98549.1| Transcription-repair-coupling factor [Bacillus thuringiensis IBL
           200]
          Length = 1176

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 644


>gi|119715169|ref|YP_922134.1| transcription-repair coupling factor [Nocardioides sp. JS614]
 gi|119535830|gb|ABL80447.1| transcription-repair coupling factor [Nocardioides sp. JS614]
          Length = 1224

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/179 (13%), Positives = 60/179 (33%), Gaps = 22/179 (12%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAF-----DKDKM 55
           M  ++KR         G+++V+  HGVG   E+K++EV G   E+ V+ +          
Sbjct: 526 MPARRKRQIDPLELSAGDYVVHEQHGVGRFVEMKQREVGGAVREYLVLEYGASKRGGPPD 585

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP      +      E   ++R               W++R      +         
Sbjct: 586 RLYVPADALDQVTRYVGGEQPSLDRL----------GGGDWTKR----KNRARKAVREIA 631

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           AE+++      +    ++     ++     +        +  +   ++ ++ ++     
Sbjct: 632 AELIKLYAARQATRGHAFGPDTPWQR---ELEDAFPFHETPDQLSTVDEVKGDMMRTVP 687


>gi|192358851|ref|YP_001982241.1| transcription-repair coupling protein Mfd [Cellvibrio japonicus
           Ueda107]
 gi|190685016|gb|ACE82694.1| transcription-repair coupling protein Mfd [Cellvibrio japonicus
           Ueda107]
          Length = 1184

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/163 (15%), Positives = 49/163 (30%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G  +V+  HGVG    ++   V     EF  + +      L VPV     I    
Sbjct: 513 TELKIGAPVVHIDHGVGRYRGLETITVDNQTNEFLTLEYAD-DAKLYVPVTSLHLISRYS 571

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E                    + S   Q+   K         AE++    R  ++   
Sbjct: 572 GAEDDLAP------------LHKLGSESWQKAKRKAAEQIRDTAAELLEVYARRAARKGF 619

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++ +    ++A            +  +  AI  +  ++ S   
Sbjct: 620 AFPD---PQTAYAAFSASFPFEETPDQQRAIEAVVKDMLSPKP 659


>gi|300790028|ref|YP_003770319.1| transcription-repair coupling factor [Amycolatopsis mediterranei
           U32]
 gi|299799542|gb|ADJ49917.1| transcription-repair coupling factor [Amycolatopsis mediterranei
           U32]
          Length = 1184

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 62/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        ++G+++V+  HG+G   E+ ++ VAG   E+ +         L+  
Sbjct: 485 MPSRRRNAVDPLALKSGDYVVHEQHGIGRFVEMVQRTVAGATREYLL---------LEYG 535

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       ++   K V G+      +     +   A+         AE+V+
Sbjct: 536 SSKRGHPGDRLFVPTDQLDEVSKYVGGELPTLNKLGGSDWKNTKARAKKAVKEIAAELVQ 595

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +  AI+ ++ ++     
Sbjct: 596 LYAARQAAPGHAFGPDTPWQ---GELEDAFPFTETNDQLAAIDEVKADMERGVP 646


>gi|149376584|ref|ZP_01894344.1| transcription-repair coupling protein Mfd [Marinobacter algicola
           DG893]
 gi|149359102|gb|EDM47566.1| transcription-repair coupling protein Mfd [Marinobacter algicola
           DG893]
          Length = 1038

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/180 (14%), Positives = 55/180 (30%), Gaps = 24/180 (13%)

Query: 3   FQQKRDAMR--------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
            ++++               R G  +V+  HGVG    ++   V G   EF ++ +    
Sbjct: 352 RRREKPTEADDAGYRDLSELRIGAPVVHIDHGVGRYQGLETITVEGEASEFLMLEYAG-G 410

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV     I     S+                    + + R      K        
Sbjct: 411 SKLYVPVSSLHLISRYTGSDTDHAP------------LHKLGTDRWSNAKQKALEKIRDT 458

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            AE++    R +++   ++ +    + A            +  +  AI  +  ++ S+  
Sbjct: 459 AAELLDVYARREARKGFAFED---PKEAYRAFAAGFPFEETPDQQAAIEAVFEDMVSEKP 515


>gi|228916274|ref|ZP_04079844.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228843472|gb|EEM88550.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 158

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/151 (26%), Positives = 81/151 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E+AG K +++VI      M + +P G+ ++  +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEIAGEKQQYYVIKMSASNMEIMIPEGEILNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DIKALIHIIDIFQHGESDRLLTWKQRYKVNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITENQIKSF 157


>gi|311066998|ref|YP_003971921.1| putative transcriptional regulator [Bacillus atrophaeus 1942]
 gi|310867515|gb|ADP30990.1| putative transcriptional regulator [Bacillus atrophaeus 1942]
          Length = 153

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/152 (25%), Positives = 80/152 (52%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E+E +  K +++VI      M + +P  K +   +R +
Sbjct: 1   MFQIGDNIVYPMHGAGIIEAIEEKEYSEEKQQYYVIKMSISNMQVMIPTRKILSSSIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + +     +   W +R +    KI +G++   AEVVRDL R   +   +
Sbjct: 61  TDILALKHIIHIFQHGESDRLLPWKQRYKVNTNKIKTGEIQEGAEVVRDLMRMKKEKALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 121 SSEKKMLDNAYEFLISELEVIKGITENQIKSF 152


>gi|229917410|ref|YP_002886056.1| transcription-repair coupling factor [Exiguobacterium sp. AT1b]
 gi|229468839|gb|ACQ70611.1| transcription-repair coupling factor [Exiguobacterium sp. AT1b]
          Length = 1175

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/183 (12%), Positives = 62/183 (33%), Gaps = 25/183 (13%)

Query: 1   MTFQQKRDAMR---------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD 51
           +T ++++             Q  +  +++V+  HG+G    IK  EV G+  ++  + + 
Sbjct: 474 VTKRKRQTKNLTNAERIKSYQELKPNDYVVHVHHGIGKYLGIKTIEVGGIHQDYLHLVYA 533

Query: 52  KDKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGD 111
                L VPV +   +     +E            GK      +     ++  +K+    
Sbjct: 534 G-DDALYVPVDQIDLVQKYVGAE------------GKEPKIYKLGGTEWKKVKSKVAKSV 580

Query: 112 LIAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
                E+++     ++    ++      +  + +         +  +  +I  I+ ++  
Sbjct: 581 KDIADELIKLYAAREASVGFAFPPD---DEEMGQFESSFPYAETEDQVRSIAEIKADMER 637

Query: 172 KSS 174
              
Sbjct: 638 SRP 640


>gi|84497836|ref|ZP_00996633.1| putative transcriptional-repair coupling factor [Janibacter sp.
           HTCC2649]
 gi|84381336|gb|EAP97219.1| putative transcriptional-repair coupling factor [Janibacter sp.
           HTCC2649]
          Length = 1204

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 62/174 (35%), Gaps = 10/174 (5%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        + G+ +V+  HGVG   E+ ++ V G   E+ V+ +          
Sbjct: 504 MPSRRRNQVDPLQLKPGDFVVHEQHGVGKFVEMMQRTVQGATREYLVLEYAPGTRGKHSQ 563

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
                    R       +++  + V G+      M     +   +K         AE+++
Sbjct: 564 PD-------RLFVPTDQLDQITRYVGGEQPTLNKMGGSDWKTTKSKARRYVKQIAAELIQ 616

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    ++S+   ++     +    A + +  +  +I+ ++ ++  +  
Sbjct: 617 LYSARMATKGHAFSKDTPWQR---ELEDAFAYIETPDQLSSIDEVKADMEREVP 667


>gi|30263594|ref|NP_845971.1| CarD family transcriptional regulator [Bacillus anthracis str.
           Ames]
 gi|47528992|ref|YP_020341.1| CarD family transcriptional regulator [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49186442|ref|YP_029694.1| CarD family transcriptional regulator [Bacillus anthracis str.
           Sterne]
 gi|52141890|ref|YP_084935.1| CarD family transcriptional regulator [Bacillus cereus E33L]
 gi|65320919|ref|ZP_00393878.1| COG1329: Transcriptional regulators, similar to M. xanthus CarD
           [Bacillus anthracis str. A2012]
 gi|167636360|ref|ZP_02394661.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0442]
 gi|170689537|ref|ZP_02880724.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0465]
 gi|177652471|ref|ZP_02934938.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0174]
 gi|190564601|ref|ZP_03017522.1| transcriptional regulator, CarD family [Bacillus anthracis
           Tsiankovskii-I]
 gi|196034117|ref|ZP_03101527.1| transcriptional regulator, CarD family [Bacillus cereus W]
 gi|196038188|ref|ZP_03105497.1| transcriptional regulator, CarD family [Bacillus cereus NVH0597-99]
 gi|196044624|ref|ZP_03111859.1| transcriptional regulator, CarD family [Bacillus cereus 03BB108]
 gi|218904774|ref|YP_002452608.1| transcriptional regulator, CarD family [Bacillus cereus AH820]
 gi|225865630|ref|YP_002751008.1| transcriptional regulator, CarD family [Bacillus cereus 03BB102]
 gi|227813522|ref|YP_002813531.1| transcriptional regulator, CarD family [Bacillus anthracis str. CDC
           684]
 gi|228928695|ref|ZP_04091731.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228934921|ref|ZP_04097752.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228947260|ref|ZP_04109554.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229092619|ref|ZP_04223770.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-42]
 gi|229123162|ref|ZP_04252368.1| Transcriptional regulator, CarD [Bacillus cereus 95/8201]
 gi|229157223|ref|ZP_04285303.1| Transcriptional regulator, CarD [Bacillus cereus ATCC 4342]
 gi|229185880|ref|ZP_04313053.1| Transcriptional regulator, CarD [Bacillus cereus BGSC 6E1]
 gi|229602120|ref|YP_002867837.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0248]
 gi|254686212|ref|ZP_05150071.1| CarD family transcriptional regulator [Bacillus anthracis str.
           CNEVA-9066]
 gi|254726022|ref|ZP_05187804.1| CarD family transcriptional regulator [Bacillus anthracis str.
           A1055]
 gi|254738685|ref|ZP_05196388.1| CarD family transcriptional regulator [Bacillus anthracis str.
           Western North America USA6153]
 gi|254744757|ref|ZP_05202435.1| CarD family transcriptional regulator [Bacillus anthracis str.
           Kruger B]
 gi|254753003|ref|ZP_05205039.1| CarD family transcriptional regulator [Bacillus anthracis str.
           Vollum]
 gi|254759274|ref|ZP_05211300.1| CarD family transcriptional regulator [Bacillus anthracis str.
           Australia 94]
 gi|301055137|ref|YP_003793348.1| CarD family transcriptional regulator [Bacillus anthracis CI]
 gi|30258229|gb|AAP27457.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           Ames]
 gi|47504140|gb|AAT32816.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49180369|gb|AAT55745.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           Sterne]
 gi|51975359|gb|AAU16909.1| transcriptional regulator, CarD family [Bacillus cereus E33L]
 gi|167528287|gb|EDR91064.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0442]
 gi|170666494|gb|EDT17270.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0465]
 gi|172082145|gb|EDT67212.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0174]
 gi|190563918|gb|EDV17882.1| transcriptional regulator, CarD family [Bacillus anthracis
           Tsiankovskii-I]
 gi|195993191|gb|EDX57149.1| transcriptional regulator, CarD family [Bacillus cereus W]
 gi|196024659|gb|EDX63331.1| transcriptional regulator, CarD family [Bacillus cereus 03BB108]
 gi|196030596|gb|EDX69194.1| transcriptional regulator, CarD family [Bacillus cereus NVH0597-99]
 gi|218535293|gb|ACK87691.1| transcriptional regulator, CarD family [Bacillus cereus AH820]
 gi|225788624|gb|ACO28841.1| transcriptional regulator, CarD family [Bacillus cereus 03BB102]
 gi|227004447|gb|ACP14190.1| transcriptional regulator, CarD family [Bacillus anthracis str. CDC
           684]
 gi|228597592|gb|EEK55239.1| Transcriptional regulator, CarD [Bacillus cereus BGSC 6E1]
 gi|228626287|gb|EEK83034.1| Transcriptional regulator, CarD [Bacillus cereus ATCC 4342]
 gi|228660255|gb|EEL15889.1| Transcriptional regulator, CarD [Bacillus cereus 95/8201]
 gi|228690772|gb|EEL44548.1| Transcriptional regulator, CarD [Bacillus cereus Rock3-42]
 gi|228812507|gb|EEM58834.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228824821|gb|EEM70622.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228831014|gb|EEM76615.1| Transcriptional regulator, CarD [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229266528|gb|ACQ48165.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0248]
 gi|300377306|gb|ADK06210.1| transcriptional regulator, CarD family [Bacillus cereus biovar
           anthracis str. CI]
          Length = 158

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 81/151 (53%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G++IVYP  G G I  I+E+E+AG K +++VI      M + +P GK ++  +R ++
Sbjct: 7   FQIGDNIVYPMQGAGIIKAIEEKEIAGEKQQYYVIKMSASNMEIMIPEGKILNSNIRPVT 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   +   + + +     +   W +R +    KI +G +   AEVVRDL R   +   + 
Sbjct: 67  DIKALIHIIDIFQHGESDRLLTWKQRYKVNTDKIKTGKMQEGAEVVRDLMRIQKEKALNA 126

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINL 164
           SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 127 SEKKMLDNAHEFLISELGLIEGITENQIKSF 157


>gi|126664951|ref|ZP_01735934.1| transcription-repair coupling protein Mfd [Marinobacter sp. ELB17]
 gi|126630321|gb|EBA00936.1| transcription-repair coupling protein Mfd [Marinobacter sp. ELB17]
          Length = 1169

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 55/180 (30%), Gaps = 24/180 (13%)

Query: 3   FQQKRDAMR--------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
            ++++               R G  +V+  HGVG    ++   V G   EF ++ +    
Sbjct: 475 RRREKPTELNDDGYRDLSELRIGSPVVHIDHGVGRYQGLETITVEGEASEFLMLGYAGS- 533

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV     I     S+                    + + R      K        
Sbjct: 534 SKLYVPVSSLHLISRYAGSDTEHAP------------LHKLGTDRWNTAKKKALEKIRDT 581

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            AE++    R +++   S+      + A            +  +  AI  +  +++S+  
Sbjct: 582 AAELLDVYARREARKGFSF---DNPQEAYRTFAAGFPFEETPDQEVAIQAVLEDMTSERP 638


>gi|291303253|ref|YP_003514531.1| transcription-repair coupling factor [Stackebrandtia nassauensis
           DSM 44728]
 gi|290572473|gb|ADD45438.1| transcription-repair coupling factor [Stackebrandtia nassauensis
           DSM 44728]
          Length = 1351

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 59/179 (32%), Gaps = 22/179 (12%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD-----KDKM 55
           M  ++K          G+++V+  HGVG   E+  + V G + E+ VI +      +   
Sbjct: 658 MPSRRKGGVNPLELSNGDYVVHEQHGVGRYIELVRRTVNGAEREYLVIEYAASKRGQPAD 717

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP      +      E   V +                    Q+  ++         
Sbjct: 718 RLFVPTDALDQLTRYVGGEMPSVHKL--------------GGSDWQKAKSRAKKAVREIA 763

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           AE+++      +    ++     ++     +        +  +  AI+ ++ ++  ++ 
Sbjct: 764 AELIKLYAARQATEGHAFGPDTPWQR---ELEDAFPYQETPDQAGAIDEVKSDMMGRTP 819


>gi|260887854|ref|ZP_05899117.1| transcription-repair coupling factor [Selenomonas sputigena ATCC
           35185]
 gi|330838722|ref|YP_004413302.1| transcription-repair coupling factor [Selenomonas sputigena ATCC
           35185]
 gi|260862360|gb|EEX76860.1| transcription-repair coupling factor [Selenomonas sputigena ATCC
           35185]
 gi|329746486|gb|AEB99842.1| transcription-repair coupling factor [Selenomonas sputigena ATCC
           35185]
          Length = 1118

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/173 (14%), Positives = 58/173 (33%), Gaps = 16/173 (9%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
             +++R A  +    G+++V+  HGVG    ++  +V G+K ++  I        L VP 
Sbjct: 415 ASKEERIAHFREINVGDYVVHVNHGVGKYLGVETLDVGGIKKDYLHIK-YGGDDKLFVPT 473

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            +   +     SE            G+      M      +  A+  +       E++  
Sbjct: 474 DQVGLLQKYIGSE------------GETPRLHRMGGTEWVKAKARARASVEDIADELIAL 521

Query: 122 LHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
             +  +    ++S    ++              +  +  AI  I+ ++     
Sbjct: 522 YAKRRAAKGFAFSPDTPWQR---EFEDAFPYEETPDQRRAIEEIKADMEKPEP 571


>gi|229021662|ref|ZP_04178248.1| Transcription-repair-coupling factor [Bacillus cereus AH1272]
 gi|228739637|gb|EEL90047.1| Transcription-repair-coupling factor [Bacillus cereus AH1272]
          Length = 1010

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 316 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 374

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 375 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 422

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 423 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 478


>gi|237745816|ref|ZP_04576296.1| transcription-repair coupling factor [Oxalobacter formigenes
           HOxBLS]
 gi|229377167|gb|EEO27258.1| transcription-repair coupling factor [Oxalobacter formigenes
           HOxBLS]
          Length = 1150

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 19/166 (11%), Positives = 49/166 (29%), Gaps = 18/166 (10%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
                + G+ +V+  HG+G    +   ++   + EF  + +   +  L VPV +   I  
Sbjct: 478 DLSELKIGDPVVHAHHGIGRYRGLVTVDLGEGETEFLHLQYA-RETKLYVPVSQLHVISR 536

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
              +     +  L  +                    K        I +   +L    ++ 
Sbjct: 537 YAGTSPE--DAPLHTLGSGQ--------------WEKARQKAAQKIHDTAAELLDLYARR 580

Query: 130 EKSYSERQLY-ESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                      ++             +  +  AI+ +  +++S+  
Sbjct: 581 SMRKGFPFPLTKNDYEAFADSFGFEETPDQAAAISAVMEDMTSEKP 626


>gi|313902509|ref|ZP_07835910.1| transcription-repair coupling factor [Thermaerobacter subterraneus
           DSM 13965]
 gi|313467195|gb|EFR62708.1| transcription-repair coupling factor [Thermaerobacter subterraneus
           DSM 13965]
          Length = 1196

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 18/162 (11%), Positives = 51/162 (31%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    ++  E+ G+  ++  + +      L VP  +   +     
Sbjct: 514 DLKPGDYVVHVHHGIGRFLGLRTMEIQGVHRDYLTLQYAGGD-RLYVPTDQIELVQKY-- 570

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
             A   +  L  +                +   ++         E++       S    +
Sbjct: 571 VGAEGHQPRLARLGSGE----------WNKVKQRVKESVREMAGELLALYAARQSVRGHA 620

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S    ++    +         +  +  AI  I+ ++     
Sbjct: 621 FSPDTPWQR---QFEDAFPYQETPDQLAAIAAIKADMERPVP 659


>gi|332798184|ref|YP_004459683.1| transcription-repair coupling factor [Tepidanaerobacter sp. Re1]
 gi|332695919|gb|AEE90376.1| transcription-repair coupling factor [Tepidanaerobacter sp. Re1]
          Length = 1178

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 24/172 (13%), Positives = 54/172 (31%), Gaps = 16/172 (9%)

Query: 3   FQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
            + KR         G+++V+  HG+G    I+  EV G   ++F + +      L VP  
Sbjct: 495 AKGKRITDFNELDVGDYVVHITHGIGKYLGIESLEVGGHIKDYFTLMYAGGD-KLYVPTN 553

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
           +   I     +                     +      +  +K          E+++  
Sbjct: 554 QVDLIQKYVGA------------DDTPPKLHKLGGNEWNKAKSKAKDSIKQMAEELIKLY 601

Query: 123 HRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
              +S    ++S    ++     M        +  +  AI  ++ ++ S   
Sbjct: 602 ATRESVSGFAFSADSPWQKEFQDM---FPYEETPDQLAAIEEVKRDMESPKP 650


>gi|229077333|ref|ZP_04210009.1| Transcription-repair-coupling factor [Bacillus cereus Rock4-2]
 gi|228705971|gb|EEL58283.1| Transcription-repair-coupling factor [Bacillus cereus Rock4-2]
          Length = 968

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 58/179 (32%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 274 SQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 332

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 333 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 380

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I+ I+ ++     
Sbjct: 381 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIDEIKKDMERGRP 436


>gi|117924949|ref|YP_865566.1| transcription-repair coupling factor [Magnetococcus sp. MC-1]
 gi|117608705|gb|ABK44160.1| transcription-repair coupling factor [Magnetococcus sp. MC-1]
          Length = 1198

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/162 (17%), Positives = 55/162 (33%), Gaps = 18/162 (11%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
               G+ +V+  HGVG    +   EV  +K +F +I +      L VPV     +G    
Sbjct: 517 DLNEGDAVVHVDHGVGRFGGLVSLEVGQLKNDFLLIIYADGD-KLYVPVENLDRVGKHSS 575

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            E   +++                 +R  +  AK     L    E+V    + ++     
Sbjct: 576 GEEVQLDKL--------------GGKRWAKTRAKARKKILEMAEELVAIQAQREATQGVV 621

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           YS                    ++ + +AI  +  +++S  +
Sbjct: 622 YSGPDAL---YQEFASTFPFEETVDQAKAIEAVLEDMASPKA 660


>gi|186475762|ref|YP_001857232.1| transcription-repair coupling factor [Burkholderia phymatum STM815]
 gi|184192221|gb|ACC70186.1| transcription-repair coupling factor [Burkholderia phymatum STM815]
          Length = 1164

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 20/183 (10%), Positives = 52/183 (28%), Gaps = 27/183 (14%)

Query: 2   TFQQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDK 52
           T +++++               + G+ +V+  HG+G    +   ++   + EF  +   +
Sbjct: 463 TGRRRQEQASNVDSMVRDLSELKVGDPVVHSQHGIGRYMGLVTMDLGEGETEFLHLE-YQ 521

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
               L VPV +   I     ++       L  +                    K      
Sbjct: 522 GDSKLYVPVSQLHVISRYSGADPDSAP--LHALGSGQ--------------WEKAKRKAA 565

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             I +   +L    ++           +     +         +  +  AI  +  +++S
Sbjct: 566 QQIRDTAAELLNLYARRAMREGHAFPLDPRDYVKFAESFGFEETPDQAAAIAAVIGDMTS 625

Query: 172 KSS 174
              
Sbjct: 626 GKP 628


>gi|302530260|ref|ZP_07282602.1| transcription-repair coupling factor [Streptomyces sp. AA4]
 gi|302439155|gb|EFL10971.1| transcription-repair coupling factor [Streptomyces sp. AA4]
          Length = 1192

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 62/174 (35%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        + G+++V+  HG+G   E+ ++ VAG   E+ +         L+  
Sbjct: 493 MPSRRRGAVDPLALKAGDYVVHDQHGIGRFVEMVQRTVAGATREYLL---------LEYA 543

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       ++   + V G+      +     +   A+         AE+V+
Sbjct: 544 SSKRGQPGDRLFVPTDQLDEVSRYVGGELPTLNKLGGSDWKNTKARAKKAVKEIAAELVQ 603

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++S    +        +  +  AI+ ++ ++     
Sbjct: 604 LYAARQAAPGHAFGPDTPWQS---ELEDAFPFTETNDQLAAIDEVKADMERGVP 654


>gi|114800270|ref|YP_760685.1| transcription-repair coupling factor [Hyphomonas neptunium ATCC
           15444]
 gi|114740444|gb|ABI78569.1| transcription-repair coupling factor [Hyphomonas neptunium ATCC
           15444]
          Length = 1145

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 54/178 (30%), Gaps = 23/178 (12%)

Query: 2   TFQQKRD----AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCL 57
             ++++             G+ +V+  HGVG    +K  EV G   +   + +    M +
Sbjct: 423 PRRKRKSASFITDATSLTPGDLVVHIDHGVGKYIGLKTLEVTGAPHDCLQLEYAGGDM-I 481

Query: 58  KVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAE 117
            +PV     I       +   E  L  + G                     +     I E
Sbjct: 482 FIPVENIDLISRY---GSEESESQLDRLGGAG--------------WQTRKAKAKKRILE 524

Query: 118 VVRDLHRTDSQPEKSYSER-QLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +  +L +  +  E   +E  Q  +              +  +  AI  +  +LSS   
Sbjct: 525 MAAELMQIAAARELKRAEAVQSGQGLYEEFAARFPYEETDDQLSAIEDVLGDLSSGKP 582


>gi|56962605|ref|YP_174331.1| CarD family transcriptional regulator [Bacillus clausii KSM-K16]
 gi|56908843|dbj|BAD63370.1| CarD family transcriptional regulator [Bacillus clausii KSM-K16]
          Length = 153

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/152 (25%), Positives = 78/152 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG G I  I+E ++   K ++++I    + M + +P  K ++  +R +
Sbjct: 1   MFQIGDNIVYPMHGAGVIEAIEEIDLLEEKQQYYIIKMSINNMKVMIPTSKIVNSRIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   +   + + +         W +R +    KI  G++   AEVVRDL R   +   +
Sbjct: 61  TDILAINHIIHIFQHGESDTLLPWKQRYKVNADKIKMGEMQEGAEVVRDLRRIKKEKTLN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE++L ++A   ++ E+  V  I++ +  + 
Sbjct: 121 TSEKELLDNAYEFLLSELEVVKGITDRQIKSF 152


>gi|56418583|ref|YP_145901.1| transcription-repair coupling factor [Geobacillus kaustophilus
           HTA426]
 gi|56378425|dbj|BAD74333.1| transcription-repair coupling factor [Geobacillus kaustophilus
           HTA426]
          Length = 1177

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    I+  E+ G+  ++  I   +    L VPV +   +     
Sbjct: 499 ELQVGDYVVHVNHGIGKYLGIETLEINGVHKDYIHI-QYQGGDTLYVPVDQIDQVQKYVG 557

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE            GK      +     ++   K+ S       ++++     ++    +
Sbjct: 558 SE------------GKEPKIYKLGGSEWKKVKRKVESSVQDIAEDLIKLYAEREASKGYA 605

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     +              +  +  +I  I+ ++ S   
Sbjct: 606 FSPDTEMQR---EFEAAFPYQETEDQLRSIEEIKRDMESDKP 644


>gi|303246473|ref|ZP_07332752.1| transcriptional regulator, CarD family [Desulfovibrio
           fructosovorans JJ]
 gi|302492183|gb|EFL52058.1| transcriptional regulator, CarD family [Desulfovibrio
           fructosovorans JJ]
          Length = 170

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 83/170 (48%), Gaps = 3/170 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F   + +VYPA GVG +  I+ Q + G   +FF++    + + L VPV  A ++G+R L
Sbjct: 1   MFSEEQLVVYPAQGVGRVERIETQVIGGTSADFFIVRILSNNVTLMVPVANAENVGLRPL 60

Query: 73  SEAHFVERALKLVRGKAR---VKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
             A      ++ ++ ++         W+RR +EY  K+ SGDL  +A V+++L       
Sbjct: 61  CTAEEGLAIIESLKDRSDFTGYTGQNWNRRYREYSEKLKSGDLADVAYVLKELLLIGQNK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKS 179
           E S+ ER+L E A + +  E+A      + E  ++I    +   +   + 
Sbjct: 121 ELSFGERRLLEQATSLLTLELALALDKDQQEIKDVINEIFADVLAPKPEE 170


>gi|148657760|ref|YP_001277965.1| transcription-repair coupling factor [Roseiflexus sp. RS-1]
 gi|148569870|gb|ABQ92015.1| transcription-repair coupling factor [Roseiflexus sp. RS-1]
          Length = 1265

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 19/164 (11%), Positives = 57/164 (34%), Gaps = 18/164 (10%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           +G + G+++V+  HG+     +  + V G++ ++       +   L VPV +   +    
Sbjct: 542 RGLKPGDYVVHIEHGIAVYEGLIRRSVGGIERDYL-NLRYAEGDRLYVPVDQIDRVSRYI 600

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +     +  L  +  +                 +       A+ ++  +L    +Q + 
Sbjct: 601 GAGDVEPQ--LTRLGTQD--------------WERAKRKARAAVQDLAEELITLYAQRQL 644

Query: 132 SYSERQLYESALNR-MVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +       ++   R +      V +  + +AI  ++ ++     
Sbjct: 645 AEGHAFSPDTEWQRELEASFPYVETPDQLKAIIDVKRDMEQPQP 688


>gi|152973901|ref|YP_001373418.1| transcription-repair coupling factor [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152022653|gb|ABS20423.1| transcription-repair coupling factor [Bacillus cytotoxicus NVH
           391-98]
          Length = 1176

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 21/180 (11%), Positives = 60/180 (33%), Gaps = 25/180 (13%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            ++K+              + G+++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SRRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKDPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNR-MVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +++     ++A  R          +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAFT----PDTAEQREFESSFPYQETEDQLRSIEEIKKDMERSRP 644


>gi|237748656|ref|ZP_04579136.1| transcription-repair coupling factor [Oxalobacter formigenes
           OXCC13]
 gi|229380018|gb|EEO30109.1| transcription-repair coupling factor [Oxalobacter formigenes
           OXCC13]
          Length = 1152

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 21/166 (12%), Positives = 48/166 (28%), Gaps = 18/166 (10%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
                + G+ +V+  HG+G    +   ++   + EF  + + K    L VPV +   I  
Sbjct: 478 DLSELKIGDPVVHANHGIGRYRGLVTVDLGEGETEFLHLQYAK-DTKLYVPVSQLHVISR 536

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
              + A   +  L  +                    K        I +   +L    ++ 
Sbjct: 537 YAGTSAD--DAPLHTLGSGQ--------------WEKAKQKAAQQIHDTAAELLDLYARR 580

Query: 130 EKSYSERQLY-ESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                      ++             +  +  AI  +  +++S   
Sbjct: 581 SMRKGFPFPLTKNDYEAFADSFGFEETPDQAAAIASVMEDMTSDKP 626


>gi|120554850|ref|YP_959201.1| transcription-repair coupling factor [Marinobacter aquaeolei VT8]
 gi|120324699|gb|ABM19014.1| transcription-repair coupling factor [Marinobacter aquaeolei VT8]
          Length = 1173

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 53/180 (29%), Gaps = 24/180 (13%)

Query: 3   FQQKRDAM--------RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
            ++++               R G  +V+  HGVG    ++     G   EF  + +    
Sbjct: 479 RRRQKPTETDDAGYRDLSELRIGAPVVHIDHGVGRYKGLETLTAGGQSDEFLTLEYAG-G 537

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV     I     ++                    + + R      K        
Sbjct: 538 SKLYVPVSSLHLISRYAGTDEEHAP------------LHKLGTERWSNAKQKALEKIRDT 585

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            AE++    R +++    + +    + A            +  +  AI  +  +++S+  
Sbjct: 586 AAELLDVYARREARKGFQFED---PKEAYRAFAAGFPFEETPDQQVAIESVFEDMTSERP 642


>gi|256389420|ref|YP_003110984.1| transcription-repair coupling factor [Catenulispora acidiphila DSM
           44928]
 gi|256355646|gb|ACU69143.1| transcription-repair coupling factor [Catenulispora acidiphila DSM
           44928]
          Length = 1182

