>cd04317 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS. These homodimeric enzymes are class2b aminoacyl-tRNA synthetases (aaRSs). This domain is a beta-barrel domain (OB fold) involved in binding the tRNA anticodon stem-loop. aaRSs catalyze the specific attachment of amino acids (AAs) to their cognate tRNAs during protein biosynthesis. This 2-step reaction involves i) the activation of the AA by ATP in the presence of magnesium ions, followed by ii) the transfer of the activated AA to the terminal ribose of tRNA. In the case of the class2b aaRSs, the activated AA is attached to the 3'OH of the terminal ribose. Eukaryotes contain 2 sets of aaRSs, both of which are encoded by the nuclear genome. One set concerns with cytoplasmic synthesis, wh

Probab=100.00 E-value=4.9e-38 Score=291.62 Aligned_cols=134 Identities=46% Similarity=0.835 Sum_probs=128.5 Q ss_pred CCCCHHHCCHHHCCCEEEEEEEECCCCCCCCEEEEEEECCCCEEEEEECCC-CHHHHHHHCCCCCCEEEEEEEEEECCCC Q ss_conf 742042369799898899997980044469879999977982599997488-1578998528988589999999975865 Q gi|254780419|r 5 RTHSCGDLGVSDVGSFVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPD-SACFEIAKSVRSEWVLCIDGLVMSRSAE 83 (622) Q Consensus 5 Rth~cg~l~~~~~g~~V~i~GwV~~~R~~g~l~F~~lrD~sG~~Q~v~~~~-~~~~~~~~~l~~esvv~v~G~V~~r~~~ 83 (622) T Consensus 1 RTh~~~el~~~~~G~~V~v~GwV~~~R~~gki~Fi~LRD~tg~iQ~v~~~~~~~~~~~~~~l~~EsvV~V~G~V~~r~~~ 80 (135) T cd04317 1 RTHYCGELRESHVGQEVTLCGWVQRRRDHGGLIFIDLRDRYGIVQVVFDPEEAPEFELAEKLRNESVIQVTGKVRARPEG 80 (135) T ss_pred CCEEHHHCCHHHCCCEEEEEEEEEEEEECCCEEEEEEECCCCEEEEEECCCCCHHHHHHHHCCCCCEEEEEEEEEECCCC T ss_conf 96354218958899999999999999717979999985288358899957651678999718976799999999967976 Q ss_pred CCCCCCCCCEEEEEEEEEEEEECCCCCCCCCCCCCCCCHHHHCCCCCEEECCCCC Q ss_conf 5588777865999988999950211799864576678987821123200012111 Q gi|254780419|r 84 TINANIITGQIELSAQKIEILSVAEELPLPVFGEREYPESIRFKYRFLDLRRDTL 138 (622) Q Consensus 84 ~~n~~~~tG~~Ei~~~~~~il~~a~~~P~~~~~~~~~~e~~rl~~R~LdLR~~~~ 138 (622) T Consensus 81 ~~n~~~~tGeiEi~v~~i~ils~a~~lP~~~~~~~~~~~e~Rl~~R~LDLR~~~~ 135 (135) T cd04317 81 TVNPKLPTGEIEVVASELEVLNKAKTLPFEIDDDVNVSEELRLKYRYLDLRRPKM 135 (135) T ss_pred CCCCCCCCCCEEEEEEEEEEEECCCCCCCCCCCCCCCCHHHHHCCEEEEECCCCC T ss_conf 6056656897799997999977288899886556778956620243356258889

HHsearch alignment for GI: 254780419 and conserved domain: cd04317