RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780420|ref|YP_003064833.1| carbamoyl phosphate synthase small subunit [Candidatus Liberibacter asiaticus str. psy62] (396 letters) >gnl|CDD|30851 COG0505, CarA, Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism]. Length = 368 Score = 481 bits (1239), Expect = e-136 Identities = 190/384 (49%), Positives = 240/384 (62%), Gaps = 17/384 (4%) Query: 11 KPTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIG 70 A LVL DG+V EG GA G+ E+ FNTS+TGYQEILTDPSY GQIV FT+P IG Sbjct: 1 SMKAYLVLEDGTVFEGYSFGAEGTAVGEVVFNTSMTGYQEILTDPSYKGQIVTFTYPLIG 60 Query: 71 NVGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRA 130 N GVN EDFES A GLV++ PSN+RA D +LK GI G++GIDTRA Sbjct: 61 NYGVNDEDFESDRIH----AAGLVVRELSERPSNWRATESLDEYLKEEGIPGIAGIDTRA 116 Query: 131 LTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSEKIW 190 LT IR+ G VIA P+ D L ERA+ + G+ G +L K V+ + W Sbjct: 117 LTRKIREKGAMKGVIATGPE--LDPAKLLERARAFPGILGTDLVKEVSTKEPYTWPG--- 171 Query: 191 KWGEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGV 250 + HVV ID+G++ N+LR L GCR+T+V A+TS ++I++L PDG+ Sbjct: 172 -------LNGGGEPGKHVVVIDFGVKRNILRELVKRGCRVTVVPADTSAEEILALNPDGI 224 Query: 251 LLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNH 310 LSNGPGDPA Y+ I +L+ + +P+FGICLGHQLL LALGA+T KM GH G NH Sbjct: 225 FLSNGPGDPAPLD-YAIETIKELLGTKIPIFGICLGHQLLALALGAKTYKMKFGHRGANH 283 Query: 311 PVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPE 370 PVK++ G V I S NHG+A+D SL L+ TH++L D + G R D P FSVQYHPE Sbjct: 284 PVKDLDTGRVYITSQNHGYAVDEDSLVETLKVTHVNLNDGTVEGIRHKDLPAFSVQYHPE 343 Query: 371 SSPGPQDSYYLFSTFIDFMHKRKT 394 +SPGP D+ YLF FI+ M K Sbjct: 344 ASPGPHDTRYLFDEFIELMEAAKK 367 >gnl|CDD|164573 CHL00197, carA, carbamoyl-phosphate synthase arginine-specific small subunit; Provisional. Length = 382 Score = 332 bits (852), Expect = 1e-91 Identities = 160/388 (41%), Positives = 221/388 (56%), Gaps = 12/388 (3%) Query: 8 TIKKPTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFP 67 K A+LVL DG+ G + E+ FNT +TGYQEI+TDPSY QIV FT+P Sbjct: 1 MKKMIPAILVLEDGTYYRGWSFSNPITTIGEVVFNTGMTGYQEIITDPSYFEQIVTFTYP 60 Query: 68 HIGNVGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGID 127 IGN G+N ED ES+ + G++ K SN+R ++L+ I + GID Sbjct: 61 EIGNTGINLEDIESVKIQ----VKGIIAKNICKSSSNWRQQESLVSYLQRHKIPFIFGID 116 Query: 128 TRALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSE 187 TRALT +R +G N I++ +L L+ + K + ++L VT S +W E Sbjct: 117 TRALTQHLRRFGTMNGCISNQ---NLNLSYLRAKIKESPHMPSSDLIPRVTTSSYYEWDE 173 Query: 188 K-IWKWGEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQ 246 K + + S + ++ ID+G++ N+LR L S GC IT+V A + Y+DI+S Q Sbjct: 174 KSHPSFYLADNKRPHSSYQLKIIVIDFGVKYNILRRLKSFGCSITVVPATSPYQDILSYQ 233 Query: 247 PDGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHH 306 PDG+LLSNGPGDP+ Y + KL+ +P+FGIC+GHQ+L LAL A+T K+ GH Sbjct: 234 PDGILLSNGPGDPSAIH-YGIKTVKKLLKYNIPIFGICMGHQILSLALEAKTFKLKFGHR 292 Query: 307 GVNHPVKNISNGTVEIVSMNHGFAIDASSL-PAGLEETHISLFDSSNCGFRLIDQPVFSV 365 G+NHP N VEI S NHGFA++ SL TH +L D + G +P FSV Sbjct: 293 GLNHPSG--LNQQVEITSQNHGFAVNLESLAKNKFYITHFNLNDGTVAGISHSPKPYFSV 350 Query: 366 QYHPESSPGPQDSYYLFSTFIDFMHKRK 393 QYHPE+SPGP D+ YLF FI+ + K Sbjct: 351 QYHPEASPGPHDADYLFEYFIEIIKHSK 378 >gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only]. Length = 1435 Score = 303 bits (776), Expect = 7e-83 Identities = 136/386 (35%), Positives = 200/386 (51%), Gaps = 36/386 (9%) Query: 14 AVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGNVG 73 + LVL DGSV+ G GA S+ E+ F T + GY E LTDPSY GQI+ FT+P IGN G Sbjct: 3 STLVLEDGSVLPGYSFGAPKSVAGELVFQTGMVGYPESLTDPSYKGQILVFTYPLIGNYG 62 Query: 74 VNSEDFESISRKNFKG----AVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTR 129 V + + K+F+ GLV+ E S++ A WL+ G+ G+ G+DTR Sbjct: 63 VPPDARDEGLLKHFESGQIHVAGLVVGEYSIEYSHWLATKSLGEWLQEEGVPGIYGVDTR 122 Query: 130 ALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSEKI 189 ALT +R+ G ++ + L V+ + + + + Sbjct: 123 ALTKKLREQGSMLGKLSIEKSPVL-----------FVDPNKRNLVSQVSTKEPKVYGD-- 169 Query: 190 WKWGEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDG 249 ++ ID G++ N +R L G +T+V I + DG Sbjct: 170 -------------GKSLRILAIDCGLKYNQIRCLVKRGAEVTVVP---WDYPIAKEEYDG 213 Query: 250 VLLSNGPGDPAV-TSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGV 308 + LSNGPGDP + + + + +L++S +P+FGICLGHQLL LA GA+T KM G+ G Sbjct: 214 LFLSNGPGDPELCPLLVQN--VRELLESNVPVFGICLGHQLLALAAGAKTYKMKYGNRGH 271 Query: 309 NHPVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYH 368 N P + G I S NHG+A+D ++LPAG + ++ D SN G +P FSVQ+H Sbjct: 272 NIPCTCRATGRCFITSQNHGYAVDPATLPAGWKPLFVNANDGSNEGIMHSSKPFFSVQFH 331 Query: 369 PESSPGPQDSYYLFSTFIDFMHKRKT 394 PE++PGP D+ YLF FI+ + K K+ Sbjct: 332 PEATPGPHDTEYLFDVFIELVKKSKS 357 >gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II. This group of sequences represents the small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II. CPSase II catalyzes the production of carbomyl phosphate (CP) from bicarbonate, glutamine and two molecules of MgATP. The reaction is believed to proceed by a series of four biochemical reactions involving a minimum of three discrete highly reactive intermediates. The synthesis of CP is critical for the initiation of two separate biosynthetic pathways. In one CP is coupled to aspartate, its carbon and nitrogen nuclei ultimately incorporated into the aromatic moieties of pyrimidine nucleotides. In the second pathway CP is condensed with ornithine at the start of the urea cycle and is utilized for the detoxification of ammonia and biosynthesis of arginine. CPSases may be encoded by one or by several genes, depending on the species. The E.coli enzyme is a heterodimer consisting of two polypeptide chains referred to as the small and large subunit. Ammonia an intermediate during the biosynthesis of carbomyl phosphate produced by the hydrolysis of glutamine in the small subunit of the enzyme is delivered via a molecular tunnel between the remotely located carboxyphosphate active site in the large subunit. CPSase IIs belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. This group also contains the sequence from the mammalian urea cycle form which has lost the active site Cys, resulting in an ammonia-dependent form, CPSase I. Length = 178 Score = 270 bits (692), Expect = 6e-73 Identities = 97/179 (54%), Positives = 124/179 (69%), Gaps = 