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 63/174 (36%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        + G+ +V+  HGVG   E+ ++ VAG   E+ V         ++  
Sbjct: 493 MPSRRRNVIDPLQLKAGDPVVHEQHGVGRYVEMAQRTVAGATREYLV---------IEYA 543

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  K V G+A     +     Q+  ++          ++V+
Sbjct: 544 AAKRGQPGDRLFVPTDQLDQVTKYVGGEAPSLHRLGGADWQKAKSRARKAVKQIAGDLVK 603

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  +++    ++     +      V +  +   I+ ++ ++     
Sbjct: 604 LYSARMAAPGHAFAADTPWQR---ELEDAFPYVETPDQLACIDEVKSDMEKPVP 654


>gi|154685003|ref|YP_001420164.1| YdeB [Bacillus amyloliquefaciens FZB42]
 gi|154350854|gb|ABS72933.1| YdeB [Bacillus amyloliquefaciens FZB42]
          Length = 153

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/152 (26%), Positives = 79/152 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G++IVYP HG GTI  I+E++    K +++VI      M + +P  K +   +R +
Sbjct: 1   MFQIGDNIVYPMHGAGTIEAIEEKQFLEEKQQYYVIRMSISNMTVMIPTRKILSSNIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  + + +     K   W +R      KI +G++   AEVVRDL R   +   +
Sbjct: 61  TDIRALKHIIHIFQHGESDKLLPWKQRYIVNTNKIKTGEIQEGAEVVRDLMRMKKEKALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++ ++A   ++ E+  +  I+E +  + 
Sbjct: 121 SSEKKMLDNAYEFLISELEVIKGITEKQIKSF 152


>gi|297243627|ref|ZP_06927558.1| transcription-repair coupling factor [Gardnerella vaginalis AMD]
 gi|296888378|gb|EFH27119.1| transcription-repair coupling factor [Gardnerella vaginalis AMD]
          Length = 1202

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 16/182 (8%), Positives = 54/182 (29%), Gaps = 26/182 (14%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEV----AGMKLEFFVIAFD-----K 52
             ++++       + G+ +V+  HG+G    +K++ +         E+ VI +       
Sbjct: 515 PKRRRKAIDLMELKPGDFVVHEQHGIGRFVGMKQRNIAVSGGSATREYLVIEYAPSKRNA 574

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
               L +P  +   +     +E   + +                     +  AK      
Sbjct: 575 PNDKLFIPTDQLDLVSKYIGAEIPKLNKL--------------GGSDWAQTKAKAKKHVH 620

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
                +++           ++S+   ++     +        +  +   I+ ++ ++   
Sbjct: 621 EIAENLIKLYSARQQSRGFAFSKDTPWQ---KELEDAFPYQETADQLTTIDEVKADMEKP 677

Query: 173 SS 174
             
Sbjct: 678 IP 679


>gi|153005645|ref|YP_001379970.1| CarD family transcriptional regulator [Anaeromyxobacter sp.
           Fw109-5]
 gi|152029218|gb|ABS26986.1| transcriptional regulator, CarD family [Anaeromyxobacter sp.
           Fw109-5]
          Length = 364

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/165 (24%), Positives = 78/165 (47%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           A     R G  +VYP  GV  +  ++E+++AG KL+   +  ++D   + VP  K   IG
Sbjct: 24  ADAAELRPGNRVVYPNQGVCEVVGVEEKDIAGQKLQLVRMRREEDGAAVLVPRNKVPSIG 83

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
           +R+++    +E     +  +       W  R ++   ++ +G ++ +AEVV+ LH     
Sbjct: 84  LRRVATGEQIEGVFHFLAAQFEDPELDWKVRHRDNADRLIAGGVLGVAEVVKGLHSLSRI 143

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
                 ER+ Y++A + +V E+A    +    A + I+  L   +
Sbjct: 144 RPLPAKEREQYDNARHLLVHEVAVSLGVPPALAEDYIDYALMPPA 188


>gi|158312659|ref|YP_001505167.1| transcription-repair coupling factor [Frankia sp. EAN1pec]
 gi|158108064|gb|ABW10261.1| transcription-repair coupling factor [Frankia sp. EAN1pec]
          Length = 1188

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 61/174 (35%), Gaps = 18/174 (10%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G+ +V+ AHGVG   E+  + VAG K E+ ++ + +    L VP
Sbjct: 501 MPSRRRKGIDPLALSAGDLVVHDAHGVGRYVEMVTRTVAGAKREYLLLEYARGD-RLYVP 559

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +   I      E               R+    W +R     ++          E++R
Sbjct: 560 TDQLEQISRYVGGEG----------PSLDRIGGADWGKR----KSRARKAVKEIAGELIR 605

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +  AI+ ++ ++     
Sbjct: 606 LYSARMAAPGHAFGPDSPWQR---ELEDAFPFRETPDQLAAIDEVKADMEKPVP 656


>gi|271969774|ref|YP_003343970.1| transcription-repair coupling factor [Streptosporangium roseum DSM
           43021]
 gi|270512949|gb|ACZ91227.1| transcription-repair coupling factor [Streptosporangium roseum DSM
           43021]
          Length = 1204

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 61/174 (35%), Gaps = 18/174 (10%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +  +++        + G+H+V+  HGVG   E+ ++ V G   E+ VI + K    L VP
Sbjct: 515 LPSKRRNMVDPLQLKVGDHVVHEQHGVGRYVEMVQRTVQGATREYLVIEYAKGD-RLYVP 573

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +  ++                 V G++     M      +   K          E++R
Sbjct: 574 TDQLDEVTRY--------------VGGESPTLNRMGGADWAKAKTKAKKAVKEIAGELIR 619

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++  +           +  + EAI+ ++ ++     
Sbjct: 620 LYSARMASPGHAFGPDTPWQREME---DAFPYAETGDQLEAIDEVKRDMERGIP 670


>gi|299782816|gb|ADJ40814.1| Transcription-repair coupling factor [Lactobacillus fermentum CECT
           5716]
          Length = 1113

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 21/163 (12%), Positives = 59/163 (36%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  EV G+  ++ V+   +D   + VPV +   +    
Sbjct: 427 TDLKPGDYVVHVNHGIGLFAGIKTMEVDGVHQDYMVLD-YRDNAQIFVPVTQLNLVQKYV 485

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E             K      +      +   ++ +       ++V    + +++   
Sbjct: 486 SAE------------SKTPRLNRLGGVEWAKTKRRVAAKIEDIADDLVDLYAKRETEKGF 533

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++ +    +    +   E     +  + ++I  I+ ++     
Sbjct: 534 AFPKDDYLQ---EKFDDEFPYAETKDQLQSIQEIKADMERPRP 573


>gi|282852620|ref|ZP_06261962.1| transcription-repair coupling factor [Lactobacillus gasseri 224-1]
 gi|282556362|gb|EFB61982.1| transcription-repair coupling factor [Lactobacillus gasseri 224-1]
          Length = 935

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 24/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    IK  +V G K + ++    +    L VP  +   +     
Sbjct: 490 ELKPGDYVVHVNHGIGRFEGIKTLDVDGKKRD-YITITYQHHDQLFVPADQLGLVQKYVA 548

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE            GK      + S    +   ++ S       +++    + +S+   +
Sbjct: 549 SE------------GKVPHINKLGSAEWAKTKKRVQSKVEDIADDLIELYAKRESEKGFA 596

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     +              +  +  +I  I+ ++ S   
Sbjct: 597 FSPDDDLQ---KEFEDAFPYPETPDQLRSIREIKADMESPKP 635


>gi|30264785|ref|NP_847162.1| CarD family transcriptional regulator [Bacillus anthracis str.
           Ames]
 gi|47778348|ref|YP_021614.2| CarD family transcriptional regulator [Bacillus anthracis str.
           'Ames Ancestor']
 gi|165869635|ref|ZP_02214293.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0488]
 gi|167638161|ref|ZP_02396439.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0193]
 gi|170705571|ref|ZP_02896035.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0389]
 gi|254725089|ref|ZP_05186872.1| transcriptional regulator, CarD family protein [Bacillus anthracis
           str. A1055]
 gi|254736826|ref|ZP_05194532.1| transcriptional regulator, CarD family protein [Bacillus anthracis
           str. Western North America USA6153]
 gi|254754539|ref|ZP_05206574.1| transcriptional regulator, CarD family protein [Bacillus anthracis
           str. Vollum]
 gi|254757371|ref|ZP_05209398.1| transcriptional regulator, CarD family protein [Bacillus anthracis
           str. Australia 94]
 gi|30259460|gb|AAP28648.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           Ames]
 gi|47552053|gb|AAT34089.2| transcriptional regulator, CarD family [Bacillus anthracis str.
           'Ames Ancestor']
 gi|164714464|gb|EDR19983.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0488]
 gi|167513978|gb|EDR89346.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0193]
 gi|170129696|gb|EDS98559.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0389]
          Length = 148

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 68/136 (50%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP +G G I  I+E+E+ G   ++ VI      M + +P+ +    G+R +
Sbjct: 1   MFQIGDKIVYPMNGAGVIEAIEEKEILGTIRQYCVIRIISKDMQVMLPMDQLQKSGIRYI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   +
Sbjct: 61  VDKGTLDDILLEFQNGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALN 120

Query: 133 YSERQLYESALNRMVR 148
            SE+Q+ ++A   M R
Sbjct: 121 ASEKQMLDNARKMMFR 136


>gi|182420058|ref|ZP_02951292.1| transcription-repair coupling factor [Clostridium butyricum 5521]
 gi|237669507|ref|ZP_04529487.1| transcription-repair coupling factor [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|182376095|gb|EDT73682.1| transcription-repair coupling factor [Clostridium butyricum 5521]
 gi|237654951|gb|EEP52511.1| transcription-repair coupling factor [Clostridium butyricum E4 str.
           BoNT E BL5262]
          Length = 1166

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/168 (17%), Positives = 61/168 (36%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +       + G+++V+  HG+G    IK+ EVAG K ++           L VPV +   
Sbjct: 495 KIKSFAELKPGDYVVHANHGIGVYKGIKQIEVAGHKRDYL-DIVYDKGDKLYVPVDQLDL 553

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           I     SE            GK+     + S   Q+  AK+         ++V+      
Sbjct: 554 IQKYVGSE------------GKSPKVNKLGSAEWQKAKAKVRKSINEIAEDLVKLYAMRT 601

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +     +S+   ++    +   E     +  +  ++  I+ ++ S   
Sbjct: 602 TVKGHKFSKDTQWQ---KQFEDEFPYDETPDQLTSLEEIKADMESDKP 646


>gi|197123346|ref|YP_002135297.1| CarD family transcriptional regulator [Anaeromyxobacter sp. K]
 gi|196173195|gb|ACG74168.1| transcriptional regulator, CarD family [Anaeromyxobacter sp. K]
          Length = 404

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/164 (23%), Positives = 76/164 (46%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
                + G+ +VYP  GV  +   + +++AG KLE   +  ++D   + VP GK   IG+
Sbjct: 26  AADELKPGDRVVYPNQGVCAVVGWEVKDIAGQKLELVRMTREEDGAAVMVPKGKVPSIGL 85

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           R+++    +E     +          W  R ++   ++ +G ++ +AEVV+ LH      
Sbjct: 86  RRVATGAQMEGVFHYLGAVYDDPELDWKVRHRDNADRLIAGGVLGVAEVVKGLHSLSRLR 145

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
                ER+ Y++A + +V E++    +    A + I+  L   +
Sbjct: 146 PLPTKEREQYDNARHLLVHEVSVSLGVPPGLAEDYIDYALMPPA 189


>gi|167463169|ref|ZP_02328258.1| transcription-repair coupling factor [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 1150

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 25/163 (15%), Positives = 54/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           Q  + G+++V+  HG+G    I   E+ G+  ++  I +      L VP+ +   I    
Sbjct: 486 QELKVGDYVVHVNHGIGKYVGIGTLEINGIHKDYLHILYAGGD-KLSVPIDQIDLIQKYV 544

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE             K      +          K+ S       ++++      S    
Sbjct: 545 GSE------------EKEPKIYKLGGAEWARVKNKVRSSVKDIADDLIKLYAERQSTLGY 592

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S+   Y+   +          +  +  AI  I+ ++     
Sbjct: 593 AFSKDSTYQ---HEFEAMFPYDETHDQLRAIEEIKKDMEKPLP 632


>gi|187923864|ref|YP_001895506.1| transcription-repair coupling factor [Burkholderia phytofirmans
           PsJN]
 gi|187715058|gb|ACD16282.1| transcription-repair coupling factor [Burkholderia phytofirmans
           PsJN]
          Length = 1160

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 51/181 (28%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           +++++               + G+ +V+  HG+G    +   ++   + EF  + +    
Sbjct: 463 RRRQEQASNVDSMVRDLSELKVGDPVVHSQHGIGRYMGLVTMDLGEGETEFLHLEYAG-D 521

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     ++       L  +                    K        
Sbjct: 522 SKLYVPVAQLHVISRYSGADPESAP--LHSLGSGQ--------------WEKAKRKAAQQ 565

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++           E     +         +  +  AI  +  +++S  
Sbjct: 566 IRDTAAELLNLYARRALRQGHAFALEPKDYVKFAESFGFEETPDQAAAIAAVIGDMTSGK 625

Query: 174 S 174
            
Sbjct: 626 P 626


>gi|111225581|ref|YP_716375.1| transcription-repair coupling factor [Frankia alni ACN14a]
 gi|111153113|emb|CAJ64860.1| Transcription-repair coupling factor (TRCF) [Frankia alni ACN14a]
          Length = 1246

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 64/174 (36%), Gaps = 18/174 (10%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G+ +V+ AHGVG   E+  + VAG K E+ ++ + +    L VP
Sbjct: 558 MPSRRRKGIDPLALVPGDMVVHDAHGVGRYVEMVTRTVAGAKREYLLLEYARGD-RLYVP 616

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +   I      +A              R+    W++R     ++          E++R
Sbjct: 617 TDQLEQITRYVGGDA----------PSLDRIGGADWAKR----KSRARKAVKEIAGELIR 662

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  +++    ++     +        +  +  AI+ ++ ++     
Sbjct: 663 LYSARMAAPGHAFAPDNPWQR---ELEDAFPFRETPDQLAAIDEVKADMEKPVP 713


>gi|170759697|ref|YP_001788879.1| transcription-repair coupling factor [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169406686|gb|ACA55097.1| transcription-repair coupling factor [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 1168

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 56/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+ +V+  HG+G    IK+ E+ G K ++           L VPV +   +    
Sbjct: 499 TELKPGDFVVHANHGIGVFKGIKQLELQGNKKDYL-ELIYHSDDKLYVPVEQLDMVQRYI 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      + S    +   K+         ++V+      +    
Sbjct: 558 GSE------------GKKPKVNKLGSSEWTKTKNKVKKSIEEIAEDLVKLYAIRATLKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            YS+  +++    +   E     +  +  AI  I+ ++ S   
Sbjct: 606 KYSDDTVWQ---KQFEEEFPYEETPDQLLAIEDIKRDMESPKP 645


>gi|152980432|ref|YP_001353098.1| transcription-repair coupling factor [Janthinobacterium sp.
           Marseille]
 gi|151280509|gb|ABR88919.1| transcription-repair coupling factor (superfamily II helicase)
           [Janthinobacterium sp. Marseille]
          Length = 1147

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 26/180 (14%), Positives = 55/180 (30%), Gaps = 25/180 (13%)

Query: 4   QQKRD---------AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
            +K++               + G+ +V+  HG+G    +   ++   + EF  + + K  
Sbjct: 462 SKKQEGATQVESMVRDLSELKIGDPVVHVNHGIGRYMGLTSMDLGEGETEFLHLEYAK-D 520

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     +           +      +     RRA E         +  
Sbjct: 521 TKLYVPVSQLHVISRYSGASPEDAP-----LHALGSGQWEKAKRRAAE--------KIRD 567

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            A  + +L+   +  E    E                   +  +  AIN +  +++S   
Sbjct: 568 TAAELLNLYARRALREGHSFE--YSAHDYEAFAESFGFEETADQAAAINAVIKDMTSGKP 625


>gi|326803014|ref|YP_004320832.1| transcription-repair coupling factor [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326650035|gb|AEA00218.1| transcription-repair coupling factor [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 1183

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 24/182 (13%), Positives = 65/182 (35%), Gaps = 26/182 (14%)

Query: 3   FQQKRDAMR----------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDK 52
            +++++             Q  + G+++V+  HG+G    ++  EVAG   ++       
Sbjct: 481 RRRRKNTNNLSNAERLKSYQELKPGDYVVHVNHGIGQFVGVETIEVAGNHKDYL-SIVYA 539

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
           D   + VP+ +   +     +E            GK+     M     Q+   +++    
Sbjct: 540 DNASIHVPIDQIDLVQKYVSAE------------GKSPKLNKMGGTEWQKTKQRVSKKIE 587

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
               ++V      +++   ++S     ++A      E     +  +  +I  I+ ++  +
Sbjct: 588 DIADDLVDLYAERETRKGYAFSPDNEDQAA---FEDEFPYPETDDQLRSIKEIKADMEKE 644

Query: 173 SS 174
             
Sbjct: 645 KP 646


>gi|260663740|ref|ZP_05864628.1| transcription-repair coupling factor [Lactobacillus fermentum
           28-3-CHN]
 gi|260551791|gb|EEX24907.1| transcription-repair coupling factor [Lactobacillus fermentum
           28-3-CHN]
          Length = 1180

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 21/163 (12%), Positives = 59/163 (36%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  EV G+  ++ V+   +D   + VPV +   +    
Sbjct: 494 TDLKPGDYVVHVNHGIGLFAGIKTMEVDGVHQDYMVLD-YRDNAQIFVPVTQLNLVQKYV 552

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E             K      +      +   ++ +       ++V    + +++   
Sbjct: 553 SAE------------SKTPRLNRLGGVEWAKTKRRVAAKIEDIADDLVDLYAKRETEKGF 600

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++ +    +    +   E     +  + ++I  I+ ++     
Sbjct: 601 AFPKDDYLQ---EKFDDEFPYAETKDQLQSIQEIKADMERPRP 640


>gi|227514331|ref|ZP_03944380.1| transcription-repair coupling factor [Lactobacillus fermentum ATCC
           14931]
 gi|227087303|gb|EEI22615.1| transcription-repair coupling factor [Lactobacillus fermentum ATCC
           14931]
          Length = 1180

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 21/163 (12%), Positives = 59/163 (36%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  EV G+  ++ V+   +D   + VPV +   +    
Sbjct: 494 TDLKPGDYVVHVNHGIGLFAGIKTMEVDGVHQDYMVLD-YRDNAQIFVPVTQLNLVQKYV 552

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E             K      +      +   ++ +       ++V    + +++   
Sbjct: 553 SAE------------SKTPRLNRLGGVEWAKTKRRVAAKIEDIADDLVDLYAKRETEKGF 600

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++ +    +    +   E     +  + ++I  I+ ++     
Sbjct: 601 AFPKDDYLQ---EKFDDEFPYAETKDQLQSIQEIKADMERPRP 640


>gi|283783133|ref|YP_003373887.1| transcription-repair coupling factor [Gardnerella vaginalis 409-05]
 gi|283441749|gb|ADB14215.1| transcription-repair coupling factor [Gardnerella vaginalis 409-05]
          Length = 1202

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 16/182 (8%), Positives = 55/182 (30%), Gaps = 26/182 (14%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEV----AGMKLEFFVIAFD-----K 52
             ++++       + G+ +V+  HG+G    +K++ +         E+ VI +       
Sbjct: 515 PKRRRKAIDLMELKPGDFVVHEQHGIGRFVGMKQRNIAVSGGSATREYLVIEYAPSKRNA 574

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
               L +P  +   +     +E   + +                     +  AK      
Sbjct: 575 PNDKLFIPTDQLDLVSKYIGAEIPKLNKL--------------GGSDWAQTKAKAKKHVH 620

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
                +++           ++S+   ++     +        +  +   I+ ++ ++ + 
Sbjct: 621 EIAENLIKLYSARQQSRGFAFSKDTPWQ---KELEDAFPYQETADQLTTIDEVKADMENP 677

Query: 173 SS 174
             
Sbjct: 678 IP 679


>gi|88607738|ref|YP_504735.1| transcription-repair coupling factor [Anaplasma phagocytophilum HZ]
 gi|88598801|gb|ABD44271.1| transcription-repair coupling factor [Anaplasma phagocytophilum HZ]
          Length = 1139

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 28/171 (16%), Positives = 58/171 (33%), Gaps = 19/171 (11%)

Query: 3   FQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
            ++           G+ +V+  +GVG    ++   V G   +F V    ++   L VPV 
Sbjct: 453 ARRTVTNNASELTIGDVVVHKDYGVGIFIALRTLTVCGSCHDF-VEIKYRNDDKLFVPVE 511

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
               I    ++     +  L  +   A           ++   K    D+       + L
Sbjct: 512 DTDLITKYGINT----DVVLDRLGSSAWHD--------KQNKLKKRIDDI------AKTL 553

Query: 123 HRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
              ++  + +   R L  S      +E   V +  + +AI  +E +L+   
Sbjct: 554 LHAEAMRKLADGSRFLPSSLYIDFCKECPYVETEDQLKAIADVENDLARGK 604


>gi|184154691|ref|YP_001843031.1| transcription-repair coupling factor [Lactobacillus fermentum IFO
           3956]
 gi|183226035|dbj|BAG26551.1| transcription-repair coupling factor [Lactobacillus fermentum IFO
           3956]
          Length = 1180

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 21/163 (12%), Positives = 59/163 (36%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  EV G+  ++ V+   +D   + VPV +   +    
Sbjct: 494 TDLKPGDYVVHVNHGIGLFAGIKTMEVDGVHQDYMVLD-YRDNAQIFVPVTQLNLVQKYV 552

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E             K      +      +   ++ +       ++V    + +++   
Sbjct: 553 SAE------------SKTPRLNRLGGVEWAKTKRRVAAKIEDIADDLVDLYAKRETEKGF 600

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++ +    +    +   E     +  + ++I  I+ ++     
Sbjct: 601 AFPKDDYLQ---EKFDDEFPYAETKDQLQSIQEIKADMERPRP 640


>gi|157690837|ref|YP_001485299.1| transcription-repair coupling factor [Bacillus pumilus SAFR-032]
 gi|157679595|gb|ABV60739.1| transcription-repair coupling factor [Bacillus pumilus SAFR-032]
          Length = 1177

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 21/163 (12%), Positives = 56/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I+  E+ G+  ++      +    L VPV +   +    
Sbjct: 498 SELQVGDYVVHINHGIGKYLGIETLEIGGIHKDYL-NIHYQGSDKLYVPVEQIDQVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +     +    K+ S       ++++     ++    
Sbjct: 557 GSE------------GKEPKLYKLGGSDWKRVKKKVESSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I+ I+ ++  +  
Sbjct: 605 AFSPDHEMQR---QFESAFPYQETDDQIRSIHEIKQDMERERP 644


>gi|39995128|ref|NP_951079.1| transcription-repair coupling factor [Geobacter sulfurreducens PCA]
 gi|39981890|gb|AAR33352.1| transcription-repair coupling factor [Geobacter sulfurreducens PCA]
 gi|298504158|gb|ADI82881.1| transcription-repair coupling factor [Geobacter sulfurreducens
           KN400]
          Length = 1157

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 24/172 (13%), Positives = 55/172 (31%), Gaps = 17/172 (9%)

Query: 4   QQKRD-AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
           ++K+        + G+H+V+  HGVG    ++   ++G   +F ++ +      L +PV 
Sbjct: 485 RKKQIMTSLAELKPGDHMVHLDHGVGIYRGLQHLSLSGCAGDFLLLEYAGGD-KLYLPVD 543

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
           +   +     SE            G       +     ++   K  +       E++R  
Sbjct: 544 RLSLVQRYVGSE------------GIEPRVDRLGGTSWEKAKGKARAAVQEMAEELLRIY 591

Query: 123 HRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                     +S                A   +  +  AI  +  +++S   
Sbjct: 592 AARQLHEGHRFSPPDDL---YREFEASFAYEETSDQLAAIEDVIADMTSNRP 640


>gi|322381190|ref|ZP_08055193.1| transcription-repair coupling factor-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154766|gb|EFX47037.1| transcription-repair coupling factor-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 1173

 Score =  104 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 25/163 (15%), Positives = 54/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           Q  + G+++V+  HG+G    I   E+ G+  ++  I +      L VP+ +   I    
Sbjct: 486 QELKVGDYVVHVNHGIGKYVGIGTLEINGIHKDYLHILYAGGD-KLSVPIDQIDLIQKYV 544

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE             K      +          K+ S       ++++      S    
Sbjct: 545 GSE------------EKEPKIYKLGGAEWARVKNKVRSSVKDIADDLIKLYAERQSTLGY 592

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S+   Y+   +          +  +  AI  I+ ++     
Sbjct: 593 AFSKDSTYQ---HEFEAMFPYDETHDQLRAIEEIKKDMEKPLP 632


>gi|168183619|ref|ZP_02618283.1| transcription-repair coupling factor [Clostridium botulinum Bf]
 gi|237797000|ref|YP_002864552.1| transcription-repair coupling factor [Clostridium botulinum Ba4
           str. 657]
 gi|182673263|gb|EDT85224.1| transcription-repair coupling factor [Clostridium botulinum Bf]
 gi|229263299|gb|ACQ54332.1| transcription-repair coupling factor [Clostridium botulinum Ba4
           str. 657]
          Length = 1168

 Score =  104 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 56/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+ +V+  HG+G    IK+ E+ G K ++           L VPV +   +    
Sbjct: 499 TELKPGDFVVHANHGIGVFKGIKQLELQGNKKDYL-ELIYHSDDKLYVPVEQLDMVQRYI 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      + S    +   K+         ++V+      +    
Sbjct: 558 GSE------------GKKPKVNKLGSSEWTKTKNKVKKSIEEIAEDLVKLYAIRATLKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            YS+  +++    +   E     +  +  AI  I+ ++ S   
Sbjct: 606 KYSDDTVWQ---KQFEEEFPYEETPDQLLAIEDIKRDMESPKP 645


>gi|156741461|ref|YP_001431590.1| transcription-repair coupling factor [Roseiflexus castenholzii DSM
           13941]
 gi|156232789|gb|ABU57572.1| transcription-repair coupling factor [Roseiflexus castenholzii DSM
           13941]
          Length = 1246

 Score =  104 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 19/164 (11%), Positives = 56/164 (34%), Gaps = 18/164 (10%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           +G + G+++V+  HG+     +  + V G+  ++       +   L VPV +   +    
Sbjct: 537 RGLKPGDYVVHIEHGIAVYEGLVRRSVGGVARDYL-NLRYAEGDRLYVPVDQIDRVSRYI 595

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +     +  L  +  +                 +       A+ ++  +L    +Q + 
Sbjct: 596 GAGDAEPQ--LTRLGTQD--------------WERAKRKARAAVQDLADELIGLYAQRQL 639

Query: 132 SYSERQLYESALNR-MVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +       ++   R +      V +  + +AI  ++ ++     
Sbjct: 640 AEGHAFSPDTEWQRELEASFPYVETPDQLKAIIDVKRDMEQPQP 683


>gi|254687524|ref|ZP_05151380.1| transcriptional regulator, CarD family protein [Bacillus anthracis
           str. CNEVA-9066]
 gi|254741862|ref|ZP_05199549.1| transcriptional regulator, CarD family protein [Bacillus anthracis
           str. Kruger B]
          Length = 146

 Score =  104 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 66/134 (49%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ IVYP +G G I  I+E+E+ G   ++ VI      M + +P+ +    G+R +
Sbjct: 1   MFQIGDKIVYPMNGAGVIEAIEEKEILGTIRQYCVIRIISKDMQVMLPMDQLQKSGIRYI 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   +
Sbjct: 61  VDKGTLDDILLEFQNGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALN 120

Query: 133 YSERQLYESALNRM 146
            SE+Q+ ++A    
Sbjct: 121 ASEKQMLDNARKMF 134


>gi|153940210|ref|YP_001392893.1| transcription-repair coupling factor [Clostridium botulinum F str.
           Langeland]
 gi|152936106|gb|ABS41604.1| transcription-repair coupling factor [Clostridium botulinum F str.
           Langeland]
 gi|295320870|gb|ADG01248.1| transcription-repair coupling factor [Clostridium botulinum F str.
           230613]
          Length = 1168

 Score =  104 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 56/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+ +V+  HG+G    IK+ E+ G K ++           L VPV +   +    
Sbjct: 499 TELKPGDFVVHANHGIGVFKGIKQLELQGNKKDYL-ELIYHSDDKLYVPVEQLDMVQRYI 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      + S    +   K+         ++V+      +    
Sbjct: 558 GSE------------GKKPKVSKLGSSEWTKTKNKVKKSIEEIAEDLVKLYAIRATLKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            YS+  +++    +   E     +  +  AI  I+ ++ S   
Sbjct: 606 KYSDDTVWQ---KQFEEEFPYEETPDQLLAIEDIKRDMESPKP 645


>gi|168181008|ref|ZP_02615672.1| transcription-repair coupling factor [Clostridium botulinum NCTC
           2916]
 gi|226950995|ref|YP_002806086.1| transcription-repair coupling factor [Clostridium botulinum A2 str.
           Kyoto]
 gi|182668078|gb|EDT80057.1| transcription-repair coupling factor [Clostridium botulinum NCTC
           2916]
 gi|226842319|gb|ACO84985.1| transcription-repair coupling factor [Clostridium botulinum A2 str.
           Kyoto]
          Length = 1168

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 56/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+ +V+  HG+G    IK+ E+ G K ++           L VPV +   +    
Sbjct: 499 TELKPGDFVVHANHGIGVFKGIKQLELQGNKKDYL-ELIYHSDDKLYVPVEQLDMVQRYI 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      + S    +   K+         ++V+      +    
Sbjct: 558 GSE------------GKKPKVSKLGSSEWTKTKNKVKKSIEEIAEDLVKLYAIRATLKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            YS+  +++    +   E     +  +  AI  I+ ++ S   
Sbjct: 606 KYSDDTVWQ---KQFEEEFPYEETPDQLLAIEDIKRDMESPKP 645


>gi|256844410|ref|ZP_05549896.1| transcription-repair coupling factor [Lactobacillus crispatus
           125-2-CHN]
 gi|256613488|gb|EEU18691.1| transcription-repair coupling factor [Lactobacillus crispatus
           125-2-CHN]
          Length = 1164

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGTKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 GSE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  ++  I+ ++ S   
Sbjct: 596 AFSPDDDLQ---KQFEDAFPYPETPDQLRSVKEIKQDMESSKP 635


>gi|194018017|ref|ZP_03056624.1| transcription-repair coupling factor [Bacillus pumilus ATCC 7061]
 gi|194010354|gb|EDW19929.1| transcription-repair coupling factor [Bacillus pumilus ATCC 7061]
          Length = 1177

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 21/163 (12%), Positives = 57/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I+  E+ G+  ++      +    L VPV +   +    
Sbjct: 498 SELQVGDYVVHINHGIGKYLGIETLEIGGIHKDYL-NIHYQGSDKLYVPVEQIDQVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +     +    K+ S       ++++     ++    
Sbjct: 557 GSE------------GKEPKLYKLGGSDWKRVKKKVESSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +   ++         +  +  +I+ I+ ++  +  
Sbjct: 605 AFSPDHEMQ---HQFESAFPYQETDDQIRSIHEIKQDMERERP 644


>gi|311070702|ref|YP_003975625.1| transcription-repair coupling factor [Bacillus atrophaeus 1942]
 gi|310871219|gb|ADP34694.1| transcription-repair coupling factor [Bacillus atrophaeus 1942]
          Length = 1177

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 21/163 (12%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I+  E+ G+  ++      +    L VPV +   +    
Sbjct: 498 SELQVGDYVVHVNHGIGKYLGIETLEINGIHKDYL-NIHYQGSDKLYVPVEQIDQVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +     +    K+ +       ++++     ++    
Sbjct: 557 GSE------------GKEPKLYKLGGSEWKRVKKKVETSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +IN I+ ++  +  
Sbjct: 605 AFSPDHEMQR---EFESAFPYQETEDQLRSINEIKKDMERERP 644


>gi|170756439|ref|YP_001783179.1| transcription-repair coupling factor [Clostridium botulinum B1 str.
           Okra]
 gi|169121651|gb|ACA45487.1| transcription-repair coupling factor [Clostridium botulinum B1 str.
           Okra]
          Length = 1168

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 56/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+ +V+  HG+G    IK+ E+ G K ++           L VPV +   +    
Sbjct: 499 TELKPGDFVVHANHGIGVFKGIKQLELQGNKKDYL-ELIYHSDDKLYVPVEQLDMVQRYI 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      + S    +   K+         ++V+      +    
Sbjct: 558 GSE------------GKKPKVSKLGSSEWTKTKNKVKKSIEEIAEDLVKLYAIRATLKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            YS+  +++    +   E     +  +  AI  I+ ++ S   
Sbjct: 606 KYSDDTVWQ---KQFEEEFPYEETPDQLLAIEDIKRDMESPKP 645


>gi|239907582|ref|YP_002954323.1| hypothetical protein DMR_29460 [Desulfovibrio magneticus RS-1]
 gi|239797448|dbj|BAH76437.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 170

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 48/170 (28%), Positives = 84/170 (49%), Gaps = 4/170 (2%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F   + +VYPA GVG +  I+ Q + G   +FF++    + + L VPV  A ++G+R L
Sbjct: 1   MFSEEQLVVYPAQGVGRVERIETQVIGGASADFFIVRILSNNVTLMVPVKNAANVGLRPL 60

Query: 73  SEAHFVERALKLVRGKAR---VKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
             A      ++ ++ ++         W+RR +EY  K+ SGDL  +A V+++L       
Sbjct: 61  CTAEQGAAIIESLKDRSDFTGYTGQNWNRRYREYSEKLKSGDLADVAYVLKELLLIGQNK 120

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK-SSKTEK 178
           E S+ ER+L E A + +  E+A      + E  ++I    +     K E+
Sbjct: 121 ELSFGERRLLEQATSLLTLELALALDKDQQEIKDVINEIFADVLQPKPEE 170


>gi|227876324|ref|ZP_03994437.1| possible transcription-repair coupling factor [Mobiluncus mulieris
           ATCC 35243]
 gi|306817215|ref|ZP_07450962.1| transcription-repair coupling factor [Mobiluncus mulieris ATCC
           35239]
 gi|227843097|gb|EEJ53293.1| possible transcription-repair coupling factor [Mobiluncus mulieris
           ATCC 35243]
 gi|304650017|gb|EFM47295.1| transcription-repair coupling factor [Mobiluncus mulieris ATCC
           35239]
          Length = 1172

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 20/174 (11%), Positives = 57/174 (32%), Gaps = 8/174 (4%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +  ++++         GE++V+  HG+G   +++++ +          A  ++ + L+  
Sbjct: 481 LPTRRRKTIDPLSLSPGEYVVHAQHGIGRFVKLEKRTIGKGN-----KATSREYVVLEYA 535

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +              ++   K V G+      M      +   K          E+VR
Sbjct: 536 PSQRQGSKDLLWVPTDSLDMLSKYVGGETPTLSKMGGTDWNKAKQKARKAVKDIARELVR 595

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 S    ++S    ++     +      V +  +   I+ ++ ++     
Sbjct: 596 LYAVRQSSKGHAFSPDTPWQR---ELEDSFEYVETPDQLTTIDEVKADMEKPVP 646


>gi|307701502|ref|ZP_07638520.1| transcription-repair coupling factor [Mobiluncus mulieris FB024-16]
 gi|307613294|gb|EFN92545.1| transcription-repair coupling factor [Mobiluncus mulieris FB024-16]
          Length = 1172

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 20/174 (11%), Positives = 57/174 (32%), Gaps = 8/174 (4%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +  ++++         GE++V+  HG+G   +++++ +          A  ++ + L+  
Sbjct: 481 LPTRRRKTIDPLSLSPGEYVVHAQHGIGRFVKLEKRTIGKGN-----KATSREYVVLEYA 535

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +              ++   K V G+      M      +   K          E+VR
Sbjct: 536 PSQRQGSKDLLWVPTDSLDMLSKYVGGETPTLSKMGGTDWNKAKQKARKAVKDIARELVR 595

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 S    ++S    ++     +      V +  +   I+ ++ ++     
Sbjct: 596 LYAVRQSSKGHAFSPDTPWQR---ELEDSFEYVETPDQLTTIDEVKADMEKPVP 646


>gi|269976100|ref|ZP_06183099.1| transcription-repair coupling factor [Mobiluncus mulieris 28-1]
 gi|269935693|gb|EEZ92228.1| transcription-repair coupling factor [Mobiluncus mulieris 28-1]
          Length = 1172

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 20/174 (11%), Positives = 57/174 (32%), Gaps = 8/174 (4%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +  ++++         GE++V+  HG+G   +++++ +          A  ++ + L+  
Sbjct: 481 LPTRRRKTIDPLSLSPGEYVVHAQHGIGRFVKLEKRTIGKGN-----KATSREYVVLEYA 535

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +              ++   K V G+      M      +   K          E+VR
Sbjct: 536 PSQRQGSKDLLWVPTDSLDMLSKYVGGETPTLSKMGGTDWNKAKQKARKAVKDIARELVR 595

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 S    ++S    ++     +      V +  +   I+ ++ ++     
Sbjct: 596 LYAVRQSSKGHAFSPDTPWQR---ELEDSFEYVETPDQLTTIDEVKADMEKPVP 646


>gi|148381479|ref|YP_001256020.1| transcription-repair coupling factor [Clostridium botulinum A str.
           ATCC 3502]
 gi|153934098|ref|YP_001385854.1| transcription-repair coupling factor [Clostridium botulinum A str.
           ATCC 19397]
 gi|153937373|ref|YP_001389261.1| transcription-repair coupling factor [Clostridium botulinum A str.
           Hall]
 gi|148290963|emb|CAL85099.1| transcription-repair coupling factor [Clostridium botulinum A str.
           ATCC 3502]
 gi|152930142|gb|ABS35642.1| transcription-repair coupling factor [Clostridium botulinum A str.
           ATCC 19397]
 gi|152933287|gb|ABS38786.1| transcription-repair coupling factor [Clostridium botulinum A str.
           Hall]
          Length = 1168

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 56/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+ +V+  HG+G    IK+ E+ G K ++           L VPV +   +    
Sbjct: 499 TELKPGDFVVHANHGIGVFKGIKQLELQGNKKDYL-ELIYHSDDKLYVPVEQLDMVQRYI 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      + S    +   K+         ++V+      +    
Sbjct: 558 GSE------------GKKPKVSKLGSSEWTKTKNKVKKSIEEIAEDLVKLYAIRATLKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            YS+  +++    +   E     +  +  AI  I+ ++ S   
Sbjct: 606 KYSDDTVWQ---KQFEEEFPYEETPDQLLAIEDIKRDMESPKP 645


>gi|134095113|ref|YP_001100188.1| transcription-repair ATP-dependent coupling factor [Herminiimonas
           arsenicoxydans]
 gi|133739016|emb|CAL62064.1| Transcription-repair-coupling factor (TRCF) (ATP-dependent helicase
           Mfd) [Herminiimonas arsenicoxydans]
          Length = 1148

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 26/180 (14%), Positives = 56/180 (31%), Gaps = 25/180 (13%)

Query: 4   QQKRD---------AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
            +K++               + G+ +V+  HG+G    +   ++   + EF  + + K  
Sbjct: 463 SKKQEGATQVEAMVRDLSELKIGDPVVHVNHGIGRYMGLTSMDLGEGETEFLHLEYAK-D 521

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     +           +      +     RRA E         +  
Sbjct: 522 TKLYVPVSQLHVISRYSGASPEDAP-----LHALGSGQWEKAKRRAAE--------KIRD 568

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            A  + +L+   +  E    E                   ++ +  AIN +  +++S   
Sbjct: 569 TAAELLNLYARRALREGHSFE--YSAHDYAAFADSFGFEETVDQAAAINAVIQDMTSGKP 626


>gi|257068518|ref|YP_003154773.1| transcription-repair coupling factor Mfd [Brachybacterium faecium
           DSM 4810]
 gi|256559336|gb|ACU85183.1| transcription-repair coupling factor Mfd [Brachybacterium faecium
           DSM 4810]
          Length = 1211

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 59/178 (33%), Gaps = 16/178 (8%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGM----KLEFFVIAFDKDKMC 56
           M  +++        R G+H+V+  HGVG   E+  + V         E+ V         
Sbjct: 499 MPSRRRNVVDPLQLRPGDHVVHAHHGVGRFVEMTRRAVGSGAKRTTREYLV--------- 549

Query: 57  LKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIA 116
           ++    K    G R    +  +++  K V G+      M      +  +K          
Sbjct: 550 IEYAPSKKGQPGDRLYVPSDQLDQVTKYVGGEEPSVNRMGGADWAKTKSKARKAIREIAD 609

Query: 117 EVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           E+VR      S P  ++     ++     +      V +  +   I+ ++ ++     
Sbjct: 610 ELVRLYSARQSAPGHAFGPDTPWQR---ELEDSFEFVETPDQLVTIDDVKADMEKSVP 664


>gi|317055208|ref|YP_004103675.1| CarD family transcriptional regulator [Ruminococcus albus 7]
 gi|315447477|gb|ADU21041.1| transcriptional regulator, CarD family [Ruminococcus albus 7]
          Length = 165

 Score =  104 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 24/165 (14%), Positives = 65/165 (39%), Gaps = 7/165 (4%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMR-- 70
            ++TG+ ++Y   G+  +  ++++++ G + E++++        +            R  
Sbjct: 1   MYKTGDVVMYGTSGICRVAAVEKRDLTGEEQEYYILRNIYSDKNIYYVPVNNEAALGRMH 60

Query: 71  KLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRT----- 125
            +     V+  +  +  +  +     ++R +EY   I   D   I  +++ L+       
Sbjct: 61  PVCTKSEVDELISHMNSEGLIWIDNDNKRKEEYSRIIKDADKHEIIRLIKTLYLRRRELS 120

Query: 126 DSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
           ++      S+      A + +  E A    I   E ++ IE +L+
Sbjct: 121 ENGRRLRSSDENYLGIAEDMLFEEFAYALGIDRCEVVDYIEKHLA 165


>gi|295692138|ref|YP_003600748.1| transcription-repair coupling factor [Lactobacillus crispatus ST1]
 gi|295030244|emb|CBL49723.1| Transcription-repair coupling factor [Lactobacillus crispatus ST1]
          Length = 1164

 Score =  104 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGTKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 GSE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  ++  I+ ++ S   
Sbjct: 596 AFSPDDDLQ---KQFEDAFPYPETPDQLRSVKEIKQDMESSKP 635


>gi|293380357|ref|ZP_06626428.1| transcription-repair coupling factor [Lactobacillus crispatus
           214-1]
 gi|290923040|gb|EFD99971.1| transcription-repair coupling factor [Lactobacillus crispatus
           214-1]
          Length = 1164

 Score =  104 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGTKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 GSE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  ++  I+ ++ S   
Sbjct: 596 AFSPDDDLQ---KQFEDAFPYPETPDQLRSVKEIKQDMESSKP 635


>gi|262047218|ref|ZP_06020176.1| transcription-repair coupling factor [Lactobacillus crispatus
           MV-3A-US]
 gi|312978409|ref|ZP_07790151.1| transcription-repair coupling factor [Lactobacillus crispatus
           CTV-05]
 gi|260572463|gb|EEX29025.1| transcription-repair coupling factor [Lactobacillus crispatus
           MV-3A-US]
 gi|310894752|gb|EFQ43824.1| transcription-repair coupling factor [Lactobacillus crispatus
           CTV-05]
          Length = 1164

 Score =  104 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGTKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 GSE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  ++  I+ ++ S   
Sbjct: 596 AFSPDDDLQ---KQFEDAFPYPETPDQLRSVKEIKQDMESSKP 635


>gi|288917959|ref|ZP_06412318.1| transcription-repair coupling factor [Frankia sp. EUN1f]
 gi|288350614|gb|EFC84832.1| transcription-repair coupling factor [Frankia sp. EUN1f]
          Length = 1189

 Score =  104 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 61/174 (35%), Gaps = 18/174 (10%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G+ +V+ AHGVG   E+  + VAG K E+ ++ + +    L VP
Sbjct: 502 MPSRRRKGIDPLALTAGDLVVHDAHGVGRYVEMVTRTVAGAKREYLLLEYARGD-RLYVP 560

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +   +      E               R+    W++R      +          E++R
Sbjct: 561 TDQLEQVSRYVGGEG----------PSLDRIGGADWAKR----KTRARKAVKEIAGELIR 606

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +  AI+ ++ ++     
Sbjct: 607 LYSARMAAPGHAFGPDTPWQR---ELEDAFPFRETPDQLSAIDEVKADMEKPVP 657


>gi|227878367|ref|ZP_03996322.1| transcriptional repair coupling factor [Lactobacillus crispatus
           JV-V01]
 gi|256849202|ref|ZP_05554635.1| transcriptional repair coupling factor [Lactobacillus crispatus
           MV-1A-US]
 gi|227862046|gb|EEJ69610.1| transcriptional repair coupling factor [Lactobacillus crispatus
           JV-V01]
 gi|256713978|gb|EEU28966.1| transcriptional repair coupling factor [Lactobacillus crispatus
           MV-1A-US]
          Length = 1164

 Score =  104 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGTKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 GSE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  ++  I+ ++ S   
Sbjct: 596 AFSPDDDLQ---KQFEDAFPYPETPDQLRSVKEIKQDMESSKP 635


>gi|49187604|ref|YP_030857.1| CarD family transcriptional regulator [Bacillus anthracis str.
           Sterne]
 gi|65322084|ref|ZP_00395043.1| COG1329: Transcriptional regulators, similar to M. xanthus CarD
           [Bacillus anthracis str. A2012]
 gi|177651210|ref|ZP_02934041.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0174]
 gi|190568329|ref|ZP_03021237.1| transcriptional regulator, CarD family [Bacillus anthracis
           Tsiankovskii-I]
 gi|227817506|ref|YP_002817515.1| transcriptional regulator, CarD family [Bacillus anthracis str. CDC
           684]
 gi|49181531|gb|AAT56907.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           Sterne]
 gi|172083036|gb|EDT68098.1| transcriptional regulator, CarD family [Bacillus anthracis str.
           A0174]
 gi|190560585|gb|EDV14562.1| transcriptional regulator, CarD family [Bacillus anthracis
           Tsiankovskii-I]
 gi|227003355|gb|ACP13098.1| transcriptional regulator, CarD family [Bacillus anthracis str. CDC
           684]
          Length = 153

 Score =  104 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 39/135 (28%), Positives = 68/135 (50%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
           F+ G+ IVYP +G G I  I+E+E+ G   ++ VI      M + +P+ +    G+R + 
Sbjct: 7   FQIGDKIVYPMNGAGVIEAIEEKEILGTIRQYCVIRIISKDMQVMLPMDQLQKSGIRYIV 66

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
           +   ++  L   +         W +R      K+ +G+L   AEVVRDL R + +   + 
Sbjct: 67  DKGTLDDILLEFQNGESDTSLSWKQRYTMNMEKMKNGNLQDSAEVVRDLLRRNKERALNA 126

Query: 134 SERQLYESALNRMVR 148
           SE+Q+ ++A   M R
Sbjct: 127 SEKQMLDNARKMMFR 141


>gi|325955975|ref|YP_004286585.1| transcription-repair coupling factor [Lactobacillus acidophilus
           30SC]
 gi|325332540|gb|ADZ06448.1| transcription-repair coupling factor [Lactobacillus acidophilus
           30SC]
          Length = 1164

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G+K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGVKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 GSE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I  I+ ++     
Sbjct: 596 AFSPDDDLQR---QFDDAFPYPETPDQLRSIKEIKEDMEKPKP 635


>gi|315037511|ref|YP_004031079.1| transcription-repair coupling factor [Lactobacillus amylovorus GRL
           1112]
 gi|312275644|gb|ADQ58284.1| transcription-repair coupling factor [Lactobacillus amylovorus GRL
           1112]
          Length = 1164

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G+K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGVKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 GSE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I  I+ ++     
Sbjct: 596 AFSPDDDLQR---QFDDAFPYPETPDQLRSIKEIKEDMEKPKP 635


>gi|118444361|ref|YP_877116.1| transcription-repair coupling factor [Clostridium novyi NT]
 gi|118134817|gb|ABK61861.1| transcription-repair coupling factor [Clostridium novyi NT]
          Length = 1170

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/168 (16%), Positives = 58/168 (34%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +       + G+++V+  HG+G    IK+ EV G K ++           L VPV +   
Sbjct: 494 KIKSFDELKPGDYVVHTNHGIGVYKGIKQLEVQGHKKDYL-ELSYNAGDTLYVPVEQLDL 552

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     SE            GK+     +      +   K+         E+V+      
Sbjct: 553 VQKYIGSE------------GKSPKVNKLGGSEWTKAKKKVRKAINEIAEELVKLYAIRS 600

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +     + +  +++    +   E     +  +  AI  I+ ++ S  +
Sbjct: 601 TLKGHKFGKDTVWQ---KQFEDEFPYDETPDQLTAIQEIKEDMESSKA 645


>gi|229131061|ref|ZP_04259974.1| Transcription-repair-coupling factor [Bacillus cereus BDRD-ST196]
 gi|229165042|ref|ZP_04292838.1| Transcription-repair-coupling factor [Bacillus cereus AH621]
 gi|228618427|gb|EEK75456.1| Transcription-repair-coupling factor [Bacillus cereus AH621]
 gi|228652398|gb|EEL08322.1| Transcription-repair-coupling factor [Bacillus cereus BDRD-ST196]
          Length = 1176

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/179 (12%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+H+V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDHVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKEPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESLFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|284048953|ref|YP_003399292.1| transcription-repair coupling factor [Acidaminococcus fermentans
           DSM 20731]
 gi|283953174|gb|ADB47977.1| transcription-repair coupling factor [Acidaminococcus fermentans
           DSM 20731]
          Length = 1092

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/177 (14%), Positives = 60/177 (33%), Gaps = 19/177 (10%)

Query: 1   MTFQQKRDAMRQGF---RTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCL 57
           +T  + +      F   + G+++V+   G+G    ++  EV G+  ++  + +      L
Sbjct: 412 LTKTKGKGPALNYFSDIKAGDYVVHDVQGIGRYMGVETIEVNGVHRDYLQLQYAGGD-KL 470

Query: 58  KVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAE 117
            VPV +   +     +E            G       M  +  Q+   K      I   E
Sbjct: 471 HVPVEQVGLLHKYVGNE------------GTPPKLSNMGRKDWQKATRKAQKAITILATE 518

Query: 118 VVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++R   +    P  +++    ++              +  + +AI  I+ ++     
Sbjct: 519 LLRLYAQRKITPGHAFAPDTHWQ---KEFEDSFPFEETPDQLKAIAEIKADMEKPVP 572


>gi|327182807|gb|AEA31254.1| transcription-repair coupling factor [Lactobacillus amylovorus GRL
           1118]
          Length = 1164

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G+K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGVKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 GSE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I  I+ ++     
Sbjct: 596 AFSPDDDLQR---QFDDAFPYPETPDQLRSIKEIKEDMEKPKP 635


>gi|163938061|ref|YP_001642945.1| transcription-repair coupling factor [Bacillus weihenstephanensis
           KBAB4]
 gi|163860258|gb|ABY41317.1| transcription-repair coupling factor [Bacillus weihenstephanensis
           KBAB4]
          Length = 1176

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/179 (12%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+H+V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDHVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKEPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESLFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|284033574|ref|YP_003383505.1| transcription-repair coupling factor [Kribbella flavida DSM 17836]
 gi|283812867|gb|ADB34706.1| transcription-repair coupling factor [Kribbella flavida DSM 17836]
          Length = 1212

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 19/174 (10%), Positives = 60/174 (34%), Gaps = 8/174 (4%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++K+         G+ +V+  HGVG   E+ ++ V             ++ + ++  
Sbjct: 517 MPSRRKKTIDPLELGPGDFVVHEQHGVGRYVEMMQRTVG-----TGQQKATREYVVIEFA 571

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+      M      +   +          E+++
Sbjct: 572 PSKRGQPGDRLYVPTDQLDQVTRYVGGEQPTLDKMGGGDWAKRKGRARKAVRQIAGELIK 631

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    ++++   +++    +      V +  +   I+ ++ ++   + 
Sbjct: 632 LYAARQATKGHAFAKDTPWQA---ELEDAFPFVETPDQLATIDDVKRDMERVTP 682


>gi|227894501|ref|ZP_04012306.1| transcriptional repair coupling factor [Lactobacillus ultunensis
           DSM 16047]
 gi|227863660|gb|EEJ71081.1| transcriptional repair coupling factor [Lactobacillus ultunensis
           DSM 16047]
          Length = 1164

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G+K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHVNHGIGRFEGIKTLENNGVKRD-YITITYQHGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 ASE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I  I+ ++     
Sbjct: 596 AFSPDDDLQ---KQFDDAFPYPETPDQLRSIKEIKEDMEKPKP 635


>gi|296329557|ref|ZP_06872043.1| transcription-repair coupling factor [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305672754|ref|YP_003864425.1| transcription-repair coupling factor [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296153300|gb|EFG94163.1| transcription-repair coupling factor [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305410997|gb|ADM36115.1| transcription-repair coupling factor [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 1177

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/163 (12%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I+  E+ G+  ++      +    L VPV +   +    
Sbjct: 498 SELQIGDYVVHINHGIGKYLGIETLEINGIHKDYL-NIHYQGSDKLYVPVEQIDQVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +     +    K+ +       ++++     ++    
Sbjct: 557 GSE------------GKEPKLYKLGGSEWKRVKKKVETSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++  +  
Sbjct: 605 AFSPDHEMQR---EFESAFPYQETEDQLRSIHEIKKDMERERP 644


>gi|291482427|dbj|BAI83502.1| transcription-repair coupling factor [Bacillus subtilis subsp.
           natto BEST195]
          Length = 1177

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/163 (12%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I+  E+ G+  ++      +    L VPV +   +    
Sbjct: 498 SELQIGDYVVHINHGIGKYLGIETLEINGIHKDYL-NIHYQGSDKLYVPVEQIDQVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +     +    K+ +       ++++     ++    
Sbjct: 557 GSE------------GKEPKLYKLGGSEWKRVKKKVETSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++  +  
Sbjct: 605 AFSPDHEMQR---EFESAFPYQETEDQLRSIHEIKKDMERERP 644


>gi|124266762|ref|YP_001020766.1| transcription-repair coupling factor [Methylibium petroleiphilum
           PM1]
 gi|124259537|gb|ABM94531.1| transcription-repair coupling factor [Methylibium petroleiphilum
           PM1]
          Length = 1184

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 50/182 (27%), Gaps = 27/182 (14%)

Query: 3   FQQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKD 53
            ++K++               + G+ +V+  HG+G    +   ++     EF  + +   
Sbjct: 491 RRRKQEQTSDVDALIKDLSELKVGDPVVHANHGIGRYVGLVNIDLGDGPSEFLHLEYAD- 549

Query: 54  KMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLI 113
           K  L VPV +   I       A   E  L  +                    K       
Sbjct: 550 KATLYVPVAQLQLISRYTGVSAE--EAPLHRLGSGQ--------------WEKAKRKAAE 593

Query: 114 AIAEVVRDLHRTDSQPEKSYSER-QLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            + +   +L    ++         +                 +  +  AI+ +  +L S 
Sbjct: 594 QVRDTAAELLNLYARRAAREGHAFRFSPQDYEAFAASFGFEETADQRAAIHAVIQDLVSP 653

Query: 173 SS 174
             
Sbjct: 654 KP 655


>gi|16077123|ref|NP_387936.1| transcription-repair coupling factor [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221307865|ref|ZP_03589712.1| transcription-repair coupling factor [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221312187|ref|ZP_03593992.1| transcription-repair coupling factor [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221317120|ref|ZP_03598414.1| transcription-repair coupling factor [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221321383|ref|ZP_03602677.1| transcription-repair coupling factor [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|585481|sp|P37474|MFD_BACSU RecName: Full=Transcription-repair-coupling factor; Short=TRCF;
           AltName: Full=ATP-dependent helicase mfd
 gi|467444|dbj|BAA05290.1| transcription-repair coupling factor [Bacillus subtilis]
 gi|2632322|emb|CAB11831.1| transcription-repair coupling factor [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 1177

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/163 (12%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I+  E+ G+  ++      +    L VPV +   +    
Sbjct: 498 SELQIGDYVVHINHGIGKYLGIETLEINGIHKDYL-NIHYQGSDKLYVPVEQIDQVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +     +    K+ +       ++++     ++    
Sbjct: 557 GSE------------GKEPKLYKLGGSEWKRVKKKVETSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++  +  
Sbjct: 605 AFSPDHEMQR---EFESAFPYQETEDQLRSIHEIKKDMERERP 644


>gi|321313725|ref|YP_004206012.1| transcription-repair coupling factor [Bacillus subtilis BSn5]
 gi|320019999|gb|ADV94985.1| transcription-repair coupling factor [Bacillus subtilis BSn5]
          Length = 1177

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/163 (12%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I+  E+ G+  ++      +    L VPV +   +    
Sbjct: 498 SELQIGDYVVHINHGIGKYLGIETLEINGIHKDYL-NIHYQGSDKLYVPVEQIDQVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +     +    K+ +       ++++     ++    
Sbjct: 557 GSE------------GKEPKLYKLGGSEWKRVKKKVETSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++  +  
Sbjct: 605 AFSPDHEMQR---EFESAFPYQETEDQLRSIHEIKKDMERERP 644


>gi|238853544|ref|ZP_04643916.1| transcription-repair coupling factor [Lactobacillus gasseri 202-4]
 gi|238833840|gb|EEQ26105.1| transcription-repair coupling factor [Lactobacillus gasseri 202-4]
          Length = 1165

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    IK  +V G K + ++    +    L VP  +   +     
Sbjct: 490 ELKPGDYVVHVNHGIGRFEGIKTLDVDGKKRD-YITITYQHHDQLFVPADQLGLVQKYVA 548

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE            GK      + S    +   ++ S       +++    + +S+   +
Sbjct: 549 SE------------GKVPHINKLGSAEWAKTKKRVQSKVEDIADDLIELYAKRESEKGFA 596

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     +              +  +  +I  I+ ++ S   
Sbjct: 597 FSPDDDLQ---KEFEDAFPYPETPDQLRSIREIKADMESPKP 635


>gi|116628945|ref|YP_814117.1| transcription-repair coupling factor [Lactobacillus gasseri ATCC
           33323]
 gi|116094527|gb|ABJ59679.1| transcription-repair coupling factor [Lactobacillus gasseri ATCC
           33323]
          Length = 1165

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    IK  +V G K + ++    +    L VP  +   +     
Sbjct: 490 ELKPGDYVVHVNHGIGRFEGIKTLDVDGKKRD-YITITYQHHDQLFVPADQLGLVQKYVA 548

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE            GK      + S    +   ++ S       +++    + +S+   +
Sbjct: 549 SE------------GKVPHINKLGSAEWAKTKKRVQSKVEDIADDLIELYAKRESEKGFA 596

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     +              +  +  +I  I+ ++ S   
Sbjct: 597 FSPDDDLQ---KEFEDAFPYPETPDQLRSIREIKADMESPKP 635


>gi|325838706|ref|ZP_08166621.1| transcription-repair coupling factor [Turicibacter sp. HGF1]
 gi|325490756|gb|EGC93063.1| transcription-repair coupling factor [Turicibacter sp. HGF1]
          Length = 1176

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 67/185 (36%), Gaps = 28/185 (15%)

Query: 2   TFQQKRDAMRQGF------------RTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIA 49
           T ++K+   +  F            + G+++V+  HG+G    I+  E  G + +F  + 
Sbjct: 471 TKRKKQPTYKSSFKEGKKIKDFNELKIGDYVVHVQHGIGQYIGIETLESNGARKDFL-MI 529

Query: 50  FDKDKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINS 109
             +    L VP+ K   +     SE            G       + +   ++  AK+  
Sbjct: 530 AYRGDDKLYVPIDKIQMVQKYVGSE------------GAKPKINKLGTSEWEKTKAKVKK 577

Query: 110 GDLIAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
                  ++++   + +  P  ++S+  + + A          V +  + +A+  I+ ++
Sbjct: 578 TVKDIADKLIKIYAQREHLPGYAFSKDTIEQHA---FENAFPYVETEDQLKAVAEIKEDM 634

Query: 170 SSKSS 174
                
Sbjct: 635 EQPHP 639


>gi|229053900|ref|ZP_04195335.1| Transcription-repair-coupling factor [Bacillus cereus AH603]
 gi|228721441|gb|EEL72961.1| Transcription-repair-coupling factor [Bacillus cereus AH603]
          Length = 1176

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/179 (12%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+H+V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDHVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKEPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESLFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|187777479|ref|ZP_02993952.1| hypothetical protein CLOSPO_01047 [Clostridium sporogenes ATCC
           15579]
 gi|187774407|gb|EDU38209.1| hypothetical protein CLOSPO_01047 [Clostridium sporogenes ATCC
           15579]
          Length = 1172

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 56/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+ +V+  HG+G    IK+ E+ G K ++           L VPV +   +    
Sbjct: 503 TELKPGDFVVHANHGIGVFKGIKQLELQGNKKDYL-ELIYHSDDKLYVPVEQLDMVQRYI 561

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      + S    +   K+         ++V+      +    
Sbjct: 562 GSE------------GKKPKVNKLGSSEWTKTKNKVKKSIEEIAEDLVKLYAIRATLKGY 609

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            YS+  +++    +   E     +  +  AI  I+ ++ S   
Sbjct: 610 KYSDDTVWQ---KQFEEEFPYEETPDQVLAIEDIKRDMESPKP 649


>gi|311695148|gb|ADP98021.1| transcription-repair-coupling factor [marine bacterium HP15]
          Length = 1177

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/180 (14%), Positives = 56/180 (31%), Gaps = 24/180 (13%)