1/179 (0%) Query: 208 VVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSS 267 VV ID+G++ N+LR L GC +T+V T ++I+ L PDG+ LSNGPGDPA+ Sbjct: 1 VVVIDFGVKHNILRELLKRGCEVTVVPYNTDAEEILKLDPDGIFLSNGPGDPALLDEAIK 60 Query: 268 PIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMNH 327 + KL+ +P+FGICLGHQLL LALGA+T KM GH G NHPVK++ G V I S NH Sbjct: 61 TVR-KLLGKKIPIFGICLGHQLLALALGAKTYKMKFGHRGSNHPVKDLITGRVYITSQNH 119 Query: 328 GFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPESSPGPQDSYYLFSTFI 386 G+A+D SLP GLE TH++L D + G R D PVFSVQ+HPE+SPGP D+ YLF F+ Sbjct: 120 GYAVDPDSLPGGLEVTHVNLNDGTVEGIRHKDLPVFSVQFHPEASPGPHDTEYLFDEFL 178 >gnl|CDD|144543 pfam00988, CPSase_sm_chain, Carbamoyl-phosphate synthase small chain, CPSase domain. The carbamoyl-phosphate synthase domain is in the amino terminus of protein. Carbamoyl-phosphate synthase catalyses the ATP-dependent synthesis of carbamyl-phosphate from glutamine or ammonia and bicarbonate. This important enzyme initiates both the urea cycle and the biosynthesis of arginine and/or pyrimidines. The carbamoyl-phosphate synthase (CPS) enzyme in prokaryotes is a heterodimer of a small and large chain. The small chain promotes the hydrolysis of glutamine to ammonia, which is used by the large chain to synthesize carbamoyl phosphate. See pfam00289. The small chain has a GATase domain in the carboxyl terminus. See pfam00117. Length = 131 Score = 205 bits (524), Expect = 2e-53 Identities = 70/135 (51%), Positives = 86/135 (63%), Gaps = 4/135 (2%) Query: 12 PTAVLVLADGSVIEGMGCGATGSIQAEICFNTSLTGYQEILTDPSYLGQIVNFTFPHIGN 71 A LVL DG+V EG GA G E+ FNT +TGYQEILTDPSY GQIV FT+P IGN Sbjct: 1 MKAYLVLEDGTVFEGESFGAEGEAVGEVVFNTGMTGYQEILTDPSYAGQIVVFTYPLIGN 60 Query: 72 VGVNSEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRAL 131 G+N EDFES A GL+++ PSN+R+ D +LK GI G+SG+DTRAL Sbjct: 61 YGINPEDFESDKPH----AKGLIVRELSDIPSNWRSEESLDEFLKEHGIPGISGVDTRAL 116 Query: 132 TVWIRDYGVSNSVIA 146 T +R+ G VI+ Sbjct: 117 TRKLREKGAMKGVIS 131 >gnl|CDD|143892 pfam00117, GATase, Glutamine amidotransferase class-I. Length = 187 Score = 180 bits (460), Expect = 5e-46 Identities = 70/185 (37%), Positives = 97/185 (52%), Gaps = 9/185 (4%) Query: 211 IDYG--IRSNLLRVLSSLGCRITIVGAETSYKDIMSL-QPDGVLLSNGPGDPAVTSVYSS 267 ID G NL R L LG + +V +T ++I+ L PDG+++S GPG P + + Sbjct: 3 IDNGDSFTYNLARALRELGVEVEVVPNDTPAEEILELLNPDGIIISPGPGSPG-DAGGAI 61 Query: 268 PIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNIS-----NGTVEI 322 I +L ++ +P+ GICLGHQLL LA G + +K + HHG N PV + V I Sbjct: 62 EAIKELRENKIPILGICLGHQLLALAFGGKVIKAKEPHHGKNSPVGHDKGLFYGLPNVFI 121 Query: 323 VSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPESSPGPQDSYYLF 382 V H +A+D +LP GLE T S R + P+F VQ+HPESS P LF Sbjct: 122 VRRYHSYAVDPDTLPDGLEVTAASDNGGEIMAIRHKENPIFGVQFHPESSLTPGGPELLF 181 Query: 383 STFID 387 + I Sbjct: 182 NFLIK 186 >gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase. Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase (ASase). This group contains proteins similar to para-aminobenzoate (PABA) synthase and ASase. These enzymes catalyze similar reactions and produce similar products, PABA and ortho-aminobenzoate (anthranilate). Each enzyme is composed of non-identical subunits: a glutamine amidotransferase subunit (component II) and a subunit that produces an aminobenzoate products (component I). ASase catalyses the synthesis of anthranilate from chorismate and glutamine and is a tetrameric protein comprising two copies each of components I and II. Component II of ASase belongs to the family of triad GTases which hydrolyze glutamine and transfer nascent ammonia between the active sites. In some bacteria, such as Escherichia coli, component II can be much larger than in other organisms, due to the presence of phosphoribosyl-anthranilate transferase (PRTase) activity. PRTase catalyses the second step in tryptophan biosynthesis and results in the addition of 5-phosphoribosyl-1-pyrophosphate to anthranilate to create N-5'-phosphoribosyl-anthranilate. In E.coli, the first step in the conversion of chorismate to PABA involves two proteins: PabA and PabB which co-operate to transfer the amide nitrogen of glutamine to chorismate forming 4-amino-4 deoxychorismate (ADC). PabA acts as a glutamine amidotransferase, supplying an amino group to PabB, which carries out the amination reaction. A third protein PabC then mediates elimination of pyruvate and aromatization to give PABA. Several organisms have bipartite proteins containing fused domains homologous to PabA and PabB commonly called PABA synthases. These hybrid PABA synthases may produce ADC and not PABA. Length = 184 Score = 101 bits (254), Expect = 4e-22 Identities = 47/161 (29%), Positives = 77/161 (47%), Gaps = 10/161 (6%) Query: 218 NLLRVLSSLGCRITIVGA-ETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDS 276 NL++ L LG + +V E + +++ L PD +++S GPG P + S I + + Sbjct: 13 NLVQYLRELGAEVVVVRNDEITLEELELLNPDAIVISPGPGHPEDAGI--SLEIIRALAG 70 Query: 277 GMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMN------HGFA 330 +P+ G+CLGHQ + A G + V+ + HG + + +G + + H Sbjct: 71 KVPILGVCLGHQAIAEAFGGKVVRAPEPMHGKTSEIHHDGSGLFKGLPQPFTVGRYHSLV 130 Query: 331 IDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPES 371 +D LP L E S D R D P++ VQ+HPES Sbjct: 131 VDPDPLPDLL-EVTASTEDGVIMALRHRDLPIYGVQFHPES 170 >gnl|CDD|30858 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism]. Length = 191 Score = 92.1 bits (229), Expect = 2e-19 Identities = 48/163 (29%), Positives = 79/163 (48%), Gaps = 13/163 (7%) Query: 218 NLLRVLSSLGCRITIV-GAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDS 276 NL++ L LG +T+V + S + I +L+PD +++S GPG P + S +I + Sbjct: 16 NLVQYLRELGAEVTVVRNDDISLELIEALKPDAIVISPGPGTPKDAGI-SLELIRRFAGR 74 Query: 277 GMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMN--------HG 328 +P+ G+CLGHQ + A G + V+ + HG + + +G+ + H Sbjct: 75 -IPILGVCLGHQAIAEAFGGKVVRAKEPMHGKTSIITH--DGSGLFAGLPNPFTVTRYHS 131 Query: 329 FAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPES 371 +D +LP LE T S R P++ VQ+HPES Sbjct: 132 LVVDPETLPEELEVTAESEDGGVIMAVRHKKLPIYGVQFHPES 174 >gnl|CDD|30864 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism]. Length = 198 Score = 72.2 bits (177), Expect = 2e-13 Identities = 48/166 (28%), Positives = 66/166 (39%), Gaps = 24/166 (14%) Query: 221 RVLSSLGCRIT-IVGAETSYKDIMSLQPDGVLLSNGPG---DPAVTSVYSSPIICKLVDS 