Query: 3   FQQKRDAM--------RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
            ++++               R G  +V+  HGVG    ++   V G   EF ++ +    
Sbjct: 483 RRREKPTETDDAGFRDLSELRIGAPVVHIDHGVGRYLGLETITVEGEASEFLMLGYAG-G 541

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV     I     ++                    + + R      K        
Sbjct: 542 SKLYVPVSSLHLISRYAGNDTEHAP------------LHKLGTDRWSTAKQKALEKIRDT 589

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            AE++    R +++   S+ +    + A            +  +  AI  +  +++S+  
Sbjct: 590 AAELLDVYARREARKGFSFED---PKEAYRAFAAGFPFEETPDQQVAIQSVFEDMTSEQP 646


>gi|229009563|ref|ZP_04166790.1| Transcription-repair-coupling factor [Bacillus mycoides DSM 2048]
 gi|228751707|gb|EEM01506.1| Transcription-repair-coupling factor [Bacillus mycoides DSM 2048]
          Length = 1176

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/179 (12%), Positives = 57/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              + G+H+V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVGDHVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKEPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESLFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|256374814|ref|YP_003098474.1| transcription-repair coupling factor [Actinosynnema mirum DSM
           43827]
 gi|255919117|gb|ACU34628.1| transcription-repair coupling factor [Actinosynnema mirum DSM
           43827]
          Length = 1187

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 64/174 (36%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++        RTG+++V+  HG+G   E+ ++ VAG   E+ V         L+  
Sbjct: 484 MPSRRRNAVDPLALRTGDYVVHEQHGIGRYVEMVQRTVAGATREYLV---------LEYA 534

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       ++   + V G+      +     +   AK         AE+V+
Sbjct: 535 SSKRGQPGDRLFVPTDQLDEVSRYVGGELPTLNKLGGSDWKNTKAKAKKAVKQIAAELVQ 594

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 S P  +++    ++     +        ++ +  AI+ ++ ++     
Sbjct: 595 LYAARQSAPGHAFAPDTPWQR---ELEDAFPFTETVDQMAAIDEVKADMERGVP 645


>gi|86742605|ref|YP_483005.1| transcription-repair coupling factor [Frankia sp. CcI3]
 gi|86569467|gb|ABD13276.1| transcription-repair coupling factor [Frankia sp. CcI3]
          Length = 1208

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 63/174 (36%), Gaps = 18/174 (10%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++         G+ +V+ AHGVG   E+  + VAG K E+ ++ + +    L VP
Sbjct: 519 MPSRRRKGIDPLALLPGDMVVHDAHGVGRYVEMVTRTVAGAKREYLLLEYARGD-RLYVP 577

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +   I      +A              R+    W++R       +         E++R
Sbjct: 578 TDQLEQITRYVGGDA----------PSLDRIGGADWAKRKSRARRAVK----EIAGELIR 623

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  +++    ++     +        +  +  AI+ ++ ++     
Sbjct: 624 LYSARMAAPGHAFAPDSPWQR---ELEDAFPFRETPDQLAAIDEVKADMEKPVP 674


>gi|260893903|ref|YP_003240000.1| transcription-repair coupling factor [Ammonifex degensii KC4]
 gi|260866044|gb|ACX53150.1| transcription-repair coupling factor [Ammonifex degensii KC4]
          Length = 1123

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/165 (14%), Positives = 60/165 (36%), Gaps = 16/165 (9%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
             + F+ GE++V+P HG+G    + +  V G+  E+ +I +  +   L +P  +   +  
Sbjct: 456 EEREFKPGEYVVHPEHGIGIYRGLVQLSVEGVTREYALIQYAGED-RLYLPADQLG-VLE 513

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
           R +       R  +L  G+            +   A++         E++R     ++  
Sbjct: 514 RYVGGEGAKPRLSRLGGGE-----------WKRVRARVKQAATDVARELLRLYAMRETAK 562

Query: 130 EKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
             ++S    ++              +  +  AI  ++ ++     
Sbjct: 563 GHAFSPDTPWQR---EFEAAFPYEETPDQLRAIADVKADMEKPRP 604


>gi|227903169|ref|ZP_04020974.1| transcriptional repair coupling factor [Lactobacillus acidophilus
           ATCC 4796]
 gi|227868974|gb|EEJ76395.1| transcriptional repair coupling factor [Lactobacillus acidophilus
           ATCC 4796]
          Length = 1165

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G+K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHINHGIGRFEGIKTLENNGVKRD-YITITYQRGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 GSE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I  I+ ++     
Sbjct: 596 AFSPDDDLQR---KFDDAFPYPETADQLRSIKEIKEDMEKPKP 635


>gi|184201352|ref|YP_001855559.1| transcription-repair coupling factor [Kocuria rhizophila DC2201]
 gi|183581582|dbj|BAG30053.1| transcription-repair coupling factor [Kocuria rhizophila DC2201]
          Length = 1254

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 19/172 (11%), Positives = 57/172 (33%), Gaps = 3/172 (1%)

Query: 3   FQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
            +++        + G+++V+  HG+G   E+ ++ +AG           ++ + L+    
Sbjct: 546 RRKRNQVDPLALQKGDYVVHEQHGIGQFIELVQRPIAGAMTAPGQPKPVREYLVLEYAAS 605

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
           K      R       +++    V G+A     M      +              E++R  
Sbjct: 606 KRNGPRDRLFVPTDQLDQVSTYVGGEAPSLSKMGGADWNKTKRSAKKAVKEIANELIRLY 665

Query: 123 HRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
               +    S+     ++     + +    + +  +   I+ ++ ++     
Sbjct: 666 SARMASKGHSFGPDTPWQR---ELEQAFPYIETPDQLTTIDEVKADMERPIP 714


>gi|58336612|ref|YP_193197.1| transcriptional repair coupling factor [Lactobacillus acidophilus
           NCFM]
 gi|58253929|gb|AAV42166.1| transcriptional repair coupling factor [Lactobacillus acidophilus
           NCFM]
          Length = 1165

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK  E  G+K + ++    +    L VP  +   +    
Sbjct: 489 TELKPGDYVVHINHGIGRFEGIKTLENNGVKRD-YITITYQRGDQLFVPADQLSLVQKYV 547

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +      +   K+ S       +++    + +S+   
Sbjct: 548 GSE------------GKTPHINKLGGSEWAKTKRKVQSKVEDIADDLIELYAKRESEKGF 595

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I  I+ ++     
Sbjct: 596 AFSPDDDLQR---KFDDAFPYPETADQLRSIKEIKEDMEKPKP 635


>gi|307729622|ref|YP_003906846.1| transcription-repair coupling factor [Burkholderia sp. CCGE1003]
 gi|307584157|gb|ADN57555.1| transcription-repair coupling factor [Burkholderia sp. CCGE1003]
          Length = 1161

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 51/181 (28%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           +++++               + G+ +V+  HG+G    +   ++   + EF  + +    
Sbjct: 463 RRRQEQASNVDSMVRDLSELKVGDPVVHSQHGIGRYMGLVTMDLGEGETEFLHLEYAG-D 521

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     ++       L  +                    K        
Sbjct: 522 SKLYVPVAQLHVISRYSGADPESAP--LHSLGSGQ--------------WEKAKRKAAQQ 565

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++           E     +         +  +  AI  +  +++S  
Sbjct: 566 IRDTAAELLNLYARRAARSGHAFALEPKDYVKFAESFGFEETPDQAAAIAAVIGDMTSGK 625

Query: 174 S 174
            
Sbjct: 626 P 626


>gi|323526062|ref|YP_004228215.1| transcription-repair coupling factor [Burkholderia sp. CCGE1001]
 gi|323383064|gb|ADX55155.1| transcription-repair coupling factor [Burkholderia sp. CCGE1001]
          Length = 1160

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 51/181 (28%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           +++++               + G+ +V+  HG+G    +   ++   + EF  + +    
Sbjct: 463 RRRQEQASNVDSMVRDLSELKVGDPVVHSQHGIGRYMGLVTMDLGEGETEFLHLEYAG-D 521

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     ++       L  +                    K        
Sbjct: 522 SKLYVPVAQLHVISRYSGADPESAP--LHSLGSGQ--------------WEKAKRKAAQQ 565

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++           E     +         +  +  AI  +  +++S  
Sbjct: 566 IRDTAAELLNLYARRAARSGHAFALEPKDYVKFAESFGFEETPDQAAAIAAVIGDMTSGK 625

Query: 174 S 174
            
Sbjct: 626 P 626


>gi|170692379|ref|ZP_02883542.1| transcription-repair coupling factor [Burkholderia graminis C4D1M]
 gi|170142809|gb|EDT10974.1| transcription-repair coupling factor [Burkholderia graminis C4D1M]
          Length = 1160

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 51/181 (28%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           +++++               + G+ +V+  HG+G    +   ++   + EF  + +    
Sbjct: 463 RRRQEQASNVDSMVRDLSELKVGDPVVHSQHGIGRYMGLVTMDLGEGETEFLHLEYAG-D 521

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     ++       L  +                    K        
Sbjct: 522 SKLYVPVAQLHVISRYSGADPESAP--LHSLGSGQ--------------WEKAKRKAAQQ 565

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++           E     +         +  +  AI  +  +++S  
Sbjct: 566 IRDTAAELLNLYARRAARSGHAFALEPKDYVKFAESFGFEETPDQAAAIAAVIGDMTSGK 625

Query: 174 S 174
            
Sbjct: 626 P 626


>gi|296131721|ref|YP_003638968.1| transcription-repair coupling factor [Thermincola sp. JR]
 gi|296030299|gb|ADG81067.1| transcription-repair coupling factor [Thermincola potens JR]
          Length = 1178

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/167 (13%), Positives = 59/167 (35%), Gaps = 18/167 (10%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           +       G+++V+  HG+G    +++ EV G+  ++ +I +  +   L VP  +   + 
Sbjct: 503 SHFTDLSVGDYVVHVNHGIGRYLGLQKLEVGGVTKDYLIIQYTGED-KLYVPTDQISLVQ 561

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
               +E    +  L  + G+                 K+      ++ E+ ++L    + 
Sbjct: 562 KYLGAEGAAPK--LSRLGGQD--------------WNKVKKRVKESVREMAQELLNLYAT 605

Query: 129 PEKSYSERQLYESALNR-MVREIAAVNSISEPEAINLIEVNLSSKSS 174
            EK        ++   +          +  +  AI  I+ ++     
Sbjct: 606 REKVVGHAYPPDTVWQKEFEEAFPYEETPDQLRAIKEIKEDMERPKP 652


>gi|149182807|ref|ZP_01861269.1| transcription-repair coupling factor [Bacillus sp. SG-1]
 gi|148849474|gb|EDL63662.1| transcription-repair coupling factor [Bacillus sp. SG-1]
          Length = 1177

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 22/163 (13%), Positives = 56/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+H+V+  HG+G    I+  E+ G+  ++  I   +    L VPV +   +    
Sbjct: 498 SELKIGDHVVHVNHGIGKYLGIETLEINGVHKDYLHIK-YQGNDKLYVPVEQFDLVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE             K      +     ++   K+ S       ++++     ++    
Sbjct: 557 ASE------------SKDPKLYKLGGTEWKKVKNKVESSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++  +  
Sbjct: 605 AFSPDGDMQR---EFETSFPYQETEDQLRSIDEIKKDMERERP 644


>gi|154684574|ref|YP_001419735.1| hypothetical protein RBAM_000640 [Bacillus amyloliquefaciens FZB42]
 gi|154350425|gb|ABS72504.1| Mfd [Bacillus amyloliquefaciens FZB42]
          Length = 1177

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 20/163 (12%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I+  E+ G+  ++      +    L VPV +   +    
Sbjct: 498 SELQVGDYVVHVNHGIGKYLGIETLEIKGIHKDYL-NIHYQGSDKLYVPVEQIDQVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +     +    K+ +       ++++     ++    
Sbjct: 557 GSE------------GKEPKLYKLGGSEWKRVKKKVENSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I  I+ ++  +  
Sbjct: 605 AFSPDHEMQR---QFESAFPYQETEDQLRSIQEIKKDMERERP 644


>gi|293375931|ref|ZP_06622192.1| transcription-repair coupling factor [Turicibacter sanguinis PC909]
 gi|292645453|gb|EFF63502.1| transcription-repair coupling factor [Turicibacter sanguinis PC909]
          Length = 1176

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 67/185 (36%), Gaps = 28/185 (15%)

Query: 2   TFQQKRDAMRQGF------------RTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIA 49
           T ++K+   +  F            + G+++V+  HG+G    I+  E  G + +F  + 
Sbjct: 471 TKRKKQPTYKSSFKEGKKIKDFNELKIGDYVVHVQHGIGQYIGIETLESNGARKDFL-MI 529

Query: 50  FDKDKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINS 109
             +    L VP+ K   +     SE            G       + +   ++  AK+  
Sbjct: 530 AYRGDDKLYVPIDKIQMVQKYVGSE------------GAKPKINKLGTSEWEKTKAKVKK 577

Query: 110 GDLIAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNL 169
                  ++++   + +  P  ++S+  + + A          V +  + +A+  I+ ++
Sbjct: 578 TVKDIADKLIKIYAQREHLPGYAFSKDTIEQHA---FENAFPYVETEDQLKAVTEIKEDM 634

Query: 170 SSKSS 174
                
Sbjct: 635 EQPHP 639


>gi|312796442|ref|YP_004029364.1| transcription-repair coupling factor [Burkholderia rhizoxinica HKI
           454]
 gi|312168217|emb|CBW75220.1| Transcription-repair coupling factor [Burkholderia rhizoxinica HKI
           454]
          Length = 1165

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 21/183 (11%), Positives = 50/183 (27%), Gaps = 27/183 (14%)

Query: 2   TFQQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDK 52
             +++++               + G+ +V+  HGVG    +   ++     EF  +   +
Sbjct: 470 ASRRRQEQASDVDSMVRDLSELKVGDPVVHSQHGVGRYMGLVTMDLGEGDTEFLHL-AYQ 528

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
               L VPV +   I     ++       L  +                    K      
Sbjct: 529 GDSKLYVPVSQLHVISRYGGADPDSAP--LHALGSGQ--------------WEKAKRRAA 572

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSS 171
             I +   +L    ++           +     R         +  +  AI  +  +++S
Sbjct: 573 QQIRDTAAELLNLYARRAARQGHAFALDPRDYVRFAESFGFDETPDQAAAIAAVIGDMTS 632

Query: 172 KSS 174
              
Sbjct: 633 GKP 635


>gi|222056789|ref|YP_002539151.1| transcription-repair coupling factor [Geobacter sp. FRC-32]
 gi|221566078|gb|ACM22050.1| transcription-repair coupling factor [Geobacter sp. FRC-32]
          Length = 1169

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 60/173 (34%), Gaps = 17/173 (9%)

Query: 3   FQQKRD-AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
            ++K+        + G+++V+   GVG    ++    +GM+ +F ++ +      L +PV
Sbjct: 496 ARRKQLLTSLAELKPGDYMVHIDFGVGIYRGLQHLTFSGMEGDFLLLEYAGAD-KLYLPV 554

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            +   +     +E            G       +     ++  AK  +       E+++ 
Sbjct: 555 DRINLVQRYVGAE------------GVEPHVDKLGGAGWEKTKAKARAAIQEMAGELLKI 602

Query: 122 LHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +   ++S     +          A   +  +  AI  + +++ SK  
Sbjct: 603 YAARQVEEGHAFS---PPDELYQEFEAAFAYEETPDQQAAIEDVLLDMESKKP 652


>gi|269794110|ref|YP_003313565.1| transcription-repair coupling factor Mfd [Sanguibacter keddieii DSM
           10542]
 gi|269096295|gb|ACZ20731.1| transcription-repair coupling factor Mfd [Sanguibacter keddieii DSM
           10542]
          Length = 1212

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 21/183 (11%), Positives = 57/183 (31%), Gaps = 26/183 (14%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAG----MKLEFFVIAFD----- 51
           M  +++        R G+ +V+  HGVG   E+ ++ + G       E+ V+ +      
Sbjct: 511 MPSKRRNVVDPLQLRAGDFVVHEQHGVGRFVELVQRTLGGGAAAATREYLVVEYASSRRG 570

Query: 52  KDKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGD 111
           +    L VP  +   +                   G++     M      +   +     
Sbjct: 571 QPGDRLFVPTDQLDQVTKYTG--------------GESPALNKMGGSDWAKTKGRAKKAI 616

Query: 112 LIAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSS 171
               +E++R      +    ++     ++     +    A   +  +   I+ ++ ++  
Sbjct: 617 KEIASELIRLYSARMATKGHAFGPDTPWQR---ELEDAFAYTETPDQLATIDEVKQDMEK 673

Query: 172 KSS 174
              
Sbjct: 674 TIP 676


>gi|304319738|ref|YP_003853381.1| transcription-repair coupling factor [Parvularcula bermudensis
           HTCC2503]
 gi|303298641|gb|ADM08240.1| transcription-repair coupling factor [Parvularcula bermudensis
           HTCC2503]
          Length = 1163

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 52/167 (31%), Gaps = 19/167 (11%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
                   G+ IV+  HG+G    ++  EV G   +  ++   +    L +PV     + 
Sbjct: 489 TEASSLSVGDLIVHVDHGIGRYDGLETLEVGGAPHDCLIL-TYQKGDKLFLPVENIELLS 547

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
                 +      L  + G A      W  R  +   +        I  +  +L    ++
Sbjct: 548 R---FGSDDPSHPLDRLGGGA------WQSRKAKMRER--------IRLMAEELIAIAAK 590

Query: 129 PEKSYSERQLYES-ALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                +E     S A +          +  +  AI+ +  +LS    
Sbjct: 591 RAARRAEELAPPSGAYDEFAARFPYTETDDQLNAIDDVISDLSRGRP 637


>gi|300362407|ref|ZP_07058583.1| transcription-repair coupling factor [Lactobacillus gasseri JV-V03]
 gi|300353398|gb|EFJ69270.1| transcription-repair coupling factor [Lactobacillus gasseri JV-V03]
          Length = 1171

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    IK  +V G K + ++    +    L VP  +   +     
Sbjct: 490 ELKPGDYVVHVNHGIGRFEGIKTLDVDGKKRD-YITITYQHHDQLFVPADQLGLVQKYVA 548

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE            GK      + S    +   ++ S       +++    + +S+   +
Sbjct: 549 SE------------GKVPHINKLGSAEWAKTKKRVQSKVEDIADDLIELYAKRESEKGFA 596

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     +              +  +  +I  I+ ++ S   
Sbjct: 597 FSPDDDLQ---KEFEDAFPYPETPDQLRSIREIKADMESPKP 635


>gi|313621017|gb|EFR92140.1| transcription-repair coupling factor [Listeria innocua FSL S4-378]
          Length = 899

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETDDQLRSISEIKKDMERPRP 645


>gi|315274585|ref|ZP_07869461.1| transcription-repair-coupling factor [Listeria marthii FSL S4-120]
 gi|313615787|gb|EFR89039.1| transcription-repair-coupling factor [Listeria marthii FSL S4-120]
          Length = 770

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEDAFPYQETEDQLRSISEIKKDMERPRP 645


>gi|126737697|ref|ZP_01753427.1| transcription-repair coupling factor [Roseobacter sp. SK209-2-6]
 gi|126721090|gb|EBA17794.1| transcription-repair coupling factor [Roseobacter sp. SK209-2-6]
          Length = 1158

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/177 (14%), Positives = 50/177 (28%), Gaps = 23/177 (12%)

Query: 2   TFQQKRD----AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCL 57
             ++++        Q    G+ +V+  HG+G    ++    AG   E  ++ +  +   L
Sbjct: 464 PKKRRKAENFLTETQSLSPGDLVVHVDHGIGRYRGLEVVTAAGAAHECILLEYA-EDSKL 522

Query: 58  KVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAE 117
            +PV     +           E  L  + G A           Q   AK+          
Sbjct: 523 YLPVENIELLSKY-----GHDEGLLDRLGGGA----------WQAKKAKLKERIREMADR 567

Query: 118 VVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++R       +             A            +  +  AI  +  +L S   
Sbjct: 568 LIRIAAERALRKAPVM---DPPPHAWEEFSARFPYQETEDQLRAIEDVMEDLHSGQP 621


>gi|302388692|ref|YP_003824513.1| transcription-repair coupling factor [Thermosediminibacter oceani
           DSM 16646]
 gi|302199320|gb|ADL06890.1| transcription-repair coupling factor [Thermosediminibacter oceani
           DSM 16646]
          Length = 1177

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 55/168 (32%), Gaps = 16/168 (9%)

Query: 6   KRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAI 65
           KR         G+++V+  HG+G    I+  EV G K ++F I +      L VP  +  
Sbjct: 497 KRITSIDELSAGDYVVHITHGIGRYLGIETLEVEGHKKDYFAIQYAGGD-KLYVPTDQVE 555

Query: 66  DIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRT 125
            +      E             +      + S    +   ++         E++      
Sbjct: 556 MLHKYVGPE------------DRPPKLNKLGSSEWAKAKTRVKESVKEMAKELLELYAAR 603

Query: 126 DSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
            +    ++S   +++     +        +  +  AI  ++ ++ S  
Sbjct: 604 QAMKGFAFSPDTVWQKEFEDL---FPYEETPDQLTAIEEVKRDMESDK 648


>gi|289642495|ref|ZP_06474639.1| transcription-repair coupling factor [Frankia symbiont of Datisca
           glomerata]
 gi|289507669|gb|EFD28624.1| transcription-repair coupling factor [Frankia symbiont of Datisca
           glomerata]
          Length = 1238

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/174 (16%), Positives = 60/174 (34%), Gaps = 18/174 (10%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  ++++       R G+ +V+ AHGVG   E+  + VAG   E+ V+ + K    L VP
Sbjct: 547 MPHRRRKGIDPLALRAGDLVVHDAHGVGRYIEMVTRTVAGATREYLVLEYAKGD-RLYVP 605

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +   +      E               R+    W++R      +          E++R
Sbjct: 606 TDQLEQVTRYVGGEG----------PSLDRIGGADWAKR----KGRARKAVKEIAGELIR 651

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +        +  +  AI  ++ ++     
Sbjct: 652 LYSARMAAPGHAFGPDTPWQR---ELEDAFPFRETPDQLSAIEEVKADMRKPVP 702


>gi|227888873|ref|ZP_04006678.1| transcription-repair coupling factor [Lactobacillus johnsonii ATCC
           33200]
 gi|227850566|gb|EEJ60652.1| transcription-repair coupling factor [Lactobacillus johnsonii ATCC
           33200]
          Length = 1165

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    IK  +V G K + ++    +    L VP  +   +     
Sbjct: 490 ELKPGDYVVHVNHGIGRFEGIKTLDVDGKKRD-YITITYQHHDQLFVPADQLGLVQKYVA 548

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE            G+      + S    +   ++ S       +++    + +S+   +
Sbjct: 549 SE------------GRVPHINKLGSSEWTKTKKRVQSKVEDIADDLIELYAKRESEKGFA 596

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     +              +  +  +I  I+ ++ S   
Sbjct: 597 FSPDDDLQ---KEFEDAFPYPETPDQLRSIREIKADMESPKP 635


>gi|297567462|ref|YP_003686434.1| CarD family transcriptional regulator [Meiothermus silvanus DSM
           9946]
 gi|296851911|gb|ADH64926.1| transcriptional regulator, CarD family [Meiothermus silvanus DSM
           9946]
          Length = 164

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/161 (21%), Positives = 68/161 (42%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           + +R G+ +V P +GVG +  I ++ ++G +  ++ + F   +    VPV       MR 
Sbjct: 2   KEYRPGDKVVLPPYGVGVVASIMQRTISGNQRAYYQVEFPNTRSKAYVPVESPQSARMRP 61

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
                 +E  L+L+R         W+ R ++    +  GD   IA +   L   + +   
Sbjct: 62  ALCREEIEEILELLRNGRLSLPRQWAARHRKTSEILAEGDPYRIATLAGQLRAWELERGL 121

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
              +RQ +  A++ +  E+     +S  EA  + E     +
Sbjct: 122 PDLDRQAFRRAIHLLAEEVCQAMEVSLEEARAMFENAWGEE 162


>gi|269959135|ref|YP_003328924.1| transcription repair coupling factor [Anaplasma centrale str.
           Israel]
 gi|269848966|gb|ACZ49610.1| transcription repair coupling factor [Anaplasma centrale str.
           Israel]
          Length = 1122

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 57/160 (35%), Gaps = 19/160 (11%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
              G+ +V+  +GVG    ++   V G   +F V    ++     VPV     I     +
Sbjct: 461 LAVGDVVVHKDYGVGIFNALRTLSVCGHLHDF-VEILYRNNDKFFVPVEDIDLITKYGTN 519

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++               W  R+ +   +I         ++ + L  +++    + 
Sbjct: 520 TDVVLDKLGST----------SWQERSAKLKKRIK--------DIAQTLLHSEAMRVLAE 561

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
             + L         +E   V +  + +AI+ +E +L+S  
Sbjct: 562 GNKFLANQRYLDFCKEFPYVETEDQLKAISEVEEDLASGK 601


>gi|255003926|ref|ZP_05278727.1| transcription repair coupling factor (mfd) [Anaplasma marginale
           str. Virginia]
          Length = 1148

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 57/160 (35%), Gaps = 19/160 (11%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
              G+ +V+  +GVG    ++   V G   +F V    ++     VPV     I     +
Sbjct: 487 LAVGDVVVHKDYGVGIFNALRTLSVCGHLHDF-VEILYRNNDKFFVPVEDIDLITKYGTN 545

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++               W  R+ +   +I         ++ + L  +++    + 
Sbjct: 546 TDVVLDKLGST----------SWQERSAKLKKRIK--------DIAQTLLHSEAMRVLAE 587

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
             + L         +E   V +  + +AI+ +E +L+S  
Sbjct: 588 GNKFLANQRYLDFCKEFPYVETEDQLKAISEVEEDLASGK 627


>gi|255002792|ref|ZP_05277756.1| transcription repair coupling factor (mfd) [Anaplasma marginale
           str. Puerto Rico]
          Length = 1152

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 57/160 (35%), Gaps = 19/160 (11%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
              G+ +V+  +GVG    ++   V G   +F V    ++     VPV     I     +
Sbjct: 491 LAVGDVVVHKDYGVGIFNALRTLSVCGHLHDF-VEILYRNNDKFFVPVEDIDLITKYGTN 549

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++               W  R+ +   +I         ++ + L  +++    + 
Sbjct: 550 TDVVLDKLGST----------SWQERSAKLKKRIK--------DIAQTLLHSEAMRVLAE 591

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
             + L         +E   V +  + +AI+ +E +L+S  
Sbjct: 592 GNKFLANQRYLDFCKEFPYVETEDQLKAISEVEEDLASGK 631


>gi|254994680|ref|ZP_05276870.1| transcription repair coupling factor (mfd) [Anaplasma marginale
           str. Mississippi]
          Length = 1099

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 57/160 (35%), Gaps = 19/160 (11%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
              G+ +V+  +GVG    ++   V G   +F V    ++     VPV     I     +
Sbjct: 438 LAVGDVVVHKDYGVGIFNALRTLSVCGHLHDF-VEILYRNNDKFFVPVEDIDLITKYGTN 496

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++               W  R+ +   +I         ++ + L  +++    + 
Sbjct: 497 TDVVLDKLGST----------SWQERSAKLKKRIK--------DIAQTLLHSEAMRVLAE 538

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
             + L         +E   V +  + +AI+ +E +L+S  
Sbjct: 539 GNKFLANQRYLDFCKEFPYVETEDQLKAISEVEEDLASGK 578


>gi|222474820|ref|YP_002563235.1| transcription repair coupling factor (mfd) [Anaplasma marginale
           str. Florida]
 gi|222418956|gb|ACM48979.1| transcription repair coupling factor (mfd) [Anaplasma marginale
           str. Florida]
          Length = 1152

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 57/160 (35%), Gaps = 19/160 (11%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
              G+ +V+  +GVG    ++   V G   +F V    ++     VPV     I     +
Sbjct: 491 LAVGDVVVHKDYGVGIFNALRTLSVCGHLHDF-VEILYRNNDKFFVPVEDIDLITKYGTN 549

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++               W  R+ +   +I         ++ + L  +++    + 
Sbjct: 550 TDVVLDKLGST----------SWQERSAKLKKRIK--------DIAQTLLHSEAMRVLAE 591

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
             + L         +E   V +  + +AI+ +E +L+S  
Sbjct: 592 GNKFLANQRYLDFCKEFPYVETEDQLKAISEVEEDLASGK 631


>gi|229542275|ref|ZP_04431335.1| transcription-repair coupling factor [Bacillus coagulans 36D1]
 gi|229326695|gb|EEN92370.1| transcription-repair coupling factor [Bacillus coagulans 36D1]
          Length = 1179

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/178 (15%), Positives = 58/178 (32%), Gaps = 21/178 (11%)

Query: 2   TFQQK-----RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMC 56
           T +QK     R         G+++V+  HG+G    I   E+ G+  ++  I   +    
Sbjct: 481 TRRQKLSNAERIKNYSELNVGDYVVHVNHGIGKYLGIVTLEINGVHKDYLHIK-YQGSDK 539

Query: 57  LKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIA 116
           L VPV +   +     SE            GK      +     +    K+ S       
Sbjct: 540 LYVPVDQIDLVQKYVGSE------------GKEPKLYKLGGSEWKRVKRKVQSSIQDIAD 587

Query: 117 EVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++V+     ++    ++S     +              +  +  +I  I+ ++  +  
Sbjct: 588 DLVKLYAEREASKGFAFSPDGDMQR---EFEAAFPYKETEDQLRSIQEIKRDMEKEKP 642


>gi|56416451|ref|YP_153525.1| transcription repair coupling factor [Anaplasma marginale str. St.
           Maries]
 gi|56387683|gb|AAV86270.1| transcription repair coupling factor [Anaplasma marginale str. St.
           Maries]
          Length = 1152

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 57/160 (35%), Gaps = 19/160 (11%)

Query: 14  FRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLS 73
              G+ +V+  +GVG    ++   V G   +F V    ++     VPV     I     +
Sbjct: 491 LAVGDVVVHKDYGVGIFNALRTLSVCGHLHDF-VEILYRNNDKFFVPVEDIDLITKYGTN 549

Query: 74  EAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSY 133
               +++               W  R+ +   +I         ++ + L  +++    + 
Sbjct: 550 TDVVLDKLGST----------SWQERSAKLKKRIK--------DIAQTLLHSEAMRVLAE 591

Query: 134 SERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
             + L         +E   V +  + +AI+ +E +L+S  
Sbjct: 592 GNKFLANQRYLDFCKEFPYVETEDQLKAISEVEEDLASGK 631


>gi|319648579|ref|ZP_08002793.1| mfd protein [Bacillus sp. BT1B_CT2]
 gi|317389346|gb|EFV70159.1| mfd protein [Bacillus sp. BT1B_CT2]
          Length = 1177

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 21/163 (12%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I+  E+ G+  ++      +    L VPV +   +    
Sbjct: 498 SELQIGDYVVHVNHGIGKYLGIETLEINGIHKDYL-NIHYQGSDKLYVPVDQIDQVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +     +    K+ S       ++++     ++    
Sbjct: 557 GSE------------GKEPKLYKLGGSEWKRVKKKVESSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++  +  
Sbjct: 605 AFSPDHEMQR---EFEAAFPYQETEDQLRSIHEIKRDMEKERP 644


>gi|52078550|ref|YP_077341.1| transcription-repair coupling factor [Bacillus licheniformis ATCC
           14580]
 gi|52783912|ref|YP_089741.1| hypothetical protein BLi00068 [Bacillus licheniformis ATCC 14580]
 gi|52001761|gb|AAU21703.1| transcription-repair coupling factor [Bacillus licheniformis ATCC
           14580]
 gi|52346414|gb|AAU39048.1| Mfd [Bacillus licheniformis ATCC 14580]
          Length = 1177

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 21/163 (12%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I+  E+ G+  ++      +    L VPV +   +    
Sbjct: 498 SELQIGDYVVHVNHGIGKYLGIETLEINGIHKDYL-NIHYQGSDKLYVPVDQIDQVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +     +    K+ S       ++++     ++    
Sbjct: 557 GSE------------GKEPKLYKLGGSEWKRVKKKVESSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++  +  
Sbjct: 605 AFSPDHEMQR---EFEAAFPYQETEDQLRSIHEIKRDMEKERP 644


>gi|229494982|ref|ZP_04388731.1| transcription-repair coupling factor [Rhodococcus erythropolis
           SK121]
 gi|229318076|gb|EEN83948.1| transcription-repair coupling factor [Rhodococcus erythropolis
           SK121]
          Length = 1208

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 58/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +  +++          G+ +V+  HG+G   E+ E+ + G + E+ V         ++  
Sbjct: 507 LPAKRRNQVDPLALSAGDMVVHDQHGIGRFVEMVERTIGGARREYLV---------IEYA 557

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+      +          K          E+V+
Sbjct: 558 PSKRGHPGDRLFVPMESLDQLSRYVGGELPALSKLGGSDWANTKRKARKAVREIAGELVQ 617

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +    A   +I +   I+ ++ ++     
Sbjct: 618 LYAARQAAPGHAFGPDTPWQ---KELEDAFAFTETIDQLTVISEVKADMEKPVP 668


>gi|226307788|ref|YP_002767748.1| transcription-repair coupling factor [Rhodococcus erythropolis PR4]
 gi|226186905|dbj|BAH35009.1| transcription-repair coupling factor [Rhodococcus erythropolis PR4]
          Length = 1229

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 58/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           +  +++          G+ +V+  HG+G   E+ E+ + G + E+ V         ++  
Sbjct: 528 LPAKRRNQVDPLALSAGDMVVHDQHGIGRFVEMVERTIGGARREYLV---------IEYA 578

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+      +          K          E+V+
Sbjct: 579 PSKRGHPGDRLFVPMESLDQLSRYVGGELPALSKLGGSDWANTKRKARKAVREIAGELVQ 638

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++     +    A   +I +   I+ ++ ++     
Sbjct: 639 LYAARQAAPGHAFGPDTPWQ---KELEDAFAFTETIDQLTVISEVKADMEKPVP 689


>gi|4090863|gb|AAC98900.1| transcription-repair coupling factor [Listeria monocytogenes]
          Length = 1190

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 510 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 568

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 569 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 616

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 617 AFSADDEMQR---EFEEAFPYQETEDQLRSISEIKKDMERPRP 656


>gi|150014978|ref|YP_001307232.1| transcription-repair coupling factor [Clostridium beijerinckii
           NCIMB 8052]
 gi|149901443|gb|ABR32276.1| transcription-repair coupling factor [Clostridium beijerinckii
           NCIMB 8052]
          Length = 1166

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/162 (17%), Positives = 59/162 (36%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    IK+ +V G K ++           L VPV +   I     
Sbjct: 501 ELKPGDYVVHANHGIGVYKGIKQIDVGGHKRDYL-DIVYDKGDKLYVPVDQLDLIQKYIG 559

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE            GK+     + S   Q+  AK          ++V+      +     
Sbjct: 560 SE------------GKSPKVNKLGSAEWQKAKAKARKSINEIAEDLVKLYAMRSTVKGHK 607

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S+   ++    +   E     +  +  ++  I++++ S   
Sbjct: 608 FSKDTEWQ---KQFEDEFPFEETPDQLTSLEEIKIDMESDKP 646


>gi|313625455|gb|EFR95204.1| transcription-repair coupling factor [Listeria innocua FSL J1-023]
          Length = 899

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETDDQLRSISEIKKDMERPRP 645


>gi|86159279|ref|YP_466064.1| CarD family transcriptional regulator [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85775790|gb|ABC82627.1| transcriptional regulator, CarD family [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 399

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/163 (23%), Positives = 77/163 (47%)

Query: 11  RQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMR 70
               + G+ +VYP  GV  +   + +++AG KLE   +  ++D   + VP GK   IG+R
Sbjct: 27  ADELKPGDRVVYPNQGVCAVVGWEVKDIAGQKLELVRMTREEDGAAVMVPKGKVPSIGLR 86

Query: 71  KLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
           +++    +E     +          W  R ++   ++ +G ++ +AEVV+ LH       
Sbjct: 87  RVATGAQMEGVFHYLGAVYDDPELDWKIRHRDNADRLIAGGVLGVAEVVKGLHSLSRLRP 146

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
               ER+ Y++A + +V E++   ++    A + I+  L   +
Sbjct: 147 LPTKEREQYDNARHLLVHEVSVSLAVPPGLAEDYIDYALMPPA 189


>gi|299066652|emb|CBJ37845.1| transcription-repair ATP-dependent coupling factor, helicase
           [Ralstonia solanacearum CMR15]
          Length = 1143

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 49/181 (27%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           ++K++               + G+ +V+  HG+G    +   ++   + EF  +      
Sbjct: 459 RRKQEQATAVDAMVRDLAELKIGDPVVHSEHGIGRYQGLVSIDMGNGEEEFLHLD-YDKG 517

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     ++       L  +                    K        
Sbjct: 518 SKLYVPVHQLHVISRYSGADPDTAP--LHQLGSGQ--------------WDKAKRKAAQQ 561

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++             +             +  +  AI  +  +++S  
Sbjct: 562 IRDTAAELLNLYARRALRQGFAFPLAPNDYETFAESFGFDETPDQAAAITAVIADMTSGK 621

Query: 174 S 174
            
Sbjct: 622 P 622


>gi|302876604|ref|YP_003845237.1| transcription-repair coupling factor [Clostridium cellulovorans
           743B]
 gi|307687278|ref|ZP_07629724.1| transcription-repair coupling factor [Clostridium cellulovorans
           743B]
 gi|302579461|gb|ADL53473.1| transcription-repair coupling factor [Clostridium cellulovorans
           743B]
          Length = 1173

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 62/166 (37%), Gaps = 16/166 (9%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           +     + G+++V+  HG+G    IK+ EV  +K ++  +    D   L VPV +   I 
Sbjct: 500 SSFAELKPGDYVVHANHGIGVYKGIKQLEVENVKKDYL-MVSYSDGDTLYVPVEQLDLIQ 558

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
               SE            GKA     +     Q+   K  +       ++V+     ++ 
Sbjct: 559 KYIGSE------------GKAPKITKLGGSEWQKAKTKARNSINEIAQDLVKLYATREAV 606

Query: 129 PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
              S+S+   ++    +   E     +  +  AI  I+V++     
Sbjct: 607 KGYSFSKDTTWQ---QQFEAEFPYEETPDQISAIEEIKVDMEKNKP 649


>gi|332654772|ref|ZP_08420514.1| transcription-repair coupling factor [Ruminococcaceae bacterium
           D16]
 gi|332516115|gb|EGJ45723.1| transcription-repair coupling factor [Ruminococcaceae bacterium
           D16]
          Length = 1164

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 60/181 (33%), Gaps = 23/181 (12%)

Query: 2   TFQQKRDAMRQGFR------TGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
             Q+K    RQ  +       G+ +V+  HGVG    + +    G++ ++  IA+    +
Sbjct: 479 PRQKKETTNRQKLKSYADLSPGDLVVHEHHGVGRYVGMVKMPADGIEKDYVKIAYAGSDV 538

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVE-RALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
            L VP  +   I           E + L  + G                  +  +    A
Sbjct: 539 -LYVPATQLDLISKYIGGGEDAQETKKLSKLGGTD--------------WERAKTRAKKA 583

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYESALNR-MVREIAAVNSISEPEAINLIEVNLSSKS 173
           + ++ + L    +Q ++        +S   R    +     +  +   I  I+ ++ S  
Sbjct: 584 VQDLAKGLIELYAQRQRQPGYAFSPDSPWQREFEEQFEYTETDDQLRCIQEIKKDMESPV 643

Query: 174 S 174
            
Sbjct: 644 P 644


>gi|296448068|ref|ZP_06889971.1| transcription-repair coupling factor [Methylosinus trichosporium
           OB3b]
 gi|296254425|gb|EFH01549.1| transcription-repair coupling factor [Methylosinus trichosporium
           OB3b]
          Length = 1173

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/182 (13%), Positives = 52/182 (28%), Gaps = 26/182 (14%)

Query: 1   MTFQQKRDA-------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKD 53
           M  ++++                G+ +V+  HG+G    ++    AG   +   I +   
Sbjct: 481 MVRRRRKTKHTENLLGEIAALSAGDLVVHVDHGIGRFIGLETITAAGAPHDCLEIHYAGG 540

Query: 54  KMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLI 113
              L +PV     +      +               ++    W  R      +       
Sbjct: 541 D-KLYLPVENIELLSRYGSEDTEAQL---------DKLGGVGWQTRKARMKNR------- 583

Query: 114 AIAEVVRDLHRTDSQPEKSYSERQ-LYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            I E+ + L    +Q     + +    E   +          +  +  AI  +  +LSS 
Sbjct: 584 -IREMAKGLIAIAAQRMLRQATKLAPPEGLYDEFCARFPYDETEDQAAAIEAVLDDLSSG 642

Query: 173 SS 174
             
Sbjct: 643 RP 644


>gi|329666673|gb|AEB92621.1| transcription-repair coupling factor [Lactobacillus johnsonii DPC
           6026]
          Length = 1165

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    IK  +V G K + ++    +    L VP  +   +     
Sbjct: 490 ELKPGDYVVHVNHGIGRFEGIKTLDVDGKKRD-YITITYQHNDQLFVPADQLGLVQKYVA 548

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE            G+      + S    +   ++ S       +++    + +S+   +
Sbjct: 549 SE------------GRVPHINKLGSSEWTKTKKRVQSKVEDIADDLIELYAKRESEKGFA 596

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     +              +  +  +I  I+ ++ S   
Sbjct: 597 FSPDDDLQ---KEFEDAFPYPETPDQLRSIREIKADMESPKP 635


>gi|327439855|dbj|BAK16220.1| transcriptional regulator, similar to M. xanthus CarD [Solibacillus
           silvestris StLB046]
          Length = 153

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/152 (24%), Positives = 79/152 (51%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ GE+I+YP HG G I  ++E+E+ G K + ++I      M + +P+ K +   +R +
Sbjct: 1   MFQIGENIIYPMHGAGIIKAVEEKEILGEKQQCYIIKMSVGNMQITIPMDKILSSSIRPV 60

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           ++   ++  L + +     +   W +R +    K+ +G ++  AEVVRDL R   +   +
Sbjct: 61  TDIIELKHILHIFQHGESDEVLPWRQRYKVNTDKVKTGKILECAEVVRDLMRMKEEKALN 120

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINL 164
            SE+++  +    ++ E+  +  I+E +  + 
Sbjct: 121 TSEKEMLNNTHQFLISELGLIKGITENQIKSF 152


>gi|188584709|ref|YP_001916254.1| transcription-repair coupling factor [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179349396|gb|ACB83666.1| transcription-repair coupling factor [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 1196

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/168 (16%), Positives = 65/168 (38%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           + +  +  +  +++V+  HG+G    IK  EV G+  ++  I +  +   L VP  +  +
Sbjct: 506 KVSDYRELQVEDYVVHEKHGIGKYMGIKTLEVGGLYKDYLHIKYAGNDS-LYVPTEQIDE 564

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           I      E            GK     ++ S   Q+   ++ S       ++++      
Sbjct: 565 IQKYVGKE------------GKPPKLYSLGSSEWQKVKQRVKSSVKELAEDLLKLYAERS 612

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           S+   ++S+   ++              +  + +AI+ I+ +L S+  
Sbjct: 613 SRKGYAFSQDTPWQ---KEFEDYFPYELTPDQKKAISEIKEDLESEQP 657


>gi|304437107|ref|ZP_07397070.1| transcription-repair coupling factor [Selenomonas sp. oral taxon
           149 str. 67H29BP]
 gi|304370058|gb|EFM23720.1| transcription-repair coupling factor [Selenomonas sp. oral taxon
           149 str. 67H29BP]
          Length = 1097

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/173 (14%), Positives = 54/173 (31%), Gaps = 16/173 (9%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
               +R    +    G+++V+ +HG+G    ++  EVAG+  ++  I        L VP 
Sbjct: 416 ASAGERIRHFREIAPGDYVVHISHGIGKYLGVETIEVAGVHRDYLHI-QYGGDDKLFVPT 474

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            +   +     +E            G A     M +       AK           ++  
Sbjct: 475 DQVSLLQKYIGAE------------GAAPRLHRMGTADWARAQAKAQKSVEDIADHLIEL 522

Query: 122 LHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                     ++S     ++             +  +  AI  I+ ++ S+  
Sbjct: 523 YAARHMSKGHAFSPD---DAGQREFEEAFPYQETDDQLRAIAEIKHDMESEKP 572


>gi|42518364|ref|NP_964294.1| transcription-repair coupling factor [Lactobacillus johnsonii NCC
           533]
 gi|41582649|gb|AAS08260.1| transcription-repair coupling factor [Lactobacillus johnsonii NCC
           533]
          Length = 1165

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    IK  +V G K + ++    +    L VP  +   +     
Sbjct: 490 ELKPGDYVVHVNHGIGRFEGIKTLDVDGKKRD-YITITYQHHDQLFVPADQLGLVQKYVA 548

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE            G+      + S    +   ++ S       +++    + +S+   +
Sbjct: 549 SE------------GRVPHINKLGSSEWTKTKKRVQSKVEDIADDLIELYAKRESEKGFA 596

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     +              +  +  +I  I+ ++ S   
Sbjct: 597 FSPDDDLQ---KEFEDAFPYPETPDQLRSIREIKADMESPKP 635


>gi|331694753|ref|YP_004330992.1| transcription-repair coupling factor [Pseudonocardia dioxanivorans
           CB1190]
 gi|326949442|gb|AEA23139.1| transcription-repair coupling factor [Pseudonocardia dioxanivorans
           CB1190]
          Length = 1194

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 62/180 (34%), Gaps = 24/180 (13%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD-----KDKM 55
           M  +++        + G+ +V+  HG+G   E++E+ V G   E+ V+ +      +   
Sbjct: 494 MPARRRNAVDLAVLQPGDFVVHSQHGIGKFVEMRERTVQGATREYLVLEYASSKRGQPAD 553

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP     +I      E   + +    + G                 +K  S    A+
Sbjct: 554 RLFVPTDALDEISRYVGGEQPTLNK----LGGAD--------------WSKTKSRARKAV 595

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNR-MVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++   L +  +  + S       +S   R +        +  +  AI+ ++ ++     
Sbjct: 596 RDIAAGLVQLYAARQASPGHAFASDSPWQRELEDAFPFTETPDQLAAIDEVKADMERPVP 655


>gi|116871596|ref|YP_848377.1| transcription-repair coupling factor [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|116740474|emb|CAK19594.1| transcription-repair coupling factor [Listeria welshimeri serovar
           6b str. SLCC5334]
          Length = 1179

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 57/163 (34%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK      +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKTPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETEDQLRSISEIKKDMERPRP 645


>gi|332671526|ref|YP_004454534.1| transcription-repair coupling factor [Cellulomonas fimi ATCC 484]
 gi|332340564|gb|AEE47147.1| transcription-repair coupling factor [Cellulomonas fimi ATCC 484]
          Length = 1222

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/178 (15%), Positives = 61/178 (34%), Gaps = 16/178 (8%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVA----GMKLEFFVIAFDKDKMC 56
           M  +++        R G+ +V+  HGVG   E+ ++ +         E+ VI +   K  
Sbjct: 520 MPSRRRNVVDPLQLRPGDFVVHEQHGVGRFVELVQRTIGTGANAATREYLVIEYASSK-- 577

Query: 57  LKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIA 116
                      G R    +  +++  K V G+A     M      +   +         A
Sbjct: 578 -------RGQPGDRLFVPSDQLDQVTKYVGGEAPTLNRMGGGDWAKTKGRARRAVKEIAA 630

Query: 117 EVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           E++R      + P  ++     ++     +    A V +  +   I+ ++ ++     
Sbjct: 631 ELIRLYSARMATPGHAFGADTPWQR---ELEDAFAYVETPDQLATIDEVKADMEKSVP 685


>gi|255520464|ref|ZP_05387701.1| transcription-repair coupling factor [Listeria monocytogenes FSL
           J1-175]
          Length = 1179

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETEDQLRSISEIKKDMERPRP 645


>gi|209964568|ref|YP_002297483.1| transcription-repair coupling factor [Rhodospirillum centenum SW]
 gi|209958034|gb|ACI98670.1| transcription-repair coupling factor [Rhodospirillum centenum SW]
          Length = 1209

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 59/177 (33%), Gaps = 23/177 (12%)

Query: 3   FQQKRDA----MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLK 58
            +++R A       G   G+ +V+  HG+G    ++  +V G   +   + ++     L 
Sbjct: 482 RKKRRAANFIAEASGLNPGDLVVHIDHGIGRYDGLETLDVGGAPHDCLRLVYEGGD-KLY 540

Query: 59  VPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEV 118
           VPV     +  R  SE    +          R+    W  R      ++         ++
Sbjct: 541 VPVENIE-VLSRYGSEDSAGQ--------LDRLGGAGWQSRKARVKKRLK--------DM 583

Query: 119 VRDLHRTDSQPEKSYSER-QLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
              L R  ++     +    + + A +          +  +  AI  +  +LSS   
Sbjct: 584 AAALLRIAAERALRTAPPVAVPDGAWDEFCARFPYAETDDQLHAIEDVLGDLSSGRP 640


>gi|228995444|ref|ZP_04155114.1| Transcription-repair-coupling factor [Bacillus mycoides Rock3-17]
 gi|228764305|gb|EEM13182.1| Transcription-repair-coupling factor [Bacillus mycoides Rock3-17]
          Length = 1183

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 20/179 (11%), Positives = 56/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              +  +++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 489 SQRKQKLSNAERIKSYSELKVDDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 547

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 548 KLYVPIEQIDQVQKYVGSE------------GKNPKVYKLGGNDWKKVKTKVEKSVQDIA 595

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 596 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 651


>gi|46906446|ref|YP_012835.1| transcription-repair coupling factor [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|226222843|ref|YP_002756950.1| transcription-repair coupling factor [Listeria monocytogenes
           Clip81459]
 gi|254825872|ref|ZP_05230873.1| transcription-repair coupling factor [Listeria monocytogenes FSL
           J1-194]
 gi|254854444|ref|ZP_05243792.1| transcription-repair coupling factor [Listeria monocytogenes FSL
           R2-503]
 gi|254933054|ref|ZP_05266413.1| transcription-repair coupling factor [Listeria monocytogenes
           HPB2262]
 gi|300766347|ref|ZP_07076306.1| transcription-repair coupling factor [Listeria monocytogenes FSL
           N1-017]
 gi|46879710|gb|AAT03012.1| transcription-repair coupling factor [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|225875305|emb|CAS04002.1| transcription-repair coupling factor [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258607844|gb|EEW20452.1| transcription-repair coupling factor [Listeria monocytogenes FSL
           R2-503]
 gi|293584612|gb|EFF96644.1| transcription-repair coupling factor [Listeria monocytogenes
           HPB2262]
 gi|293595111|gb|EFG02872.1| transcription-repair coupling factor [Listeria monocytogenes FSL
           J1-194]
 gi|300512946|gb|EFK40034.1| transcription-repair coupling factor [Listeria monocytogenes FSL
           N1-017]
 gi|332310623|gb|EGJ23718.1| Transcription-repair-coupling factor [Listeria monocytogenes str.
           Scott A]
          Length = 1179

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETEDQLRSISEIKKDMERPRP 645


>gi|328467970|gb|EGF38997.1| transcription-repair coupling factor [Listeria monocytogenes 1816]
          Length = 1179

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETEDQLRSISEIKKDMERPRP 645


>gi|254829305|ref|ZP_05233992.1| transcription-repair coupling factor [Listeria monocytogenes FSL
           N3-165]
 gi|258601718|gb|EEW15043.1| transcription-repair coupling factor [Listeria monocytogenes FSL
           N3-165]
          Length = 1179

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETEDQLRSISEIKKDMERPRP 645


>gi|228989261|ref|ZP_04149254.1| Transcription-repair-coupling factor [Bacillus pseudomycoides DSM
           12442]
 gi|228770471|gb|EEM19042.1| Transcription-repair-coupling factor [Bacillus pseudomycoides DSM
           12442]
          Length = 1176

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 20/179 (11%), Positives = 56/179 (31%), Gaps = 23/179 (12%)

Query: 3   FQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
            Q+K+              +  +++V+  HG+G    I+  E+ G+  ++      +   
Sbjct: 482 SQRKQKLSNAERIKSYSELKVDDYVVHVNHGIGKFLGIETLEINGVHKDYL-NIKYQGND 540

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VP+ +   +     SE            GK      +     ++   K+        
Sbjct: 541 KLYVPIEQIDQVQKYVGSE------------GKNPKVYKLGGNDWKKVKTKVEKSVQDIA 588

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            ++++     ++    +Y+      +             +  +  +I  I+ ++     
Sbjct: 589 DDLIKLYAEREASKGYAYTPDT---AEQQEFESSFPYQETEDQLRSIEEIKKDMERGRP 644


>gi|254832465|ref|ZP_05237120.1| transcription-repair coupling factor [Listeria monocytogenes
           10403S]
          Length = 1179

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETEDQLRSISEIKKDMERPRP 645


>gi|47093156|ref|ZP_00230931.1| transcription-repair coupling factor [Listeria monocytogenes str.
           4b H7858]
 gi|47018463|gb|EAL09221.1| transcription-repair coupling factor [Listeria monocytogenes str.
           4b H7858]
          Length = 1179

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETEDQLRSISEIKKDMERPRP 645


>gi|16802260|ref|NP_463745.1| transcription-repair coupling factor [Listeria monocytogenes EGD-e]
 gi|224503466|ref|ZP_03671773.1| transcription-repair coupling factor [Listeria monocytogenes FSL
           R2-561]
 gi|284803047|ref|YP_003414912.1| transcription-repair coupling factor [Listeria monocytogenes
           08-5578]
 gi|284996188|ref|YP_003417956.1| transcription-repair coupling factor [Listeria monocytogenes
           08-5923]
 gi|16409579|emb|CAD00741.1| transcription-repair coupling factor [Listeria monocytogenes EGD-e]
 gi|284058609|gb|ADB69550.1| transcription-repair coupling factor [Listeria monocytogenes
           08-5578]
 gi|284061655|gb|ADB72594.1| transcription-repair coupling factor [Listeria monocytogenes
           08-5923]
          Length = 1179

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETEDQLRSISEIKKDMERPRP 645


>gi|17546361|ref|NP_519763.1| transcription-repair coupling factor protein [Ralstonia
           solanacearum GMI1000]
 gi|17428658|emb|CAD15344.1| probable transcription-repair coupling factor protein [Ralstonia
           solanacearum GMI1000]
          Length = 1157

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 49/181 (27%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           ++K++               + G+ +V+  HG+G    +   ++   + EF  +      
Sbjct: 473 RRKQEQATAVDAMVRDLAELKIGDPVVHSEHGIGRYQGLVSIDMGNGEEEFLHLD-YDKG 531

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     ++       L  +                    K        
Sbjct: 532 SKLYVPVHQLHVISRYSGADPDTAP--LHQLGSGQ--------------WDKAKRKAAQQ 575

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++             +             +  +  AI  +  +++S  
Sbjct: 576 IRDTAAELLNLYARRALRQGFAFPLAPNDYEAFAESFGFDETPDQAAAITAVIADMTSGK 635

Query: 174 S 174
            
Sbjct: 636 P 636


>gi|47096207|ref|ZP_00233806.1| transcription-repair coupling factor [Listeria monocytogenes str.
           1/2a F6854]
 gi|224500335|ref|ZP_03668684.1| transcription-repair coupling factor [Listeria monocytogenes
           Finland 1988]
 gi|254901001|ref|ZP_05260925.1| transcription-repair coupling factor [Listeria monocytogenes J0161]
 gi|254913931|ref|ZP_05263943.1| transcription-repair coupling factor [Listeria monocytogenes J2818]
 gi|47015455|gb|EAL06389.1| transcription-repair coupling factor [Listeria monocytogenes str.
           1/2a F6854]
 gi|293591949|gb|EFG00284.1| transcription-repair coupling factor [Listeria monocytogenes J2818]
          Length = 1179

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETEDQLRSISEIKKDMERPRP 645


>gi|326692375|ref|ZP_08229380.1| transcription-repair coupling factor [Leuconostoc argentinum KCTC
           3773]
          Length = 1176

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 50/163 (30%), Gaps = 16/163 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
               G+++V+  HG+G    ++   V G K ++      +    + +PV +   I     
Sbjct: 493 ELNVGDYVVHVNHGIGRYEGLQTMTVDGGKQDYL-TIAYQKNAKIFIPVTQLNLIQKYIG 551

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +        L  + G                 AK        I ++  DL    +Q E  
Sbjct: 552 ASDAAKAPKLNKLGGTE--------------WAKTKRQVAAKIEDIADDLLELYAQREAE 597

Query: 133 YSERQLY-ESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                   ++A  +         +  +  +I  I+ ++     
Sbjct: 598 AGYAFPPDDTAQLKFDTAFGYPETPDQIRSIEEIKADMQKPRP 640


>gi|289433569|ref|YP_003463441.1| transcription-repair coupling factor [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|289169813|emb|CBH26351.1| transcription-repair coupling factor [Listeria seeligeri serovar
           1/2b str. SLCC3954]
          Length = 1178

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHINHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S  +  +              +  +  +I  I+ ++     
Sbjct: 606 AFSPDEEMQR---EFEDAFPYQETDDQLRSIAEIKKDMERPRP 645


>gi|217965700|ref|YP_002351378.1| transcription-repair coupling factor [Listeria monocytogenes HCC23]
 gi|217334970|gb|ACK40764.1| transcription-repair coupling factor [Listeria monocytogenes HCC23]
 gi|307569753|emb|CAR82932.1| transcription-repair coupling factor [Listeria monocytogenes L99]
          Length = 1179

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETEDQLRSISEIKKDMERPRP 645


>gi|290894278|ref|ZP_06557245.1| transcription-repair coupling factor [Listeria monocytogenes FSL
           J2-071]
 gi|290556162|gb|EFD89709.1| transcription-repair coupling factor [Listeria monocytogenes FSL
           J2-071]
          Length = 1179

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETEDQLRSISEIKKDMERPRP 645


>gi|294340382|emb|CAZ88763.1| Transcription-repair coupling factor (TRCF) (ATP-dependent helicase
           mfd) [Thiomonas sp. 3As]
          Length = 1160

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 21/182 (11%), Positives = 52/182 (28%), Gaps = 27/182 (14%)

Query: 3   FQQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKD 53
            ++K++               + G+ +V+  HG+G    + E ++     EF  + +   
Sbjct: 466 RRRKQEQASNVDALIHDLAELQPGDPVVHANHGIGRYQGLAELDLGDGPAEFLHLVYAN- 524

Query: 54  KMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLI 113
              L VPV +   IG    +     +  L ++                    K       
Sbjct: 525 DAVLYVPVSQLHLIGRYSGAAQD--DAPLHILGSGQ--------------WDKARRKAAE 568

Query: 114 AIAEVVRDLHRTDSQPEKSYSER-QLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            + +   +L    ++         +                 +  +  AI+ +  ++ S 
Sbjct: 569 QVRDAAAELLNIYARRAAHQGHAFRYSPQDYEAFAASFGFEETPDQAAAIHAVVQDMISP 628

Query: 173 SS 174
             
Sbjct: 629 KP 630


>gi|148554437|ref|YP_001262019.1| transcription-repair coupling factor [Sphingomonas wittichii RW1]
 gi|148499627|gb|ABQ67881.1| transcription-repair coupling factor [Sphingomonas wittichii RW1]
          Length = 1195

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/177 (16%), Positives = 58/177 (32%), Gaps = 23/177 (12%)

Query: 3   FQQKRDA-----MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCL 57
            ++K+ A            G+ +V+  HG+G    +    VA    +  V         L
Sbjct: 513 QKRKKSADAFLAELATLSPGDLVVHMDHGIGRYEGLTSIPVAKAPHDC-VALTYAGGDKL 571

Query: 58  KVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAE 117
            VPV     +  R  +E   V+          ++    W  R      +        I E
Sbjct: 572 YVPVENID-VLSRYGAENEGVQ--------LDKLGGVAWQARKARMKER--------IRE 614

Query: 118 VVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +  +L +T ++     +E    +S  N  V       +  +  AI  +  +L++   
Sbjct: 615 IAGELIKTAAERALRPAEAIEPDSGYNEFVDRFPYQETEDQDRAIADVIEDLAAGKP 671


>gi|251794075|ref|YP_003008806.1| transcription-repair coupling factor [Paenibacillus sp. JDR-2]
 gi|247541701|gb|ACS98719.1| transcription-repair coupling factor [Paenibacillus sp. JDR-2]
          Length = 1175

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 54/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I   E+ G+  ++  I +      L VPV +   I    
Sbjct: 486 TELKVGDYVVHQNHGIGKYVGIGTLEIGGIHKDYLHILYAGGD-KLSVPVEQVDMIQKYV 544

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE             K      +          K+ +       ++++      S P  
Sbjct: 545 GSE------------EKEPKINKLGGSEWIRAKNKVRASVQDIADDLIKLYAERQSAPGF 592

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++ +   Y++    +        +  +  AI  I+ ++     
Sbjct: 593 AFGQDTAYQNEFEAI---FPYDETRDQLRAIEEIKKDMQKPQP 632


>gi|312865767|ref|ZP_07725989.1| transcription-repair coupling factor [Streptococcus downei F0415]
 gi|311098642|gb|EFQ56864.1| transcription-repair coupling factor [Streptococcus downei F0415]
          Length = 1169

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 57/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    I+  E+ G+  ++      ++   + +PV +   +     
Sbjct: 490 ELQKGDYVVHNVHGIGRFLGIETIEIKGVHRDYL-TVQYQNGDTISIPVEQIELLSKYTA 548

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           S             GK      +   R Q+   K++        ++++           +
Sbjct: 549 S------------DGKEPKINKLNDGRFQKAKQKVSKQVEDIADDLLKLYAERSQLKGFA 596

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     +        + A V +  +  +I  ++ ++ S   
Sbjct: 597 FSAD---DDDQREFEEDFAYVETDDQLRSIKEVKADMESDKP 635


>gi|268608669|ref|ZP_06142396.1| transcriptional regulator, CarD family protein [Ruminococcus
           flavefaciens FD-1]
          Length = 165