276 R L LG + IV +++ PDG+++S GP D +I Sbjct: 19 RRLRELGYVYSEIVPYTGDAEELPLDSPDGIIISGGPMSVYDEDPWLPREKDLIKDAGVP 78 Query: 277 GMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTV---------EIVSMNH 327 G P+ GICLGHQLL ALG + + + G PV+ V M+H Sbjct: 79 GKPVLGICLGHQLLAKALGGKVERGPKREIGW-TPVELTEGDDPLFAGLPDLFTTVFMSH 137 Query: 328 GFAIDASSLPAGLEETHISLFDSSNC---GFRLIDQPVFSVQYHPE 370 G + LP G L S C FR + + VQ+HPE Sbjct: 138 GDTVVE--LPEGAV----VLASSETCPNQAFR-YGKRAYGVQFHPE 176 >gnl|CDD|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase. Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase. GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. Glutamine amidotransferase (GATase) activity catalyse the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. GMP synthetase catalyses the amination of the nucleotide precursor xanthosine 5'-monophospahte to form GMP. GMP synthetase belongs to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 181 Score = 69.5 bits (171), Expect = 1e-12 Identities = 45/171 (26%), Positives = 73/171 (42%), Gaps = 41/171 (23%) Query: 221 RVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYS--SPIICK-LVDSG 277 R + LG I+ T ++I P G++LS GP +SVY +P + + + G Sbjct: 16 RRVRELGVYSEILPNTTPLEEIKLKNPKGIILSGGP-----SSVYEEDAPRVDPEIFELG 70 Query: 278 MPMFGICLGHQLLGLALGAQTVKMYQGHHG--------VNHP---VKNISNGTVEIVSMN 326 +P+ GIC G QL+ ALG + + G ++ + + + V M+ Sbjct: 71 VPVLGICYGMQLIAKALGGKVER---GDKREYGKAEIEIDDSSPLFEGLPDEQT--VWMS 125 Query: 327 HGFAIDASSLPAGLEETHISLFD----SSNCGFRLI---DQPVFSVQYHPE 370 HG + LP G F S NC I ++ ++ VQ+HPE Sbjct: 126 HGDEVVK--LPEG--------FKVIASSDNCPVAAIANEEKKIYGVQFHPE 166 >gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 188 Score = 66.5 bits (163), Expect = 1e-11 Identities = 44/182 (24%), Positives = 63/182 (34%), Gaps = 26/182 (14%) Query: 207 HVVCIDYGIRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYS 266 H G+ +LLR + I +V DG+++ GP Y Sbjct: 7 HDTPEGPGLFEDLLREAGAETIEIDVVDVYAGELLPDLDDYDGLVILGGPMS-VDEDDY- 64 Query: 267 SPI-------ICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGT 319 P I + + +G P+ GICLGHQLL ALG + + +G PV G Sbjct: 65 -PWLKKLKELIRQALAAGKPVLGICLGHQLLARALGGKVGRNPKGWEIGWFPVTLTEAGK 123 Query: 320 VEIVSMNHGFAIDA--------SSLPAGLEETHISLFDSSNC---GFRLIDQPVFSVQYH 368 + + LP G + L S C FR +Q+H Sbjct: 124 ADPLFAGLPDEFPVFHWHGDTVVELPPG----AVLLASSEACPNQAFR-YGDRALGLQFH 178 Query: 369 PE 370 PE Sbjct: 179 PE 180 >gnl|CDD|35249 KOG0026, KOG0026, KOG0026, Anthranilate synthase, beta chain [Amino acid transport and metabolism]. Length = 223 Score = 58.5 bits (141), Expect = 3e-09 Identities = 50/188 (26%), Positives = 78/188 (41%), Gaps = 21/188 (11%) Query: 201 SSDAKYHVVCIDY--GIRSNLLRVLS-SLGCRITIV-GAETSYKDIMSLQPDGVLLSNGP 256 SS ++ ID NL + L LGC + E + +++ P G+L+S GP Sbjct: 14 SSKQNGPIIVIDNYDSFTYNLCQYLMGELGCHFEVYRNDELTVEELKRKNPRGLLISPGP 73 Query: 257 GDPAVTSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQG-HHGVNHPV--- 312 G P + + + + +P+FG+C+G Q +G A G + V+ G HG + V Sbjct: 74 GTPQDSGISLQTV--LELGPLVPLFGVCMGLQCIGEAFGGKIVRSPFGVMHGKSSMVHYD 131 Query: 313 --------KNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLID-QPVF 363 +SN IV H I+ S P+ E D R + + Sbjct: 132 