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 67/165 (40%), Gaps = 7/165 (4%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV--GKAIDIGMR 70
            + TG+ ++Y + G+  +T I+++++ G + E++++     +  +             M 
Sbjct: 1   MYSTGDIVMYGSFGICKVTAIEKRDLTGEEQEYYILKHINSEKNIFYVPINNVTALSKMH 60

Query: 71  KLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ-- 128
            +     V+  +  +  +  +      +R +EY   I   D+  I  +++ L+    +  
Sbjct: 61  PICSKAEVDELISHMDSEELIWIDNDIKRKEEYSRIIKDADIHEIIRLIKTLYLRRKELA 120

Query: 129 ---PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
               +   ++      A N +  E A    I + E +  IE +++
Sbjct: 121 VSGKKLRSTDENYLSLAENMLFEEFAYALDIDKSEVVEYIEKHIA 165


>gi|323142048|ref|ZP_08076896.1| transcription-repair coupling factor [Phascolarctobacterium sp. YIT
           12067]
 gi|322413435|gb|EFY04306.1| transcription-repair coupling factor [Phascolarctobacterium sp. YIT
           12067]
          Length = 1090

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/182 (16%), Positives = 65/182 (35%), Gaps = 24/182 (13%)

Query: 1   MTFQQK-----RDAMRQGF---RTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDK 52
           M  +++     +    Q F   + G+++V+  HG+G    ++  EV G+  ++ ++A+  
Sbjct: 404 MQKRKRLHTKNQGQQLQYFSDIKAGDYVVHKVHGIGRYIGVENVEVDGIHRDYLLLAYAG 463

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
               L VPV +   +     SE          V   +++    W R      AK      
Sbjct: 464 -DDKLYVPVEQVGMLHKYVGSEGS--------VPRLSKMGGNDWKR----TTAKAAKAIT 510

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
               E++R   +    P  ++S     +              +  + +AI  I+ ++   
Sbjct: 511 ELAEELLRLYAQRQIMPGHAFSPDCQLQ---KDFEAAFPYEETPDQLKAIAEIKADMEKP 567

Query: 173 SS 174
             
Sbjct: 568 QP 569


>gi|163848640|ref|YP_001636684.1| transcription-repair coupling factor [Chloroflexus aurantiacus
           J-10-fl]
 gi|222526576|ref|YP_002571047.1| transcription-repair coupling factor [Chloroflexus sp. Y-400-fl]
 gi|163669929|gb|ABY36295.1| transcription-repair coupling factor [Chloroflexus aurantiacus
           J-10-fl]
 gi|222450455|gb|ACM54721.1| transcription-repair coupling factor [Chloroflexus sp. Y-400-fl]
          Length = 1185

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 18/180 (10%), Positives = 65/180 (36%), Gaps = 22/180 (12%)

Query: 1   MTFQQKRD--AMRQGF----RTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           +  ++++     R  F    + G+++V+  HG+     +  + V+ ++ E+ V+ +  + 
Sbjct: 472 LAERRRKTGTTDRAAFLRTLKPGDYVVHIEHGIAIFDGMIRRTVSEVEREYLVLRYAGED 531

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             + VPV +   +     +                     + ++  +    K+ +     
Sbjct: 532 -KIYVPVDQIDRVTRYIGAG------------DGPPTLTRLGTQDWERTKRKVRAAVQDL 578

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
             E++R   +   +   ++S    ++     +      + +  +  AI  ++ ++   + 
Sbjct: 579 AEELLRLYAQRQLKSGYAFSPDNEWQR---ELEASFPYLETDDQLRAIAEVKADMEKPTP 635


>gi|324997533|ref|ZP_08118645.1| transcription-repair coupling factor [Pseudonocardia sp. P1]
          Length = 1211

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 24/178 (13%), Positives = 58/178 (32%), Gaps = 22/178 (12%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD-----KDKMC 56
           T +++        + G+++V+  HG+G   E+KE+ V G   E+ V+ +      +    
Sbjct: 508 TPRRRNAVDLAVLQPGDYVVHNQHGIGRFVEMKERTVQGATREYLVLEYASSKRGQPADR 567

Query: 57  LKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIA 116
           L VP     +I      E   V +                     +   +         A
Sbjct: 568 LFVPTDALDEISRYVGGEQPSVNKL--------------GGADWAKTKGRARKAVKDIAA 613

Query: 117 EVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            +V+      + P  ++     ++     +        +  +  AI+ ++ ++     
Sbjct: 614 GLVQLYAARQASPGHAFGADTPWQR---ELEDAFPYTETPDQLSAIDEVKKDMERPVP 668


>gi|302390888|ref|YP_003826708.1| transcription-repair coupling factor [Acetohalobium arabaticum DSM
           5501]
 gi|302202965|gb|ADL11643.1| transcription-repair coupling factor [Acetohalobium arabaticum DSM
           5501]
          Length = 1175

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 20/168 (11%), Positives = 56/168 (33%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           + +  +    G+++V+  HG+G    +K  EV G   ++ +I +  +   L VP  +   
Sbjct: 499 KISSFEELNVGDYVVHENHGIGKYLGVKTLEVQGHNQDYLLIKYADED-KLYVPTDQVNL 557

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           I           +  L  +                    ++         E++      +
Sbjct: 558 IQKY--VGKEGNKPKLYSLGSND----------WARVKQRVKESVQEMAEELLDIYAERE 605

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            +   ++SE  +++        +     +  + + I  ++ ++ S   
Sbjct: 606 VKDGYAFSEDTVWQ---QEFESDFPYEETPDQLKTIEEVKEDMESPQP 650


>gi|298253895|ref|ZP_06977482.1| transcription-repair coupling factor [Gardnerella vaginalis 5-1]
 gi|297532038|gb|EFH71013.1| transcription-repair coupling factor [Gardnerella vaginalis 5-1]
          Length = 1202

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 16/182 (8%), Positives = 55/182 (30%), Gaps = 26/182 (14%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEV----AGMKLEFFVIAFD-----K 52
             ++++       + G+ +V+  HG+G    +K++ +         E+ VI +       
Sbjct: 515 PKRRRKAIDLMELKPGDFVVHEQHGIGCFVGMKQRNIAVSGGSATREYLVIEYAPSKRNA 574

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
               L +P  +   +     +E   + +                     +  AK      
Sbjct: 575 PNDKLFIPTDQLDLVSKYIGAEIPKLNKL--------------GGSDWAQTKAKAKKHVH 620

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
                +++           ++S+   ++     +        +  +   I+ ++ ++ + 
Sbjct: 621 EIAENLIKLYSARQQSRGFAFSKDTPWQ---KELEDAFPYQETADQLTTIDEVKADMENP 677

Query: 173 SS 174
             
Sbjct: 678 IP 679


>gi|328551756|gb|AEB22248.1| transcription-repair coupling factor [Bacillus amyloliquefaciens
           TA208]
          Length = 1177

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 20/163 (12%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I+  E+ G+  ++      +    L VPV +   +    
Sbjct: 498 SELQVGDYVVHVNHGIGKYLGIETLEIKGIHKDYL-NIHYQGSDKLYVPVEQIDQVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +     +    K+ +       ++++     ++    
Sbjct: 557 GSE------------GKEPKLYKLGGSEWKRVKKKVENSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I  I+ ++  +  
Sbjct: 605 AFSPDHEMQR---QFEAAFPYQETDDQLRSIQEIKKDMERERP 644


>gi|296136148|ref|YP_003643390.1| transcription-repair coupling factor [Thiomonas intermedia K12]
 gi|295796270|gb|ADG31060.1| transcription-repair coupling factor [Thiomonas intermedia K12]
          Length = 1160

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 21/182 (11%), Positives = 51/182 (28%), Gaps = 27/182 (14%)

Query: 3   FQQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKD 53
            ++K++               + G+ +V+  HG+G    + E ++     EF  + +   
Sbjct: 466 RRRKQEQASNVDALIHDLAELQPGDPVVHANHGIGRYQGLAELDLGDGPAEFLHLVYAN- 524

Query: 54  KMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLI 113
              L VPV +   IG    +     +  L  +                    K       
Sbjct: 525 DAVLYVPVSQLHLIGRYSGAAQE--DAPLHTLGSGQ--------------WDKARRKAAE 568

Query: 114 AIAEVVRDLHRTDSQPEKSYSER-QLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
            + +   +L    ++         +                 +  +  AI+ +  ++ S 
Sbjct: 569 QVRDAAAELLNIYARRAAHQGHAFRYSPQDYEAFAASFGFEETPDQAAAIHAVVQDMISP 628

Query: 173 SS 174
             
Sbjct: 629 KP 630


>gi|163736366|ref|ZP_02143785.1| transcription-repair coupling factor [Phaeobacter gallaeciensis
           BS107]
 gi|161390236|gb|EDQ14586.1| transcription-repair coupling factor [Phaeobacter gallaeciensis
           BS107]
          Length = 1155

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/177 (14%), Positives = 52/177 (29%), Gaps = 23/177 (12%)

Query: 2   TFQQKRD----AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCL 57
             ++++        Q    G+ +V+  HG+G    ++    AG   E  ++ +  +   L
Sbjct: 459 PKKRRKAENFLTETQSLSPGDLVVHVDHGIGRYKGLEVVTAAGAAHECILLEYA-EHSKL 517

Query: 58  KVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAE 117
            +PV     +           E  L  + G A           Q   AK+          
Sbjct: 518 YLPVENIELLSKY-----GHDEGLLDRLGGGA----------WQAKKAKLKERIREMADR 562

Query: 118 VVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++R       +             A            +  +  AI+ +  +L S S 
Sbjct: 563 LIRVAAERALRKAPMM---DPPPHAWEEFSARFPYQETDDQLRAISEVMEDLQSGSP 616


>gi|163741099|ref|ZP_02148491.1| transcription-repair coupling factor [Phaeobacter gallaeciensis
           2.10]
 gi|161385452|gb|EDQ09829.1| transcription-repair coupling factor [Phaeobacter gallaeciensis
           2.10]
          Length = 1155

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/177 (14%), Positives = 52/177 (29%), Gaps = 23/177 (12%)

Query: 2   TFQQKRD----AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCL 57
             ++++        Q    G+ +V+  HG+G    ++    AG   E  ++ +  +   L
Sbjct: 459 PKKRRKAENFLTETQSLSPGDLVVHVDHGIGRYKGLEVVTAAGAAHECILLEYA-EHSKL 517

Query: 58  KVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAE 117
            +PV     +           E  L  + G A           Q   AK+          
Sbjct: 518 YLPVENIELLSKY-----GHDEGLLDRLGGGA----------WQAKKAKLKERIREMADR 562

Query: 118 VVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++R       +             A            +  +  AI+ +  +L S S 
Sbjct: 563 LIRVAAERALRKAPMM---DPPPHAWEEFSARFPYQETDDQLRAISEVMEDLQSGSP 616


>gi|256833153|ref|YP_003161880.1| transcription-repair coupling factor [Jonesia denitrificans DSM
           20603]
 gi|256686684|gb|ACV09577.1| transcription-repair coupling factor [Jonesia denitrificans DSM
           20603]
          Length = 1216

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 24/178 (13%), Positives = 59/178 (33%), Gaps = 16/178 (8%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVA----GMKLEFFVIAFDKDKMC 56
           M  +++        + G+ +V+  HGVG   E+ ++ +         E+ V         
Sbjct: 520 MPSRRRNVVDPLQLKAGDFVVHEQHGVGKFVELVQRTLGAPGNQATREYLV--------- 570

Query: 57  LKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIA 116
           ++    +    G R       +++  K   G+      M     Q+  AK          
Sbjct: 571 IEYAASRRGQPGDRLFVPMDQLDQVTKYTGGEQPSVNKMGGADWQKTKAKARKAIKQIAG 630

Query: 117 EVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           E++R      +    +YS    ++     +    A + +  +   I+ ++ ++     
Sbjct: 631 ELIRLYSARMATQGFAYSPDTPWQR---ELEDAFAYIETPDQLATIDEVKADMEKMIP 685


>gi|163841705|ref|YP_001626109.1| transcription-repair coupling factor [Renibacterium salmoninarum
           ATCC 33209]
 gi|162955181|gb|ABY24696.1| transcription-repair coupling factor [Renibacterium salmoninarum
           ATCC 33209]
          Length = 1278

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 59/176 (33%), Gaps = 14/176 (7%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMK--LEFFVIAFDKDKMCLK 58
           M  +++        R G+ +V+  HG+G   E+ +++VAG     E+ V         L+
Sbjct: 587 MPSKRRNAVDPLQLRGGDFVVHEQHGIGRFLELIQRKVAGTDGSREYLV---------LE 637

Query: 59  VPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEV 118
               K    G R       +++    V G A     M          K          E+
Sbjct: 638 YAPSKRGAPGDRLFVPTDQLDQITAYVGGDAPALSKMGGSDWASTKNKARKAVKEIAGEL 697

Query: 119 VRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +R      +    S+S    ++     +      V +  +   IN ++ ++  +  
Sbjct: 698 IRLYSARMASRGFSFSADTPWQR---ELEEAFPYVETPDQLTTINEVKADMEREIP 750


>gi|308171946|ref|YP_003918651.1| transcription-repair coupling factor [Bacillus amyloliquefaciens
           DSM 7]
 gi|307604810|emb|CBI41181.1| transcription-repair coupling factor [Bacillus amyloliquefaciens
           DSM 7]
 gi|328910016|gb|AEB61612.1| transcription-repair coupling factor [Bacillus amyloliquefaciens
           LL3]
          Length = 1177

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 20/163 (12%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I+  E+ G+  ++      +    L VPV +   +    
Sbjct: 498 SELQVGDYVVHVNHGIGKYLGIETLEIKGIHKDYL-NIHYQGSDKLYVPVEQIDQVQKYV 556

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GK      +     +    K+ +       ++++     ++    
Sbjct: 557 GSE------------GKEPKLYKLGGSEWKRVKKKVENSVQDIADDLIKLYAEREASKGY 604

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +    +         +  +  +I  I+ ++  +  
Sbjct: 605 AFSPDHEMQR---QFEAAFPYQETDDQLRSIQEIKKDMERERP 644


>gi|71907594|ref|YP_285181.1| transcription-repair coupling factor [Dechloromonas aromatica RCB]
 gi|71847215|gb|AAZ46711.1| transcription-repair coupling factor [Dechloromonas aromatica RCB]
          Length = 1147

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 19/166 (11%), Positives = 45/166 (27%), Gaps = 18/166 (10%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
                + G+ +V+ +HG+G    +   ++   + EF       ++  L VPV +   I  
Sbjct: 470 DLTELKVGDPVVHESHGIGRYRGLIRMDLGNGEQEFL-ELHYANEAKLFVPVAQLHVISR 528

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
              +E       L  +                    K          +   +L    +  
Sbjct: 529 YSGAEPEAAP--LHTLGSGQ--------------WEKAKRRAAEQARDTAAELLTLYAAR 572

Query: 130 EKSYSERQLYES-ALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                    ++               +  + +AI  +  ++ S   
Sbjct: 573 AARQGHAFSFQENDYEAFADGFGFEETHDQAQAIAAVIEDMRSGKP 618


>gi|119960591|ref|YP_947136.1| transcription-repair coupling factor [Arthrobacter aurescens TC1]
 gi|119947450|gb|ABM06361.1| transcription-repair coupling factor [Arthrobacter aurescens TC1]
          Length = 1210

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 61/174 (35%), Gaps = 6/174 (3%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++          G+ +V+  HG+G   E+ +++VAG        A  ++ + L+  
Sbjct: 513 MPSKRRNAVDPLQLHAGDFVVHEQHGIGRFVELIQRKVAGTSSS---DAGLREYLVLEYA 569

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G A     M         +K          E++R
Sbjct: 570 PSKRGAPGDRLFVPTDQLDQVTRYVGGDAPALSKMGGADWASTKSKARKAVKEIAGELIR 629

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    +++    ++     +      V +  +   IN ++ ++  +  
Sbjct: 630 LYSARMASRGHAFAPDTPWQR---ELEEAFPYVETPDQLTTINEVKADMEREIP 680


>gi|297626903|ref|YP_003688666.1| Transcription-repair coupling factor [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
 gi|296922668|emb|CBL57245.1| Transcription-repair coupling factor [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
          Length = 1232

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 60/174 (34%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++   +    + G+ +V+  HGVG   E+ ++ VAG   E+ V         ++  
Sbjct: 509 MPTKRRNQVVPLELKPGDPLVHEQHGVGRFVEMTQRTVAGAIREYMV---------IEYA 559

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+A     M     +   ++         A +++
Sbjct: 560 ASKRGQPGDRLYVPMDQLDQVTRYVGGEAPALDKMGGAEWKHRKSRARKAVRQVAAGLIK 619

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    ++S    ++  +           +  +   I  ++ ++     
Sbjct: 620 LYAARQASRGHAFSPDTPWQHEME---DAFRYEETPDQLACITDVKHDMEQIVP 670


>gi|225867624|ref|YP_002743572.1| transcription-repair coupling factor [Streptococcus equi subsp.
           zooepidemicus]
 gi|225700900|emb|CAW97563.1| putative transcription-repair coupling factor [Streptococcus equi
           subsp. zooepidemicus]
          Length = 1164

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 55/162 (33%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
               G+++V+  HG+G    I+   + G+  + +V    +    + +PV +   +     
Sbjct: 487 ELSKGDYVVHSVHGIGRFLGIETINIQGVHRD-YVTIQYQQSDRISLPVDQLESLSKYVS 545

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +             GK      +   R Q+   ++         ++++       Q    
Sbjct: 546 A------------DGKEPKINKLNDGRFQKTKQRVKKQVEDIADDLLKLYAERSQQKGFQ 593

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     + A      + A V +  +  +I  ++ ++ S   
Sbjct: 594 FSPDDELQKA---FEEDFAFVETDDQVRSIKEVKKDMESIKP 632


>gi|218134019|ref|ZP_03462823.1| hypothetical protein BACPEC_01909 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991394|gb|EEC57400.1| hypothetical protein BACPEC_01909 [Bacteroides pectinophilus ATCC
           43243]
          Length = 191

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 66/179 (36%), Gaps = 5/179 (2%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           ++ +  R+  R  F  G+ +V   +GV  I +I + +    ++ ++++    +K      
Sbjct: 11  ISTKGIREMERHMFEKGDMVVCGNNGVCRIEKISKLDSIDSEVLYYIMQPVYEKSSTVYI 70

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             +     +R +         +K +   + ++      R  +Y A +          ++R
Sbjct: 71  PVEGHSTPIRNIMTKDEAMDFIKKIPTISEIELAGDRERESQYKACMEPAQAEGWVRIIR 130

Query: 121 DLHRTDSQ-----PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            L+R + +      +    + +  + A N +  E+A    + + E    IE  L     
Sbjct: 131 TLYRRNEERAAAGKKTINMDERYMKMAKNCLYGELAVSLGMKKDEVEAFIESILDKDEE 189


>gi|315660330|ref|ZP_07913183.1| transcription-repair coupling factor [Staphylococcus lugdunensis
           M23590]
 gi|315494619|gb|EFU82961.1| transcription-repair coupling factor [Staphylococcus lugdunensis
           M23590]
          Length = 1173

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 57/168 (33%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +    Q  + G+++V+  HGVG    ++  EV  +  ++  +   K    L VPV +   
Sbjct: 489 KIKSYQDLKVGDYVVHVHHGVGRYLGVETLEVGDVHRDYIKL-QYKGTDQLFVPVDQMDQ 547

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     SE             K+     +     ++  AK+         E++      +
Sbjct: 548 VQKYVASE------------DKSPKLNKLGGSEWKKTKAKVQQSVEDIAEELIALYKERE 595

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + E    + A      +     +  + ++I  I+ ++  +  
Sbjct: 596 MSVGYQFGEDTAEQQAFEL---DFPYELTPDQAKSIEEIKADMELQKP 640


>gi|58617486|ref|YP_196685.1| transcription-repair coupling factor [Ehrlichia ruminantium str.
           Gardel]
 gi|58417098|emb|CAI28211.1| Transcription-repair coupling factor [Ehrlichia ruminantium str.
           Gardel]
          Length = 1123

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 60/161 (37%), Gaps = 18/161 (11%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
               G+ +++  +G+G I +++  +V     +F  I +  +   L +PV     I     
Sbjct: 465 DLNIGDIVIHKDYGIGKIAKLETIKVLDNYHDFLKIEYYNND-KLFLPVENINLITRYSN 523

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
            +++             R+  T W +R  +            I ++ ++L + ++  +  
Sbjct: 524 QDSNITL---------DRLGSTSWQQRQTKLKNH--------IQKIAKELIKIEAARQLM 566

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
                L  +       E A   +  + +AI  IE +LSS  
Sbjct: 567 QGTPFLPNNIYKNFCDEFAYTETTDQLQAIQDIENDLSSGK 607


>gi|16799323|ref|NP_469591.1| transcription-repair coupling factor [Listeria innocua Clip11262]
 gi|16412675|emb|CAC95479.1| transcription-repair coupling factor [Listeria innocua Clip11262]
          Length = 1179

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 15/163 (9%), Positives = 58/163 (35%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++  ++ G+  ++ ++   + +  L +PV +   +    
Sbjct: 499 SELKVGDYVVHVNHGIARYVGMETLDINGVHKDYLLL-VYQGEDKLFIPVDQLDLVQKYV 557

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            GK+     +     +    K+ +       ++++     +++   
Sbjct: 558 GAE------------GKSPRLNKLGGAEWKRVKKKVQASVQDIADDLIKLYAEREAEKGY 605

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++S     +              +  +  +I+ I+ ++     
Sbjct: 606 AFSADDEMQR---EFEEAFPYQETDDQLRSISEIKKDMERPRP 645


>gi|281414624|ref|ZP_06246366.1| transcriptional regulator, CarD family protein [Micrococcus luteus
           NCTC 2665]
          Length = 137

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/135 (26%), Positives = 69/135 (51%)

Query: 36  QEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTM 95
           + + G +  +  +   +  + ++VP      +G+R + +A  +E  ++++R +   + T 
Sbjct: 2   RTIKGEEKMYLKLKVAQGDLTIEVPAENVDLVGVRDVVDAEGLEHVMEVLRAEHVEEPTN 61

Query: 96  WSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNS 155
           WSRR +    K+ SGD+  +AEVVRDL R D     S  E+++   A   +V E+A    
Sbjct: 62  WSRRYKANLEKLASGDVNKVAEVVRDLWRRDQDRGLSAGEKRMLSKARQVLVSELALAKK 121

Query: 156 ISEPEAINLIEVNLS 170
           ++E EA   ++  L 
Sbjct: 122 VTEEEAEGRLDKVLE 136


>gi|253681221|ref|ZP_04862019.1| transcription-repair coupling factor [Clostridium botulinum D str.
           1873]
 gi|253562459|gb|EES91910.1| transcription-repair coupling factor [Clostridium botulinum D str.
           1873]
          Length = 1169

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/168 (16%), Positives = 59/168 (35%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +       + G+++V+  HG+G    IK+ EV G K ++           L VPV +   
Sbjct: 494 KIKSFAELKPGDYVVHTNHGIGVYKGIKQLEVQGHKKDYL-ELSYTAGDTLYVPVEQLDL 552

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     SE            GK+     +      +   K+         E+V+      
Sbjct: 553 VQKYIGSE------------GKSPKVNKLGGSEWIKAKTKVKKAINEIAEELVKLYAIRS 600

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +     +++  +++    +   E     +  +  AI  I+ ++ S  +
Sbjct: 601 TLKGHKFNKDTIWQ---KQFEEEFPYDETPDQLTAIQEIKSDMESGKA 645


>gi|326386142|ref|ZP_08207766.1| CarD family transcriptional regulator [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326209367|gb|EGD60160.1| CarD family transcriptional regulator [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 151

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 82/150 (54%), Positives = 111/150 (74%)

Query: 31  TEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKAR 90
            E++ +E+AGMKLE +V+ F+K++M L+VPV K   IGMRKLS    +  AL  ++GK +
Sbjct: 2   VELQNEEIAGMKLELYVLRFEKERMTLRVPVNKVEAIGMRKLSSDKTLREALDTLKGKPK 61

Query: 91  VKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREI 150
           VKRTMWSRRAQEY+AKINSGDL+AIAEV RDL R D QPE+SYSERQ++E+A +R+ RE+
Sbjct: 62  VKRTMWSRRAQEYEAKINSGDLVAIAEVTRDLFRADDQPEQSYSERQIFEAASSRLAREL 121

Query: 151 AAVNSISEPEAINLIEVNLSSKSSKTEKST 180
           AA+    EP A+  I V L+  + K  ++ 
Sbjct: 122 AAMEKTDEPAALKKILVILNEHAPKYYETV 151


>gi|300703955|ref|YP_003745557.1| transcription-repair ATP-dependent coupling factor, helicase
           [Ralstonia solanacearum CFBP2957]
 gi|299071618|emb|CBJ42942.1| transcription-repair ATP-dependent coupling factor, helicase
           [Ralstonia solanacearum CFBP2957]
          Length = 1147

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 49/181 (27%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           ++K++               + G+ +V+  HG+G    +   ++   + EF  +      
Sbjct: 463 RRKQEQATAVDAMVRDLAELKIGDPVVHSEHGIGRYQGLVSIDMGNGEEEFLHLD-YDKG 521

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     ++       L  +                    K        
Sbjct: 522 SKLYVPVHQLHVISRYSGADPDTAP--LHQLGSGQ--------------WEKAKRRAAQQ 565

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLY-ESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++             +             +  +  AI  +  +++S  
Sbjct: 566 IRDTAAELLNLYARRALRQGFAFPLTPNDYEAFAESFGFDETPDQAAAITAVIADMTSGK 625

Query: 174 S 174
            
Sbjct: 626 P 626


>gi|207743032|ref|YP_002259424.1| transcription-repair coupling factor protein [Ralstonia
           solanacearum IPO1609]
 gi|206594429|emb|CAQ61356.1| transcription-repair coupling factor protein [Ralstonia
           solanacearum IPO1609]
          Length = 1147

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 49/181 (27%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           ++K++               + G+ +V+  HG+G    +   ++   + EF  +      
Sbjct: 463 RRKQEQATAVDAMVRDLAELKIGDPVVHSEHGIGRYQGLVSIDMGNGEEEFLHLD-YDKG 521

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     ++       L  +                    K        
Sbjct: 522 SKLYVPVHQLHVISRYSGADPDTAP--LHQLGSGQ--------------WEKAKRRAAQQ 565

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLY-ESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++             +             +  +  AI  +  +++S  
Sbjct: 566 IRDTAAELLNLYARRALRQGFAFPLTPNDYEAFAESFGFDETPDQAAAITAVIADMTSGK 625

Query: 174 S 174
            
Sbjct: 626 P 626


>gi|207724177|ref|YP_002254575.1| transcription-repair coupling factor protein [Ralstonia
           solanacearum MolK2]
 gi|206589387|emb|CAQ36349.1| transcription-repair coupling factor protein [Ralstonia
           solanacearum MolK2]
          Length = 1147

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 49/181 (27%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           ++K++               + G+ +V+  HG+G    +   ++   + EF  +      
Sbjct: 463 RRKQEQATAVDAMVRDLAELKIGDPVVHSEHGIGRYQGLVSIDMGNGEEEFLHLD-YDKG 521

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     ++       L  +                    K        
Sbjct: 522 SKLYVPVHQLHVISRYSGADPDTAP--LHQLGSGQ--------------WEKAKRRAAQQ 565

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLY-ESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++             +             +  +  AI  +  +++S  
Sbjct: 566 IRDTAAELLNLYARRALRQGFAFPLTPNDYEAFAESFGFDETPDQAAAITAVIADMTSGK 625

Query: 174 S 174
            
Sbjct: 626 P 626


>gi|83745897|ref|ZP_00942954.1| Transcription-repair coupling factor [Ralstonia solanacearum UW551]
 gi|83727587|gb|EAP74708.1| Transcription-repair coupling factor [Ralstonia solanacearum UW551]
          Length = 1206

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 49/181 (27%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           ++K++               + G+ +V+  HG+G    +   ++   + EF  +      
Sbjct: 522 RRKQEQATAVDAMVRDLAELKIGDPVVHSEHGIGRYQGLVSIDMGNGEEEFLHLD-YDKG 580

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     ++       L  +                    K        
Sbjct: 581 SKLYVPVHQLHVISRYSGADPDTAP--LHQLGSGQ--------------WEKAKRRAAQQ 624

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLY-ESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++             +             +  +  AI  +  +++S  
Sbjct: 625 IRDTAAELLNLYARRALRQGFAFPLTPNDYEAFAESFGFDETPDQAAAITAVIADMTSGK 684

Query: 174 S 174
            
Sbjct: 685 P 685


>gi|219850580|ref|YP_002465013.1| transcription-repair coupling factor [Chloroflexus aggregans DSM
           9485]
 gi|219544839|gb|ACL26577.1| transcription-repair coupling factor [Chloroflexus aggregans DSM
           9485]
          Length = 1182

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 16/180 (8%), Positives = 64/180 (35%), Gaps = 22/180 (12%)

Query: 1   MTFQQKRDAMR------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           ++ ++++  +       +  + G+++V+  HG+     +  + V  ++ E+ V+ +  + 
Sbjct: 471 LSERRRKTTVADRTAFLRSLKPGDYVVHIEHGIAVFDGMIRRTVGEVEREYLVLRYAGED 530

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             + VPV +   +     +                     + ++  +    K+ +     
Sbjct: 531 -KIYVPVDQIDRVTRYIGAG------------DGPPTLTRLGTQDWERTKRKVRAAVQEL 577

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
             E++    +   +P  ++S    ++     +      + +  +  AI  ++ ++     
Sbjct: 578 AEELLHLYAQRQLKPGFAFSPDNEWQR---ELEASFPYLETDDQLRAIAEVKADMERPIP 634


>gi|116333178|ref|YP_794705.1| transcription-repair coupling factor [Lactobacillus brevis ATCC
           367]
 gi|116098525|gb|ABJ63674.1| Transcription-repair coupling factor (superfamily II helicase)
           [Lactobacillus brevis ATCC 367]
          Length = 1180

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 23/164 (14%), Positives = 54/164 (32%), Gaps = 18/164 (10%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    ++   V G+  ++  I   +D   L +PV +   I    
Sbjct: 494 TDLKPGDYVVHVNHGIGKFIGMQTLTVDGVHQDYMTID-YQDNAQLFIPVTQLNLIQKYV 552

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE    +  +  + G                 AK  S     I ++  +L    ++   
Sbjct: 553 SSEDKKPK--INKLGGSE--------------WAKTKSKVAAKIEDIADELVDLYAKRSA 596

Query: 132 SYSERQLYESALNR-MVREIAAVNSISEPEAINLIEVNLSSKSS 174
                   + +L      +     +  +   I  ++ ++     
Sbjct: 597 EKGYAFPVDDSLQHDFENDFPYAETPDQLRTIEEVKHDMEKPRP 640


>gi|268318833|ref|YP_003292489.1| Transcription-repair-coupling factor [Lactobacillus johnsonii
           FI9785]
 gi|262397208|emb|CAX66222.1| Transcription-repair-coupling factor [Lactobacillus johnsonii
           FI9785]
          Length = 1165

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    IK  +V G K + ++    +    L VP  +   +     
Sbjct: 490 ELKPGDYVVHVNHGIGRFEGIKTLDVDGKKRD-YITITYQHHDQLFVPADQLGLVQKYVA 548

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE            G+      + S    +   ++ S       +++    + +S+   +
Sbjct: 549 SE------------GRVPHINKLGSSEWTKTKKRVQSKVEDIADDLIELYAKRESEKGFA 596

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     +              +  +  +I  I+ ++ S   
Sbjct: 597 FSPDDDLQ---KEFEDAFPYPETPDQLRSIREIKADMESTKP 635


>gi|28209962|ref|NP_780906.1| transcription-repair coupling factor [Clostridium tetani E88]
 gi|28202397|gb|AAO34843.1| transcription-repair coupling factor [Clostridium tetani E88]
          Length = 1030

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 63/180 (35%), Gaps = 25/180 (13%)

Query: 3   FQQKRDAMRQGF---------RTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKD 53
            + K+   ++GF         + G++IV+  HG+G    IK+ EV G + ++  + +   
Sbjct: 489 RKNKKLTNKKGFSRIKSFTDLKPGDYIVHVNHGIGVYKGIKQLEVGGHRKDYLELTYYG- 547

Query: 54  KMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLI 113
              L VPV +   +      E            GK      + +    +   K       
Sbjct: 548 DDKLYVPVEQLDIVQKYIGGE------------GKTPKINKLGNAEWTKTKNKAKKSIEE 595

Query: 114 AIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
              ++V       +     +S+  +++    +   E     +  +  AI  I+ ++ S  
Sbjct: 596 IAEDLVNLYAVRSTLKGYKFSKDTVWQR---QFEEEFPHEETPDQITAIEEIKNDMQSNR 652


>gi|298244980|ref|ZP_06968786.1| transcription-repair coupling factor [Ktedonobacter racemifer DSM
           44963]
 gi|297552461|gb|EFH86326.1| transcription-repair coupling factor [Ktedonobacter racemifer DSM
           44963]
          Length = 1169

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 62/180 (34%), Gaps = 24/180 (13%)

Query: 2   TFQQKRDAMRQGF----RTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCL 57
           + Q+++      F      G+++V+  HG+G    + +  +AG++ E+ +I +      L
Sbjct: 487 SQQRRKPVTPASFLAEVNPGDYVVHQEHGIGRFEGLTKMNLAGVEREYLLIHYAGTD-KL 545

Query: 58  KVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAE 117
            +P  +   +   +         AL  +                    +  S    ++ +
Sbjct: 546 YIPTDQLDRV--TRFIGMGDSVPALSKLGTTE--------------WTRAKSRVKESVQD 589

Query: 118 VVRDLHRTDSQPEKSYSERQLYESAL---NRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           V R+L +  S  E +       +S       +        +  +  AI  ++ ++    +
Sbjct: 590 VARELLKLYSAREAAPGYAFSPDSEQPWLQELEDAFPYEETPDQARAIEEVKADMERPKA 649


>gi|329915573|ref|ZP_08276288.1| Transcription-repair coupling factor [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327544874|gb|EGF30242.1| Transcription-repair coupling factor [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 1120

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 23/180 (12%), Positives = 54/180 (30%), Gaps = 27/180 (15%)

Query: 5   QKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKM 55
           +K++A              + G+ +V+  HG+G    +   ++   + EF  + + K + 
Sbjct: 436 KKQEAATQVESMVRDLSELKIGDPVVHSNHGIGRYMGLVSMDLGEGETEFLYLDYAK-EA 494

Query: 56  CLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAI 115
            L VPV +   I     +     +  L  +                    K        I
Sbjct: 495 KLYVPVSQLHVISRYSGASPE--DAPLHSLGSGQ--------------WEKAKRRAAQQI 538

Query: 116 AEVVRDLHRTDSQPEKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            +   +L    ++          +                ++ +  AIN +  +++S   
Sbjct: 539 RDTAAELLNLYARRALRKGHAFEFSAHDYANFADSFGFEETVDQAAAINAVIGDMTSGKP 598


>gi|116626979|ref|YP_819598.1| transcription-repair coupling factor [Streptococcus thermophilus
           LMD-9]
 gi|116100256|gb|ABJ65402.1| Transcription-repair coupling factor (superfamily II helicase)
           [Streptococcus thermophilus LMD-9]
 gi|312277424|gb|ADQ62081.1| Transcription-repair coupling factor (Superfamily II helicase)
           [Streptococcus thermophilus ND03]
          Length = 1168

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 55/162 (33%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
               G+++V+  HG+G    I+  E+ G+  ++      +D   + +P+ +   +     
Sbjct: 489 ELEKGDYVVHQTHGIGQFKGIETIEIKGVHRDYL-TIQYQDAATISLPIEQIESLSKYVS 547

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                         GK      +   R Q+   K++         +++           +
Sbjct: 548 V------------DGKEPKINKLNDGRFQKTKQKVSKQVEDIADNLLKLYAERSQLKGFA 595

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     +        E + V ++ +  +I  I+ ++ S   
Sbjct: 596 FSPD---DDNQRDFEDEFSYVETVDQLRSIKEIKADMESDKP 634


>gi|238783787|ref|ZP_04627806.1| Transcription-repair-coupling factor [Yersinia bercovieri ATCC
           43970]
 gi|238715338|gb|EEQ07331.1| Transcription-repair-coupling factor [Yersinia bercovieri ATCC
           43970]
          Length = 725

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/184 (14%), Positives = 58/184 (31%), Gaps = 29/184 (15%)

Query: 3   FQQKRDAMRQ-----------GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFD 51
            ++++D  R              R G+ +V+  HGVG    +   E  G+K E+ ++ + 
Sbjct: 455 SRRRQDNRRTINTDTLIRNLAELRPGQPVVHLEHGVGRYLGLTTLEAGGIKAEYLILTYA 514

Query: 52  KDKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGD 111
            +   L VPV     I              L  + G+A                +     
Sbjct: 515 GED-KLYVPVSSLHLISRYSGGADE--NAPLHKLGGEA--------------WGRARQKA 557

Query: 112 LIAIAEVVRDLHRTDSQPEKSYSERQLYESA-LNRMVREIAAVNSISEPEAINLIEVNLS 170
              + +V  +L    +Q       +   +        +      +  + +AIN +  ++ 
Sbjct: 558 AEKVRDVAAELLDIYAQRAAKSGFKFKLDREQYQLFCQSFPFETTPDQEQAINAVLSDMC 617

Query: 171 SKSS 174
              +
Sbjct: 618 QPLA 621


>gi|299820651|ref|ZP_07052540.1| transcription-repair coupling factor [Listeria grayi DSM 20601]
 gi|299817672|gb|EFI84907.1| transcription-repair coupling factor [Listeria grayi DSM 20601]
          Length = 1186

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 18/163 (11%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+     ++   + G+  ++      + +  L VPV +   I    
Sbjct: 506 SELKVGDYVVHINHGIARYVGMETLNIGGVHKDYL-NLIYQGEDKLFVPVDQLEMIQKYV 564

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE            GKA     +     +   +K+ +       ++++     +++   
Sbjct: 565 GSE------------GKAPRLHKLGGTEWKRVKSKVKASVQDIADDLIKLYAEREAEKGY 612

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +++     +              +  +  +I  I+ ++     
Sbjct: 613 AFTPDSEMQR---EFEDAFPYQETDDQIRSIKEIKKDMERPRP 652


>gi|260664822|ref|ZP_05865673.1| transcription-repair coupling factor [Lactobacillus jensenii
           SJ-7A-US]
 gi|260561305|gb|EEX27278.1| transcription-repair coupling factor [Lactobacillus jensenii
           SJ-7A-US]
          Length = 1161

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 58/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    IK  +V G K + ++    +    L VP  +   +     
Sbjct: 488 DLKPGDYVVHVNHGIGRFEGIKTLDVDGQKRD-YITITYQGHDQLFVPADQLSLVQKYVG 546

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE H  +               +   +  +    + S       ++++     +S+   +
Sbjct: 547 SEGHRPK------------VNKLGGSQWAKTKRSVQSKVEDIADDLIKLYAARESEKGFA 594

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S+    + A          V +  +  + N I+ ++    +
Sbjct: 595 FSKDNDLQKA---FEDAFPYVETPDQLRSSNEIKADMEKPKA 633


>gi|238855038|ref|ZP_04645366.1| transcription-repair coupling factor [Lactobacillus jensenii 269-3]
 gi|282934824|ref|ZP_06340058.1| transcription-repair coupling factor [Lactobacillus jensenii 208-1]
 gi|238832282|gb|EEQ24591.1| transcription-repair coupling factor [Lactobacillus jensenii 269-3]
 gi|281301096|gb|EFA93406.1| transcription-repair coupling factor [Lactobacillus jensenii 208-1]
          Length = 1161

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 58/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    IK  +V G K + ++    +    L VP  +   +     
Sbjct: 488 DLKPGDYVVHVNHGIGRFEGIKTLDVDGQKRD-YITITYQGHDQLFVPADQLSLVQKYVG 546

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE H  +               +   +  +    + S       ++++     +S+   +
Sbjct: 547 SEGHRPK------------VNKLGGSQWAKTKRSVQSKVEDIADDLIKLYAARESEKGFA 594

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S+    + A          V +  +  + N I+ ++    +
Sbjct: 595 FSKDNDLQKA---FEDAFPYVETPDQLRSSNEIKADMEKPKA 633


>gi|332981377|ref|YP_004462818.1| transcription-repair coupling factor [Mahella australiensis 50-1
           BON]
 gi|332699055|gb|AEE95996.1| transcription-repair coupling factor [Mahella australiensis 50-1
           BON]
          Length = 1159

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 22/172 (12%), Positives = 57/172 (33%), Gaps = 16/172 (9%)

Query: 3   FQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
              +R         G+++V+  +G+G    IK+  V G   ++  I +      L VP  
Sbjct: 478 KAGQRVTAFSDLNIGDYVVHENYGIGQYMGIKKLTVEGKSRDYLFIRYADGD-NLYVPTD 536

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
           +   +                   G +     +      +  AK+         E+++  
Sbjct: 537 RMSLVQRYIGG------------DGASPRLSKLGGSEWSKTKAKVRESVRKMAGELLKLY 584

Query: 123 HRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
               +    ++S   ++++   ++        +  + +AI  I+ ++ S   
Sbjct: 585 ASRYTTKGHAFSPDTVWQA---QLEESFPYQETPDQLQAIEEIKADMESDKP 633


>gi|312138702|ref|YP_004006038.1| transcription repair coupling factor mfd [Rhodococcus equi 103S]
 gi|311888041|emb|CBH47353.1| transcription repair coupling factor Mfd [Rhodococcus equi 103S]
          Length = 1228

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 58/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++          G+ +V+  HG+G   E+ E+ + G + E+ V         ++  
Sbjct: 517 MPAKRRNQVDPLALTAGDMVVHDQHGIGRFVEMVERTIGGARREYLV---------IEYA 567

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+      +     Q    K          E+V+
Sbjct: 568 ASKRGHPGDRLFVPMESLDQLSRYVGGEMPALSKLGGSDWQNTKRKARKAVREIAGELVQ 627

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++  +       A   +  +   I+ ++ ++     
Sbjct: 628 LYAARQAAPGHAFGPDTPWQKEME---DAFAFTETHDQLTVIDEVKADMEKPVP 678


>gi|325676609|ref|ZP_08156287.1| transcription-repair coupling factor [Rhodococcus equi ATCC 33707]
 gi|325552787|gb|EGD22471.1| transcription-repair coupling factor [Rhodococcus equi ATCC 33707]
          Length = 1225

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 58/174 (33%), Gaps = 12/174 (6%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++          G+ +V+  HG+G   E+ E+ + G + E+ V         ++  
Sbjct: 514 MPAKRRNQVDPLALTAGDMVVHDQHGIGRFVEMVERTIGGARREYLV---------IEYA 564

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G+      +     Q    K          E+V+
Sbjct: 565 ASKRGHPGDRLFVPMESLDQLSRYVGGEMPALSKLGGSDWQNTKRKARKAVREIAGELVQ 624

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + P  ++     ++  +       A   +  +   I+ ++ ++     
Sbjct: 625 LYAARQAAPGHAFGPDTPWQKEME---DAFAFTETHDQLTVIDEVKADMEKPVP 675


>gi|209520701|ref|ZP_03269451.1| transcription-repair coupling factor [Burkholderia sp. H160]
 gi|209498863|gb|EDZ98968.1| transcription-repair coupling factor [Burkholderia sp. H160]
          Length = 1159

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 52/181 (28%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           +++++               + G+ +V+  HG+G    +   ++   + EF  + +    
Sbjct: 463 RRRQEQASNVDSMVRDLSELKVGDPVVHSQHGIGRYMGLVTMDLGEGETEFLHLEYAG-D 521

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV + + I     ++       L  +                    K        
Sbjct: 522 SKLYVPVAQLLVISRYSGADPESAP--LHSLGSGQ--------------WEKAKRKAAQQ 565

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++           E     +         +  +  AI  +  +++S  
Sbjct: 566 IRDTAAELLNLYARRAAREGHAFALEPKDYVKFAESFGFEETPDQAAAIAAVIGDMTSGK 625

Query: 174 S 174
            
Sbjct: 626 P 626


>gi|242371667|ref|ZP_04817241.1| transcription-repair coupling factor [Staphylococcus epidermidis
           M23864:W1]
 gi|242350616|gb|EES42217.1| transcription-repair coupling factor [Staphylococcus epidermidis
           M23864:W1]
          Length = 1169

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/168 (16%), Positives = 56/168 (33%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +    Q    G++IV+  HGVG    ++  EV     ++  +   K    L VPV +   
Sbjct: 489 KIKSYQDLNVGDYIVHVHHGVGRYLGVETLEVGDTHRDYIKL-QYKGTDQLFVPVDQMDQ 547

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     SE             K+     +     ++  AK+         E++      +
Sbjct: 548 VQKYVASE------------DKSPRLNKLGGTEWKKTKAKVQQSVEDIADELIDLYKERE 595

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 Y E    +SA      +     +  + ++I  I+ ++  +  
Sbjct: 596 MSVGYKYGEDTAEQSA---FEHDFPYELTPDQDKSIEEIKSDMERERP 640


>gi|116669806|ref|YP_830739.1| transcription-repair coupling factor [Arthrobacter sp. FB24]
 gi|116609915|gb|ABK02639.1| transcription-repair coupling factor [Arthrobacter sp. FB24]
          Length = 1222

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 59/174 (33%), Gaps = 9/174 (5%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++          G+H+V+  HG+G   E+ +++VAG           ++ + L+  
Sbjct: 528 MPSKRRNAVDPLQLVAGDHVVHEQHGIGRFVELIQRKVAGG------GEGVREYLVLEYA 581

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G       M         +K          E++R
Sbjct: 582 PSKRGAPGDRLFVPTDQLDQVTRYVGGDTPALSKMGGSDWASTKSKARKAVKEIAGELIR 641

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    ++     ++     +      V +  +   IN ++ ++  +  
Sbjct: 642 LYSARMASKGFAFGPDTPWQR---ELEEAFPYVETPDQLTTINEVKADMEREIP 692


>gi|167772369|ref|ZP_02444422.1| hypothetical protein ANACOL_03746 [Anaerotruncus colihominis DSM
           17241]
 gi|167665472|gb|EDS09602.1| hypothetical protein ANACOL_03746 [Anaerotruncus colihominis DSM
           17241]
          Length = 1157

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 57/174 (32%), Gaps = 17/174 (9%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
             + K+         G+++V+ AHG+G    I ++++ G+  ++  I +      L VPV
Sbjct: 479 PKEGKKLRDISDLTPGDYVVHTAHGIGVFEGIVKRDIQGVVKDYIKIRYAGTD-TLFVPV 537

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            +   +            R                S+       K       A+ ++ ++
Sbjct: 538 TQLDLVSKYIGMRDDANVRL---------------SKLNSIEWQKTRQRVKKAVEDMAKE 582

Query: 122 LHRTDSQPEKSYSERQLYESALNR-MVREIAAVNSISEPEAINLIEVNLSSKSS 174
           L    ++           ++       R  A   +  +   I+ I+ ++ S   
Sbjct: 583 LTELYAKRMAVKGYAFSPDTDWQNDFERRFAYDETDDQLRCIDEIKADMESSVP 636


>gi|254974810|ref|ZP_05271282.1| putative regulatory protein [Clostridium difficile QCD-66c26]
 gi|255092198|ref|ZP_05321676.1| putative regulatory protein [Clostridium difficile CIP 107932]
 gi|255313937|ref|ZP_05355520.1| putative regulatory protein [Clostridium difficile QCD-76w55]
 gi|255516617|ref|ZP_05384293.1| putative regulatory protein [Clostridium difficile QCD-97b34]
 gi|255649717|ref|ZP_05396619.1| putative regulatory protein [Clostridium difficile QCD-37x79]
 gi|260682872|ref|YP_003214157.1| putative regulatory protein [Clostridium difficile CD196]
 gi|260686470|ref|YP_003217603.1| putative regulatory protein [Clostridium difficile R20291]
 gi|306519829|ref|ZP_07406176.1| putative regulatory protein [Clostridium difficile QCD-32g58]
 gi|260209035|emb|CBA62142.1| putative regulatory protein [Clostridium difficile CD196]
 gi|260212486|emb|CBE03403.1| putative regulatory protein [Clostridium difficile R20291]
          Length = 165

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 74/163 (45%), Gaps = 1/163 (0%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFF-VIAFDKDKMCLKVPVGKAIDIGMRK 71
            ++ GE ++YP  G   I+ +  +++     +++ +       + + +PV  A  IG+R 
Sbjct: 1   MYKIGESVMYPKEGACYISGLVTKDINHHIQKYYELTVIYNSNLKISIPVLNADKIGVRP 60

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
           + + + VE  ++ +     +      +R + Y  K +SGD+  I ++++ L   D+  + 
Sbjct: 61  IMDENEVENFIQSLDKVDCLWVFDRKKRLKLYHDKFHSGDVFEIVKLIKMLMIQDNSKQL 120

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
             +++     A    + E+AA    S    +  ++ ++ +  +
Sbjct: 121 CSTDKDFLNKAQRFALSELAAAQCKSYTIVLEEMKNHILNSKN 163


>gi|295397825|ref|ZP_06807889.1| transcription-repair coupling factor [Aerococcus viridans ATCC
           11563]
 gi|294973922|gb|EFG49685.1| transcription-repair coupling factor [Aerococcus viridans ATCC
           11563]
          Length = 1233

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 64/186 (34%), Gaps = 30/186 (16%)

Query: 2   TFQQKRDAMR------------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIA 49
           T +++R A +            Q    G+++V+  HG+G  T I+  E AG   ++  I 
Sbjct: 476 TQKKRRKAKKPLISNAERIKNYQQLEVGDYVVHVNHGIGRYTGIETIEFAGTHQDYLTIV 535

Query: 50  FDKDKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINS 109
           F      + VP+ +   +     +E            G+      M      +   K++S
Sbjct: 536 FADQAA-IHVPIDQIDLVQKYVSAE------------GREPKLNKMGGSEWAKTKQKVSS 582

Query: 110 GDLIAIAEVVRDLHRTDSQPEKSYSERQLYESALN-RMVREIAAVNSISEPEAINLIEVN 168
                  E++      ++Q   ++      ++A             +  +  +I  I+ +
Sbjct: 583 KIEDIADELIDLYASREAQKGFAFG----PDTAEQAEFENAFPYTETDDQVRSIAEIKKD 638

Query: 169 LSSKSS 174
           +  +  
Sbjct: 639 MEVEKP 644


>gi|256848382|ref|ZP_05553825.1| transcription-repair coupling factor [Lactobacillus coleohominis
           101-4-CHN]
 gi|256714980|gb|EEU29958.1| transcription-repair coupling factor [Lactobacillus coleohominis
           101-4-CHN]
          Length = 1179

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 22/163 (13%), Positives = 55/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    IK   V G+  ++ VI   +D   + VPV +   +    
Sbjct: 495 TDLKPGDYVVHVNHGIGIFAGIKTMTVDGVHQDYIVID-YRDHAQIFVPVTQLNLVQKYV 553

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE+                   +      +   ++         ++V    +  +    
Sbjct: 554 SSESTK------------PHINKLGGNEWAKTKRRVAQKVENIAGDLVDLYAQRKTAKGF 601

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +Y +    +    +   E     +  +  +IN ++ ++     
Sbjct: 602 AYPKDDYLQ---EKFDHEFPYSETKDQLRSINEVKADMEKPKP 641


>gi|227509305|ref|ZP_03939354.1| transcription-repair coupling factor [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227191235|gb|EEI71302.1| transcription-repair coupling factor [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 1168

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 54/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    +K  EV G   ++      +D   L +PV +   I    
Sbjct: 485 TDLKPGDYVVHVNHGIGRYEGMKTMEVDGKHQDYL-TISYRDSAKLFIPVTQLNMIQKYV 543

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE             K      +     Q+   K+ S       +++    + D++   
Sbjct: 544 SSE------------DKKPRINKLGGSEWQKTKRKVASKIEDIADDLIELYAKRDAEKGY 591

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +Y      +   N          +  +  + + I+ ++     
Sbjct: 592 AYPPDDSLQ---NEFEARFPYTETPDQLRSADEIKHDMEHNKP 631


>gi|228476216|ref|ZP_04060919.1| transcription-repair coupling factor [Staphylococcus hominis SK119]
 gi|228269701|gb|EEK11200.1| transcription-repair coupling factor [Staphylococcus hominis SK119]
          Length = 1169

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 56/168 (33%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +    Q    G+++V+  HGVG    ++  EV  +  ++  +   K    L VPV +   
Sbjct: 489 KIKSYQDLNVGDYVVHVHHGVGRYLGVETLEVGDVHRDYIKL-QYKGTDQLFVPVDQMDQ 547

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     SE             K+     +     ++  AK+         E++      +
Sbjct: 548 VQKYVASE------------DKSPKLNKLGGSEWKKTKAKVQQSVEDIADELIALYKERE 595

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 Y E     +  +    +     +  + ++I  I+ ++  +  
Sbjct: 596 MSVGYQYGEDT---AEQHDFEMDFPYELTPDQAKSIEEIKEDMEKERP 640


>gi|227512317|ref|ZP_03942366.1| transcription-repair coupling factor [Lactobacillus buchneri ATCC
           11577]
 gi|227084492|gb|EEI19804.1| transcription-repair coupling factor [Lactobacillus buchneri ATCC
           11577]
          Length = 1168

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 54/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    +K  EV G   ++      +D   L +PV +   I    
Sbjct: 485 TDLKPGDYVVHVNHGIGRYEGMKTMEVDGKHQDYL-TISYRDSAKLFIPVTQLNMIQKYV 543

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE             K      +     Q+   K+ S       +++    + D++   
Sbjct: 544 SSE------------DKKPRINKLGGSEWQKTKRKVASKIEDIADDLIELYAKRDAEKGY 591

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +Y      +   N          +  +  + + I+ ++     
Sbjct: 592 AYPPDDSLQ---NEFEARFPYTETPDQLRSADEIKHDMEHNKP 631


>gi|193212321|ref|YP_001998274.1| transcription-repair coupling factor [Chlorobaculum parvum NCIB
           8327]
 gi|193085798|gb|ACF11074.1| transcription-repair coupling factor [Chlorobaculum parvum NCIB
           8327]
          Length = 1097

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 24/178 (13%), Positives = 65/178 (36%), Gaps = 21/178 (11%)

Query: 2   TFQQKRD-----AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMC 56
             ++++         Q  + G+++V+  +GVG    ++  +V   + E  V+   +    
Sbjct: 385 PHRKRKVRGISLKELQRLKVGDYVVHEDYGVGVFRSLETIQVGDSEQEC-VLVEYEGGDQ 443

Query: 57  LKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIA 116
           L V V     +     SE          +   +++  + WS + ++   K+        A
Sbjct: 444 LYVNVQNINLLSKYTASEGS--------LPNLSKLGSSKWSAKKEKVRKKLR----DIAA 491

Query: 117 EVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +++R        P  ++    +++              +  + +AI  ++ ++ S S 
Sbjct: 492 KLIRIYAERKMTPGFAFGPDSIFQR---EFEASFMFEETPDQLKAIQEVKKDMQSPSP 546


>gi|296157812|ref|ZP_06840646.1| transcription-repair coupling factor [Burkholderia sp. Ch1-1]
 gi|295892058|gb|EFG71842.1| transcription-repair coupling factor [Burkholderia sp. Ch1-1]
          Length = 1160

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 51/181 (28%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           +++++               + G+ +V+  HG+G    +   ++   + EF  + +    
Sbjct: 463 RRRQEQASNVDSMVRDLSELKLGDPVVHSQHGIGRYMGLVTMDLGEGETEFLHLEYAG-D 521

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     ++       L  +                    K        
Sbjct: 522 SKLYVPVAQLHVISRYSGADPESAP--LHSLGSGQ--------------WEKAKRKAAQQ 565

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++           E     +         +  +  AI  +  +++S  
Sbjct: 566 IRDTAAELLNLYARRAARSGHAFALEPKDYVKFAESFGFEETPDQAAAIAAVIGDMTSGK 625

Query: 174 S 174
            
Sbjct: 626 P 626


>gi|91783503|ref|YP_558709.1| transcription-repair coupling factor [Burkholderia xenovorans
           LB400]
 gi|91687457|gb|ABE30657.1| transcription-repair coupling factor [Burkholderia xenovorans
           LB400]
          Length = 1160

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 51/181 (28%), Gaps = 27/181 (14%)

Query: 4   QQKRDA---------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           +++++               + G+ +V+  HG+G    +   ++   + EF  + +    
Sbjct: 463 RRRQEQASNVDSMVRDLSELKLGDPVVHSQHGIGRYMGLVTMDLGEGETEFLHLEYAG-D 521

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I     ++       L  +                    K        
Sbjct: 522 SKLYVPVAQLHVISRYSGADPESAP--LHSLGSGQ--------------WEKAKRKAAQQ 565

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           I +   +L    ++           E     +         +  +  AI  +  +++S  
Sbjct: 566 IRDTAAELLNLYARRAARSGHAFALEPKDYVKFAESFGFEETPDQAAAIAAVIGDMTSGK 625

Query: 174 S 174
            
Sbjct: 626 P 626


>gi|314937290|ref|ZP_07844632.1| transcription-repair coupling factor [Staphylococcus hominis subsp.
           hominis C80]
 gi|313654586|gb|EFS18336.1| transcription-repair coupling factor [Staphylococcus hominis subsp.
           hominis C80]
          Length = 1169

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 56/168 (33%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +    Q    G+++V+  HGVG    ++  EV  +  ++  +   K    L VPV +   
Sbjct: 489 KIKSYQDLNVGDYVVHVHHGVGRYLGVETLEVGDVHRDYIKL-QYKGTDQLFVPVDQMDQ 547

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     SE             K+     +     ++  AK+         E++      +
Sbjct: 548 VQKYVASE------------DKSPKLNKLGGSEWKKTKAKVQQSVEDIADELIALYKERE 595

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 Y E     +  +    +     +  + ++I  I+ ++  +  
Sbjct: 596 MSVGYQYGEDT---AEQHDFEMDFPYELTPDQAKSIEEIKEDMEKERP 640


>gi|315644370|ref|ZP_07897510.1| transcription-repair coupling factor [Paenibacillus vortex V453]
 gi|315280247|gb|EFU43539.1| transcription-repair coupling factor [Paenibacillus vortex V453]
          Length = 1175

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 50/163 (30%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I   E+ G+  ++  I +      L VP+ +   I    
Sbjct: 487 TELKVGDYVVHQNHGIGKYMGIGTLEINGIHKDYMHILYAGGD-KLSVPIEQIDLIQKYV 545

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE             K      +          K+ S       ++++      S P  
Sbjct: 546 GSE------------DKEPKVYKLGGNEWTRVKNKVRSSVQDIADDLIKLYAERQSAPGY 593

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            + +     S             +  +  AI  I+ ++     
Sbjct: 594 GFEKDT---SEQQEFEDMFPYDETPDQLRAITEIKKDMEQNRP 633


>gi|253996787|ref|YP_003048851.1| transcription-repair coupling factor [Methylotenera mobilis JLW8]
 gi|253983466|gb|ACT48324.1| transcription-repair coupling factor [Methylotenera mobilis JLW8]
          Length = 1145

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 23/166 (13%), Positives = 44/166 (26%), Gaps = 18/166 (10%)

Query: 10  MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGM 69
                R  + +V+  HGVG    +   ++   + EF ++ +      L VPV +   I  
Sbjct: 476 DLSELRINDPVVHEQHGVGRYKGLINLDLGEGETEFLLLEYYG-DDKLYVPVSQLFLISR 534

Query: 70  RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQP 129
                       L  +   +                K     L  I +   +L    +Q 
Sbjct: 535 YSGGPPESAP--LHRLGSGS--------------WEKAKKKALKQIRDTAAELLNLYAQR 578

Query: 130 EKSYSERQLYE-SALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                                     +  + EAI  +  ++ S   
Sbjct: 579 AARRGHAFTLSLQDYEAFCEGFPFEETADQLEAIENVIKDMQSGRP 624


>gi|73663562|ref|YP_302343.1| transcription-repair coupling factor [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|123761497|sp|Q49V12|MFD_STAS1 RecName: Full=Transcription-repair-coupling factor; Short=TRCF;
           AltName: Full=ATP-dependent helicase mfd
 gi|72496077|dbj|BAE19398.1| transcription-repair coupling factor [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 1170

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/173 (15%), Positives = 61/173 (35%), Gaps = 18/173 (10%)

Query: 3   FQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVG 62
              ++    Q  + G+++V+  HGVG    ++  EV G+  ++  +   K    L VPV 
Sbjct: 486 TNAEKIKSYQDLKVGDYVVHVHHGVGRYLGVETLEVGGVHKDYIKL-QYKGTDQLFVPVD 544

Query: 63  KAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDL 122
           +   +     SE    +  L  + G                  K  +    ++ ++  +L
Sbjct: 545 QMDQVQKYVASEDKSPK--LNKLGGTE--------------WKKTKAKVQQSVEDMADEL 588

Query: 123 HRTDSQPEKSYSERQLYESALNR-MVREIAAVNSISEPEAINLIEVNLSSKSS 174
                  E S   +   ++A       +     +  + ++I  I+ ++  +  
Sbjct: 589 IELYKAREMSVGYKFGPDTAEQNDFEIDFPYELTPDQSKSIEEIKQDMEIERP 641


>gi|227522403|ref|ZP_03952452.1| transcription-repair coupling factor [Lactobacillus hilgardii ATCC
           8290]
 gi|227090461|gb|EEI25773.1| transcription-repair coupling factor [Lactobacillus hilgardii ATCC
           8290]
          Length = 1168

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 54/163 (33%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    +K  EV G   ++      +D   L +PV +   I    
Sbjct: 485 TDLKPGDYVVHVNHGIGRYEGMKTMEVDGKHQDYL-TISYRDSAKLFIPVTQLNMIQKYV 543

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE             K      +     Q+   K+ S       +++    + D++   
Sbjct: 544 SSE------------DKKPRINKLGGSEWQKTKRKVASKIEDIADDLIELYAKRDAEKGY 591

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +Y      +   N          +  +  + + I+ ++     
Sbjct: 592 AYPPDDSLQ---NEFEARFPYTETPDQLRSADEIKHDMEHNKP 631


>gi|224543056|ref|ZP_03683595.1| hypothetical protein CATMIT_02256 [Catenibacterium mitsuokai DSM
           15897]
 gi|224523996|gb|EEF93101.1| hypothetical protein CATMIT_02256 [Catenibacterium mitsuokai DSM
           15897]
          Length = 1150

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 59/180 (32%), Gaps = 24/180 (13%)

Query: 3   FQQK--------RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
            ++K        + +     + G+++V+  +G+G    I+   V G+  ++  I   K  
Sbjct: 459 TKKKYIKYRDATKISDYNELKVGDYVVHDTNGIGQYMGIETLVVDGVHKDYLHI-AYKGN 517

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV +   I                   GK      + S +  +  A++       
Sbjct: 518 DILYVPVEQFQLIRKY------------SSRDGKPPRIHALGSPKWAKEKARVRQKVDGL 565

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
             +++        QP  ++      +        E     +  + +A+  I+ ++ +   
Sbjct: 566 ADDLINLYAERMRQPGFAFEPDGDLQL---EFESEFGYELTPDQAQAVEEIKKDMETPRP 622


>gi|187935467|ref|YP_001885252.1| CarD family transcriptional regulator [Clostridium botulinum B str.
           Eklund 17B]
 gi|187723620|gb|ACD24841.1| transcriptional regulator, CarD family [Clostridium botulinum B
           str. Eklund 17B]
          Length = 160

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 78/160 (48%), Gaps = 2/160 (1%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
            F+ G+ +VYP  G+G +  I+E+   G K ++ +I   K+ + + +P+ +     +R +
Sbjct: 1   MFKVGDKVVYPMQGIGIVQRIEEKLFCGTKRKYCIIQMLKNSLEIMIPIDRIAKSRLRMI 60

Query: 73  SEAHFVERALKLVRGK--ARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPE 130
           ++ + +E  L  ++              R +    KI SG L    +V  +L   +    
Sbjct: 61  NDINTLEDILNHIQDTSDPEELNLPSKERYEINLNKIKSGLLEDSLDVFYNLTLINKMKA 120

Query: 131 KSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLS 170
            + +E+Q+  +A N ++ EI  +  ISE EA  +++ ++S
Sbjct: 121 LNSTEKQILNTAQNFLIDEIRVIKDISENEATKILKSSIS 160


>gi|320530140|ref|ZP_08031210.1| transcription-repair coupling factor [Selenomonas artemidis F0399]
 gi|320137573|gb|EFW29485.1| transcription-repair coupling factor [Selenomonas artemidis F0399]
          Length = 1094

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 52/163 (31%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           +    G+++V+ +HG+G    ++  EVAG+  ++  I        L VP  +   +    
Sbjct: 426 REIAPGDYVVHVSHGIGKYLGVETLEVAGVHRDYLHI-QYGGDDKLFVPTDQVGLLQKYI 484

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            G A     M +       AK           ++    +       
Sbjct: 485 GAE------------GAAPRLHRMGTADWARARAKAQKSVEDIADHLLEIYAKRKLAAGH 532

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +++     +              +  +  AI  I+ ++ S+  
Sbjct: 533 AFTPDDAMQR---EFEEAFPYEETEDQLRAIEEIKRDMESERP 572


>gi|220934531|ref|YP_002513430.1| transcription-repair coupling factor [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995841|gb|ACL72443.1| transcription-repair coupling factor [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 1157

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 25/180 (13%), Positives = 59/180 (32%), Gaps = 24/180 (13%)

Query: 3   FQQKRDA--------MRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
            ++KR                 G  +V+  HGVG    +++  V G + EF  + +    
Sbjct: 466 RRRKRPTRDADAVISNLTDLHPGAPVVHEEHGVGRYLGLQKLAVGGQETEFLALEYAGGD 525

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VPV     +     ++       L  + G+       W++  ++   K        
Sbjct: 526 -KLYVPVSSLHLVSRYTGADTEHAP--LHKLGGE------QWAKIRRKAAEKAR-----D 571

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +A  + +++   +  +    + Q   +             +  +  AI  +  +++S   
Sbjct: 572 VAAELLEIYARRAARQGQSFDVQA--TGYAAFADSFPFEETPDQARAIEAVLEDMASPRP 629


>gi|313894846|ref|ZP_07828406.1| transcription-repair coupling factor [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312976527|gb|EFR41982.1| transcription-repair coupling factor [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 1094

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 53/163 (32%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
           +    G+++V+ +HG+G    ++  EVAG+  ++  I        L VP  +   +    
Sbjct: 426 REIAPGDYVVHVSHGIGKYLGVETLEVAGVHRDYLHI-QYGGDDKLFVPTDQVGLLQKYI 484

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            +E            G A     M +       AK           ++    +       
Sbjct: 485 GAE------------GAAPRLHRMGTADWARARAKAQKSVEDIADHLLEIYAKRKLAAGH 532

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +++     +   +          +  +  AI  I+ ++ S+  
Sbjct: 533 AFTPDDAMQ---HEFEEAFPYEETEDQLRAIEEIKRDMESERP 572


>gi|224282806|ref|ZP_03646128.1| transcription-repair coupling factor [Bifidobacterium bifidum NCIMB
           41171]
 gi|313139965|ref|ZP_07802158.1| transcription-repair coupling factor [Bifidobacterium bifidum NCIMB
           41171]
 gi|313132475|gb|EFR50092.1| transcription-repair coupling factor [Bifidobacterium bifidum NCIMB
           41171]
          Length = 1199

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 19/182 (10%), Positives = 56/182 (30%), Gaps = 26/182 (14%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVA----GMKLEFFVIAFD-----K 52
             ++++       + G+++V+  HG+G   E++++ +         E+ VI +       
Sbjct: 505 PKRRRKAIDLMELKAGDYVVHEQHGIGRFLEMRQRTIGTGANKTTREYLVIEYAPSKRGA 564

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
               L +P  +   I     +EA  + +                        AK      
Sbjct: 565 PADKLFIPTDQLDLISKYIGAEAPKLNKL--------------GGSDWAATKAKARKHVH 610

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
               ++V+           ++S    ++     +        +  +   I+ ++ ++   
Sbjct: 611 EIAEDLVKLYSARQRTKGFAFSPDTPWQ---KELEDAFPYQETTDQLTTIDDVKSDMEKP 667

Query: 173 SS 174
             
Sbjct: 668 VP 669


>gi|312874973|ref|ZP_07734992.1| transcription-repair coupling factor [Lactobacillus iners LEAF
           2053A-b]
 gi|311089718|gb|EFQ48143.1| transcription-repair coupling factor [Lactobacillus iners LEAF
           2053A-b]
          Length = 1110

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 21/168 (12%), Positives = 54/168 (32%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +    Q    G+++V+  HG+G    IK  E  G K + ++    ++   L VP  +   
Sbjct: 431 QIRSYQELNPGDYVVHINHGIGIFEGIKTLESNGQKGD-YITITYRNHDQLFVPADQLGV 489

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     S             GK      +      +   ++         E++       
Sbjct: 490 VQKYVAS------------DGKIPKINKLGGNEWAKTKCRVQEKIEDIADELLAIYAHRA 537

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++   ++      +            + +  + +AI  I++++  +  
Sbjct: 538 TEKGFAFLPDDELQR---DFEASFPYLETPDQIKAIKEIKLDMQKEKP 582


>gi|289551698|ref|YP_003472602.1| Transcription-repair coupling factor [Staphylococcus lugdunensis
           HKU09-01]
 gi|289181229|gb|ADC88474.1| Transcription-repair coupling factor [Staphylococcus lugdunensis
           HKU09-01]
          Length = 1173

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 57/168 (33%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +    Q  + G+++V+  HGVG    ++  EV  +  ++  +   K    L VPV +   
Sbjct: 489 KIKSYQDLKVGDYVVHVHHGVGRYLGVETLEVGDVHRDYIKL-QYKGTDQLFVPVDQMDQ 547

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     SE             K+     +     ++  AK+         E++      +
Sbjct: 548 VQKYVASE------------DKSPKLNKLGGSEWKKTKAKVQQSVEDIAEELIALYKERE 595

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 + E    + A      +     +  + ++I  I+ ++  +  
Sbjct: 596 MSVGYQFGEDTAEQQAFEL---DFPYELTPDQAKSIEEIKADMELQKP 640


>gi|296875514|ref|ZP_06899586.1| transcription-repair coupling factor [Streptococcus parasanguinis
           ATCC 15912]
 gi|296433438|gb|EFH19213.1| transcription-repair coupling factor [Streptococcus parasanguinis
           ATCC 15912]
          Length = 1167

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 60/162 (37%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
               G+++V+  HG+G    I+  E++G+  + +V    ++   + +PV +   +     
Sbjct: 487 ELEKGDYVVHQVHGIGQYLGIETIEISGVHRD-YVSIQYQNGDRISIPVDQIQMLSKYVA 545

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           S             GKA     +   R Q+   K+ +       ++++           +
Sbjct: 546 S------------DGKAPKINKLNDGRFQKTKQKVQTQVEDIADDLIKLYAERSQLEGFA 593

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           YS+    +       ++   + +  +  +I  I+ ++ S   
Sbjct: 594 YSKD---DENQEAFEQDFPYIETDDQLRSIEEIKKDMESNRP 632


>gi|312872569|ref|ZP_07732637.1| transcription-repair coupling factor [Lactobacillus iners LEAF
           2062A-h1]
 gi|311091931|gb|EFQ50307.1| transcription-repair coupling factor [Lactobacillus iners LEAF
           2062A-h1]
          Length = 1110

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 21/168 (12%), Positives = 54/168 (32%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +    Q    G+++V+  HG+G    IK  E  G K + ++    ++   L VP  +   
Sbjct: 431 QIRSYQELNPGDYVVHINHGIGIFEGIKTLESNGQKGD-YITITYRNHDQLFVPADQLGV 489

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     S             GK      +      +   ++         E++       
Sbjct: 490 VQKYVAS------------DGKIPKINKLGGNEWAKTKCRVQEKIEDIADELLAIYAHRA 537

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++   ++      +            + +  + +AI  I++++  +  
Sbjct: 538 TEKGFAFLPDDELQR---DFEASFPYLETPDQIKAIKEIKLDMQKEKP 582


>gi|309803761|ref|ZP_07697847.1| transcription-repair coupling factor [Lactobacillus iners LactinV
           11V1-d]
 gi|308164170|gb|EFO66431.1| transcription-repair coupling factor [Lactobacillus iners LactinV
           11V1-d]
          Length = 1110

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 21/168 (12%), Positives = 54/168 (32%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +    Q    G+++V+  HG+G    IK  E  G K + ++    ++   L VP  +   
Sbjct: 431 QIRSYQELNPGDYVVHINHGIGIFEGIKTLESNGKKGD-YITITYRNHDQLFVPADQLGV 489

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     S             GK      +      +   ++         E++       
Sbjct: 490 VQKYVAS------------DGKIPKINKLGGNEWAKTKCRVQEKIEDIADELLAIYAHRA 537

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++   ++      +            + +  + +AI  I++++  +  
Sbjct: 538 TEKGFAFLPDDELQR---DFEASFPYLETPDQIKAIKEIKLDMQKEKP 582


>gi|311064109|ref|YP_003970834.1| transcription-repair coupling factor [Bifidobacterium bifidum
           PRL2010]
 gi|310866428|gb|ADP35797.1| Mfd Transcription-repair coupling factor [Bifidobacterium bifidum
           PRL2010]
          Length = 1199

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 19/182 (10%), Positives = 56/182 (30%), Gaps = 26/182 (14%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVA----GMKLEFFVIAFD-----K 52
             ++++       + G+++V+  HG+G   E++++ +         E+ VI +       
Sbjct: 505 PKRRRKAIDLMELKAGDYVVHEQHGIGRFLEMRQRTIGTGANKTTREYLVIEYAPSKRGA 564

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
               L +P  +   I     +EA  + +                        AK      
Sbjct: 565 PADKLFIPTDQLDLISKYIGAEAPKLNKL--------------GGSDWAATKAKARKHVH 610

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
               ++V+           ++S    ++     +        +  +   I+ ++ ++   
Sbjct: 611 EIAEDLVKLYSARQRTKGFAFSPDTPWQ---KELEDAFPYQETTDQLTTIDDVKSDMEKP 667

Query: 173 SS 174
             
Sbjct: 668 VP 669


>gi|329925538|ref|ZP_08280412.1| transcription-repair coupling factor [Paenibacillus sp. HGF5]
 gi|328939821|gb|EGG36161.1| transcription-repair coupling factor [Paenibacillus sp. HGF5]
          Length = 1175

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 50/163 (30%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I   E+ G+  ++  I +      L VP+ +   I    
Sbjct: 487 TELKVGDYVVHQNHGIGKYMGIGTLEINGIHKDYMHILYAGGD-KLSVPIEQIDLIQKYV 545

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE             K      +          K+ S       ++++      S P  
Sbjct: 546 GSE------------DKEPKVYKLGGNEWTRVKNKVRSSVQDIADDLIKLYAERQSAPGY 593

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            + +     S             +  +  AI  I+ ++     
Sbjct: 594 GFEKDT---SEQQEFEDMFPYDETPDQLRAITEIKKDMEQNRP 633


>gi|309804680|ref|ZP_07698745.1| transcription-repair coupling factor [Lactobacillus iners LactinV
           09V1-c]
 gi|308166072|gb|EFO68290.1| transcription-repair coupling factor [Lactobacillus iners LactinV
           09V1-c]
          Length = 1110

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 21/168 (12%), Positives = 54/168 (32%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +    Q    G+++V+  HG+G    IK  E  G K + ++    ++   L VP  +   
Sbjct: 431 QIRSYQELNPGDYVVHINHGIGIFEGIKTLESNGKKGD-YITITYRNHDQLFVPADQLGV 489

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     S             GK      +      +   ++         E++       
Sbjct: 490 VQKYVAS------------DGKIPKINKLGGNEWAKTKCRVQEKIEDIADELLAIYAHRA 537

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++   ++      +            + +  + +AI  I++++  +  
Sbjct: 538 TEKGFAFLPDDELQR---DFEASFPYLETPDQIKAIKEIKLDMQKEKP 582


>gi|329850695|ref|ZP_08265540.1| transcription-repair coupling factor [Asticcacaulis biprosthecum
           C19]
 gi|328841010|gb|EGF90581.1| transcription-repair coupling factor [Asticcacaulis biprosthecum
           C19]
          Length = 1161

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 22/167 (13%), Positives = 48/167 (28%), Gaps = 19/167 (11%)

Query: 9   AMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIG 68
           A       G+ +V+  HG+G    +K   V     +         +  L +PV     + 
Sbjct: 486 AEASSLSPGDLVVHIEHGIGRYEGLKTLSVNDAPHDCL-ELHYAAESKLYLPVENIDLL- 543

Query: 69  MRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ 128
            R  S++   +          R+    W  R  +   K+         E+   L +  + 
Sbjct: 544 TRYGSDSDSAQ--------LDRLGSASWQARKAKAKQKLR--------EMADGLIQLAAA 587

Query: 129 PEKSYS-ERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                  +        +    +     +  +  AI  +  +L+    
Sbjct: 588 RALREGAQIDPPSGLYDEFCAQFPYEETDDQLHAIQDVLEDLAKGQP 634


>gi|55820109|ref|YP_138551.1| transcription repair coupling factor [Streptococcus thermophilus
           LMG 18311]
 gi|55736094|gb|AAV59736.1| transcription repair coupling factor [Streptococcus thermophilus
           LMG 18311]
          Length = 1168

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 20/162 (12%), Positives = 54/162 (33%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
               G+++V+  HG+G    I+  E+ G+  ++      +D   + +P+ +   +     
Sbjct: 489 ELEKGDYVVHQTHGIGQFKGIETIEIRGVHRDYL-TIQYQDAATISLPIEQIESLSKYVS 547

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
                         GK      +   R Q+   K++         +++           +
Sbjct: 548 V------------DGKEPKINKLNDGRFQKTKQKVSKQVEDIADNLLKLYAERSQLKGFA 595

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     +        E +   ++ +  +I  I+ ++ S   
Sbjct: 596 FSPD---DDNQRDFEDEFSYAETVDQLRSIKEIKADMESDKP 634


>gi|225869494|ref|YP_002745441.1| transcription-repair coupling factor [Streptococcus equi subsp.
           equi 4047]
 gi|225698898|emb|CAW91884.1| putative transcription-repair coupling factor [Streptococcus equi
           subsp. equi 4047]
          Length = 1164

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 55/162 (33%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
               G+++V+  HG+G    I+   + G+  + +V    +    + +PV +   +     
Sbjct: 487 ELSKGDYVVHSVHGIGRFLGIETINIQGVHRD-YVTIQYQQSDRISLPVDQLESLSKYVS 545

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +             GK      +   R Q+   ++         ++++       Q    
Sbjct: 546 A------------DGKEPKINKLNDGRFQKAKQRVKKQVEDIADDLLKLYAERSQQKGFQ 593

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     + A      + A V +  +  +I  ++ ++ S   
Sbjct: 594 FSPDDELQRA---FEEDFAFVETDDQVRSIKEVKKDMESVRP 632


>gi|196250768|ref|ZP_03149455.1| transcription-repair coupling factor [Geobacillus sp. G11MC16]
 gi|196209718|gb|EDY04490.1| transcription-repair coupling factor [Geobacillus sp. G11MC16]
          Length = 1177

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 58/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    I+  E+ G+  ++  I   +    L VPV +   +     
Sbjct: 499 ELQVGDYVVHVNHGIGKYLGIETLEINGVHKDYIHI-QYQGGDTLYVPVDQMDQVQKYVG 557

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE            GK      +     ++   K+ S       ++++     ++    +
Sbjct: 558 SE------------GKEPKIYKLGGTEWKKVKKKVESSVQDIAEDLIKLYAEREASKGYA 605

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S+    +              +  +  +I  I+ ++ S+  
Sbjct: 606 FSQDTEMQR---EFEAAFPYQETEDQLRSIEEIKRDMESEKP 644


>gi|195977163|ref|YP_002122407.1| transcription-repair coupling factor [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|195973868|gb|ACG61394.1| transcription-repair coupling factor [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
          Length = 1164

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 55/162 (33%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
               G+++V+  HG+G    I+   + G+  + +V    +    + +PV +   +     
Sbjct: 487 ELSKGDYVVHSVHGIGRFLGIETINIQGIHRD-YVTIQYQQSDRISLPVEQLESLSKYVS 545

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           +             GK      +   R Q+   ++         ++++       Q    
Sbjct: 546 A------------DGKEPKINKLNDGRFQKAKQRVKKQVEDIADDLLKLYAERSQQKGFQ 593

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S     + A      + A V +  +  +I  ++ ++ S   
Sbjct: 594 FSPDDELQKA---FEEDFAFVETDDQLRSIKEVKKDMESVRP 632


>gi|138893727|ref|YP_001124180.1| transcription-repair coupling factor [Geobacillus
           thermodenitrificans NG80-2]
 gi|134265240|gb|ABO65435.1| Transcription-repair coupling factor [Geobacillus
           thermodenitrificans NG80-2]
          Length = 1177

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 58/162 (35%), Gaps = 16/162 (9%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRKL 72
             + G+++V+  HG+G    I+  E+ G+  ++  I   +    L VPV +   +     
Sbjct: 499 ELQVGDYVVHVNHGIGKYLGIETLEINGVHKDYIHI-QYQGGDTLYVPVDQMDQVQKYVG 557

Query: 73  SEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEKS 132
           SE            GK      +     ++   K+ S       ++++     ++    +
Sbjct: 558 SE------------GKEPKIYKLGGTEWKKVKKKVESSVQDIAEDLIKLYAEREASKGYA 605

Query: 133 YSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           +S+    +              +  +  +I  I+ ++ S+  
Sbjct: 606 FSQDTEMQR---EFEAAFPYQETEDQLRSIEEIKRDMESEKP 644


>gi|15896463|ref|NP_349812.1| transcription-repair coupling factor [Clostridium acetobutylicum
           ATCC 824]
 gi|15026288|gb|AAK81152.1|AE007817_6 Transcription-repair coupling factor, MFD (superfamily II helicase
           ) [Clostridium acetobutylicum ATCC 824]
 gi|325510621|gb|ADZ22257.1| Transcription-repair coupling factor, MFD (superfamily II helicase
           ) [Clostridium acetobutylicum EA 2018]
          Length = 1171

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 31/167 (18%), Positives = 62/167 (37%), Gaps = 16/167 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +       + G++IV+  HG+G    IK+ EV G K ++  +++      L VPV +   
Sbjct: 495 KIKSFTELKPGDYIVHVNHGIGVFKGIKQLEVQGHKKDYLELSYA-VDDKLYVPVEQLDL 553

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     SE            GK      + S    +   K+         E+V+      
Sbjct: 554 VQKYIGSE------------GKVPKVNKLGSSEWTKAKNKVRKSINEIAEELVKLYAVRT 601

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKS 173
           +     YS+  +++    +   E     +  +  AI+ I+ ++ S  
Sbjct: 602 TVNGFKYSKDTVWQ---KQFEEEFPYNETQDQLLAIDEIKNDMESGK 645


>gi|325962661|ref|YP_004240567.1| transcription-repair coupling factor Mfd [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323468748|gb|ADX72433.1| transcription-repair coupling factor Mfd [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 1221

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 60/174 (34%), Gaps = 9/174 (5%)

Query: 1   MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60
           M  +++          G+H+V+  HG+G   E+ +++VAG           ++ + L+  
Sbjct: 527 MPSKRRNAVDPLQLVAGDHVVHEQHGIGKFVELIQRKVAGG------GDGVREYLVLEYA 580

Query: 61  VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120
             K    G R       +++  + V G   V   M         +K          E++R
Sbjct: 581 PSKRGAPGDRLFVPTDQLDQVTRYVGGDTPVLSKMGGADWASTKSKARKAVKEIAGELIR 640

Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                 +    ++     ++     +      V +  +   IN ++ ++  +  
Sbjct: 641 LYSARMASRGHAFGPDTPWQR---ELEEAFPYVETPDQLTTINEVKADMEREIP 691


>gi|309809624|ref|ZP_07703481.1| transcription-repair coupling factor [Lactobacillus iners SPIN
           2503V10-D]
 gi|308170105|gb|EFO72141.1| transcription-repair coupling factor [Lactobacillus iners SPIN
           2503V10-D]
          Length = 1110

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 21/168 (12%), Positives = 54/168 (32%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +    Q    G+++V+  HG+G    IK  E  G K + ++    ++   L VP  +   
Sbjct: 431 QIRSYQELNPGDYVVHINHGIGIFEGIKTLESNGKKGD-YITITYRNHDQLFVPADQLGV 489

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     S             GK      +      +   ++         E++       
Sbjct: 490 VQKYVAS------------DGKIPKINKLGGNEWAKTKCRVQEKIEDIADELLAIYAHRA 537

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++   ++      +            + +  + +AI  I++++  +  
Sbjct: 538 TEKGFAFLPDDELQR---DFEASFPYLETPDQIKAIKEIKLDMQKEKP 582


>gi|261403915|ref|YP_003240156.1| transcription-repair coupling factor [Paenibacillus sp. Y412MC10]
 gi|261280378|gb|ACX62349.1| transcription-repair coupling factor [Paenibacillus sp. Y412MC10]
          Length = 1175

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 50/163 (30%), Gaps = 16/163 (9%)

Query: 12  QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAIDIGMRK 71
              + G+++V+  HG+G    I   E+ G+  ++  I +      L VP+ +   I    
Sbjct: 487 TELKVGDYVVHQNHGIGKYMGIGTLEINGIHKDYMHILYAGGD-KLSVPIEQIDLIQKYV 545

Query: 72  LSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQPEK 131
            SE             K      +          K+ S       ++++      S P  
Sbjct: 546 GSE------------DKEPKVYKLGGNEWTRVKNKVRSSVQDIADDLIKLYAERQSAPGY 593

Query: 132 SYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
            + +     S             +  +  AI  I+ ++     
Sbjct: 594 GFEKDT---SEQQEFEDMFPYDETPDQLRAITEIKKDMEQNRP 633


>gi|213692705|ref|YP_002323291.1| transcription-repair coupling factor [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|213524166|gb|ACJ52913.1| transcription-repair coupling factor [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|320458861|dbj|BAJ69482.1| transcription-repair coupling factor [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 1194

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 17/182 (9%), Positives = 56/182 (30%), Gaps = 26/182 (14%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVA----GMKLEFFVIAFD-----K 52
             ++++       + G+++V+  HG+G   E++++ +         E+ VI +       
Sbjct: 495 PKRRRKAIDLVELKKGDYVVHEQHGIGRFIEMRQRTIGTGANKTTREYLVIEYAPSKRGA 554

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
               L +P  +   +     +EA  + +                        AK      
Sbjct: 555 PADKLFIPTDQLDQVSKYIGAEAPKLNKL--------------GGSDWAATKAKARKHVH 600

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
               ++++           ++S    ++     +        +  +   I+ ++ ++   
Sbjct: 601 EIADDLIKLYSARQRAKGFAFSPDTPWQ---KELEDAFPYQETADQLTTIDEVKSDMEKP 657

Query: 173 SS 174
             
Sbjct: 658 VP 659


>gi|319654942|ref|ZP_08009016.1| transcription-repair coupling factor [Bacillus sp. 2_A_57_CT2]
 gi|317393367|gb|EFV74131.1| transcription-repair coupling factor [Bacillus sp. 2_A_57_CT2]
          Length = 1179

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 60/182 (32%), Gaps = 26/182 (14%)

Query: 3   FQQKRDAMR----------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDK 52
            ++K    +             + G+++V+  HG+G    I+  E+ G+  ++  I   +
Sbjct: 478 TKKKARRQKLSNAERIKSYSELKVGDYVVHVNHGIGKYLGIETLEINGVHKDYLHI-RYQ 536

Query: 53  DKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDL 112
               L VPV +   +     SEA            K      +     +    K+ S   
Sbjct: 537 GSDKLYVPVEQIELVQKYVGSEA------------KEPKIYKLGGNDWKRVKKKVQSSVQ 584

Query: 113 IAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSK 172
               ++++     ++    ++S     +              +  +  +I+ I+ ++  +
Sbjct: 585 DIADDLIKLYAEREASKGYAFSPDGDMQR---EFEAAFPYQETEDQIRSIHEIKKDMERE 641

Query: 173 SS 174
             
Sbjct: 642 RP 643


>gi|315653944|ref|ZP_07906860.1| transcriptional repair coupling factor [Lactobacillus iners ATCC
           55195]
 gi|315488640|gb|EFU78286.1| transcriptional repair coupling factor [Lactobacillus iners ATCC
           55195]
          Length = 1110

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 21/168 (12%), Positives = 54/168 (32%), Gaps = 16/168 (9%)

Query: 7   RDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPVGKAID 66
           +    Q    G+++V+  HG+G    IK  E  G K + ++    ++   L VP  +   
Sbjct: 431 QIRSYQELNPGDYVVHINHGIGIFEGIKTLESNGKKGD-YITITYRNHDQLFVPADQLGV 489

Query: 67  IGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTD 126
           +     S             GK      +      +   ++         E++       
Sbjct: 490 VQKYVAS------------DGKIPKINKLGGNEWAKTKCRVQEKIEDIADELLAIYAHRA 537

Query: 127 SQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
           ++   ++      +            + +  + +AI  I++++  +  
Sbjct: 538 TEKGFAFLPDDELQR---DFEASFPYLETPDQIKAIKEIKLDMQKEKP 582


>gi|238927163|ref|ZP_04658923.1| transcription-repair coupling factor [Selenomonas flueggei ATCC
           43531]
 gi|238884945|gb|EEQ48583.1| transcription-repair coupling factor [Selenomonas flueggei ATCC
           43531]
          Length = 1097

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 25/173 (14%), Positives = 54/173 (31%), Gaps = 16/173 (9%)

Query: 2   TFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVPV 61
               +R    +    G+++V+ +HG+G    ++  EVAG+  ++  I        L VP 
Sbjct: 416 ASAGERIRHFREIAPGDYVVHVSHGIGKYLGVETIEVAGVHRDYLHI-QYGGDDKLFVPT 474

Query: 62  GKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRD 121
            +   +     +E            G A     M S       AK           ++  
Sbjct: 475 DQVGLLQKYIGAE------------GSAPRLHRMGSADWARARAKAQKSVEDIADHLLEL 522

Query: 122 LHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
                     +++     ++             +  +  AI  I+ ++ S+  
Sbjct: 523 YAARRLAKGHAFAPD---DAGQREFEEAFPYQETDDQLRAIAEIKNDMESEKP 572


>gi|154484319|ref|ZP_02026767.1| hypothetical protein EUBVEN_02032 [Eubacterium ventriosum ATCC
           27560]
 gi|149734796|gb|EDM50713.1| hypothetical protein EUBVEN_02032 [Eubacterium ventriosum ATCC
           27560]
          Length = 172

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 65/172 (37%), Gaps = 7/172 (4%)

Query: 13  GFRTGEHIVYPAHGVGTITEIKEQEVAGMKLE--FFVIAFDKDKMCLKVPVGKAIDIGMR 70
            F  GE+IV+   GV  + +I   ++ G   +  ++V+   K++            I MR
Sbjct: 1   MFNKGEYIVHGRKGVCKVEDITHLDIDGADKKSLYYVLIPMKNQDSKVFYPTDNDKIPMR 60

Query: 71  KLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDSQ-- 128
            +     VE  ++ +     +      +R  +Y   I S D   +  +++ LH+      
Sbjct: 61  TIHTKDQVEEIVEHINEIEPIWIDNERQREYKYKEVIGSCDCKQLIGIIKTLHKRGRSRL 120

Query: 129 ---PEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTE 177
               + +Y + +    A   +  E +    I +P+    I  N++      E
Sbjct: 121 AHGKKITYVDEKYLREAKEVLYDEFSLALDIDKPQVEKYIINNINESDKAAE 172


>gi|116513512|ref|YP_812418.1| transcription-repair coupling factor [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|116092827|gb|ABJ57980.1| transcription-repair coupling factor [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
          Length = 1158

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 20/180 (11%), Positives = 58/180 (32%), Gaps = 23/180 (12%)

Query: 2   TFQQKRDAMR-------QGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDK 54
           + ++ +              + G+++V+  HG+G    I+  E  G K + ++    +  
Sbjct: 466 SKKRIKTLENAQRLRSYTELKPGDYVVHVNHGIGRFEGIQTLETDGKKRD-YITITYQKG 524

Query: 55  MCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIA 114
             L VP  +   +     SE            GK      +      +   ++ +     
Sbjct: 525 DQLFVPADQLSLVQKYVASE------------GKQPHVNKLGGSEWAKTKKRVAARVEDI 572

Query: 115 IAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSS 174
             +++    + +++   ++S     ++A            +  +  A   I+ ++     
Sbjct: 573 ADDLIELYAKREAEKGFAFSPDGSDQAA---FEAAFPYEPTPDQLRATAEIKADMEKAKP 629


>gi|308050222|ref|YP_003913788.1| tran