EKGEEGLFSGLSNPF--IVGRYHSLVIEKDSFPSDELEVTAWTEDGLVMAARHRKYKHIQ 189 Query: 364 SVQYHPES 371 VQ+HPES Sbjct: 190 GVQFHPES 197 >gnl|CDD|164502 CHL00101, trpG, anthranilate synthase component 2. Length = 190 Score = 55.9 bits (135), Expect = 2e-08 Identities = 42/164 (25%), Positives = 69/164 (42%), Gaps = 15/164 (9%) Query: 218 NLLRVLSSLGCR-ITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDS 276 NL++ L L + E I +L +++S GPG P + + S +I Sbjct: 14 NLVQSLGELNSDVLVCRNDEIDLSKIKNLNIRHIIISPGPGHPRDSGI-SLDVISSYAPY 72 Query: 277 GMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPV--------KNISNGTVEIVSMNHG 328 +P+ G+CLGHQ +G G + +K + HG + + + N + H Sbjct: 73 -IPILGVCLGHQSIGYLFGGKIIKAPKPMHGKTSKIYHNHDDLFQGLPNPF--TATRYHS 129 Query: 329 FAIDASSLPAGLEETHISLFDSSNCGFRLIDQP-VFSVQYHPES 371 ID +LP+ LE T + D R + +Q+HPES Sbjct: 130 LIIDPLNLPSPLEITAWT-EDGLIMACRHKKYKMLRGIQFHPES 172 >gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain. Type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA. and, the A4 beta-galactosidase middle domain. The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site. Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. For Pyrococcus horikoshii PH1704, the Cys of the nucleophile elbow together with a different His and, a Glu from an adjacent monomer form a catalytic triad different from the typical GATase1 triad. The E. coli HP-II C-terminal domain, S. meliloti Rm1021 ThuA and the A4 beta-galactosidase middle domain lack the catalytic triad typical GATaseI domains. GATase1-like domains can occur either as single polypeptides, as in Class I glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 115 Score = 55.3 bits (133), Expect = 3e-08 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 6/84 (7%) Query: 218 NLLRVLSSLGCRITIVGAE--TSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPI--ICKL 273 + L L G + +V + D+ DG++L GPG P + + + + + Sbjct: 16 SPLDALREAGAEVDVVSPDGGPVESDVDLDDYDGLILPGGPGTPDDLARDEALLALLREA 75 Query: 274 VDSGMPMFGICLGHQLLGLALGAQ 297 +G P+ GICLG QL L LG Q Sbjct: 76 AAAGKPILGICLGAQL--LVLGVQ 97 >gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain. Type 1 glutamine amidotransferase (GATase1)-like domain. This group contains proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA, the A4 beta-galactosidase middle domain and peptidase E. The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site. Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase (CPSase), cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. For Pyrococcus horikoshii PH1704, the Cys of the nucleophile elbow together with a different His and, a Glu from an adjacent monomer form a catalytic triad different from the typical GATase1 triad. Peptidase E is believed to be a serine peptidase having a Ser-His-Glu catalytic triad which differs from the Cys-His-Glu catalytic triad of typical GATase1 domains, by having a Ser in place of the reactive Cys at the nucleophile elbow. The E. coli HP-II C-terminal domain, S. meliloti Rm1021 ThuA and the A4 beta-galactosidase middle domain lack the catalytic triad typical GATaseI domains. GATase1-like domains can occur either as single polypeptides, as in Class I glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Peptidase E has a circular permutation in the common core of a typical GTAse1 domain. Length = 92 Score = 55.3 bits (133), Expect = 3e-08 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 4/77 (5%) Query: 218 NLLRVLSSLGCRITIVGAETSYK--DIMSLQPDGVLLSNGPGDPAVTSVYSSPI--ICKL 273 + L L G + +V + D+ DG++L GPG P + + + + + Sbjct: 16 SPLDALREAGAEVDVVSPDGGPVESDVDLDDYDGLILPGGPGTPDDLAWDEALLALLREA 75 Query: 274 VDSGMPMFGICLGHQLL 290 +G P+ GICLG QLL Sbjct: 76 AAAGKPVLGICLGAQLL 92 >gnl|CDD|36438 KOG1224, KOG1224, KOG1224, Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis]. Length = 767 Score = 54.7 bits (131), Expect = 4e-08 Identities = 54/216 (25%), Positives = 87/216 (40%), Gaps = 25/216 (11%) Query: 194 EETSFLKSSDAKYHVVCIDY--GIRSNLLRVLSSLG--CRITIVGAET----SYKDIMSL 245 E+ S +K S + + ID N+ ++LS++ + IV E +Y + Sbjct: 3 EDLSVVKKSLPRLRTLLIDNYDSYTFNIYQLLSTINGVPPVVIVHDEWTWEDAYHYLYQD 62 Query: 246 QP-DGVLLSNGPGDPAVTSVYSSPIICKLVD--SGMPMFGICLGHQLLGLALGAQTV--- 299 D +++ GPG P + I +L+ +P+ GICLG Q LGL GA V Sbjct: 63 VAFDAIVVGPGPGSPMCAA--DIGICLRLLLECRDIPILGICLGFQALGLVHGAHVVHAN 120 Query: 300 -----KMYQGHHGVNHPVKNISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNC- 353 ++ H N I +G + ++ +SLP L +++D + Sbjct: 121 EPVHGRVSGIEHDGNILFSGIPSGRNSDFKVVRYHSLIINSLPIDLLPILWTIYDDNGHI 180 Query: 354 --GFRLIDQPVFSVQYHPESSPGPQDSYYLFSTFID 387 P F +QYHPES LF F+D Sbjct: 181 LMSIMHSSFPHFGLQYHPESI-ASTYGSQLFKNFLD 215 >gnl|CDD|36835 KOG1622, KOG1622, KOG1622, GMP synthase [Nucleotide transport and metabolism]. Length = 552 Score = 50.7 bits (121), Expect = 7e-07 Identities = 40/176 (22%), Positives = 72/176 (40%), Gaps = 21/176 (11%) Query: 208 VVCIDYGIRSNLL--RVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVY 265 ++ +D+G + + R + L + I+ T K I P G+++S GP SVY Sbjct: 19 ILILDFGAQYGKVIDRRVRELNVQSEILPLTTPAKTITEYGPRGIIISGGP-----NSVY 73 Query: 266 S--SPII-CKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVN--------HPVKN 314 + +P + + G+P+ GIC G QL+ G VK G + Sbjct: 74 AEDAPSFDPAIFELGVPVLGICYGMQLINKLNGGTVVKGMVREDGEDEIEVDDSVDLFSG 133 Query: 315 ISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQPVFSVQYHPE 370 + V + HG ++ +P G + S + G + ++ +Q+HPE Sbjct: 134 LHKTEFMTVLLTHGDSLSK--VPEGFKVVAFSG-NKPVAGILNELKKIYGLQFHPE 186 >gnl|CDD|153216 cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 189 Score = 50.3 bits (121), Expect = 1e-06 Identities = 40/164 (24%), Positives = 57/164 (34%), Gaps = 48/164 (29%) Query: 228 CRITIVGAETSYKDIMSLQPDGVLLSNGP--------GDPAVTS--------VYSSPIIC 271 + V E + + L DG+LL+ G +P + ++ Sbjct: 36 VLLPPVDDEEDLEQYLEL-LDGLLLTGGGDVDPPLYGEEPHPELGPIDPERDAFELALLR 94 Query: 272 KLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMNHGFAI 331 ++ G P+ GIC G QLL +ALG +YQ VN S+ H AI Sbjct: 95 AALERGKPILGICRGMQLLNVALGG---TLYQ-DIRVN--------------SL-HHQAI 135 Query: 332 DASSLPAGLEETHISLFDSSNCG----FRLID-QPVFSVQYHPE 370 L GL + G D V VQ+HPE Sbjct: 136 KR--LADGLRVEA-----RAPDGVIEAIESPDRPFVLGVQWHPE 172 >gnl|CDD|32254 COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only]. Length = 243 Score = 49.9 bits (119), Expect = 1e-06 Identities = 39/151 (25%), Positives = 58/151 (38%), Gaps = 25/151 (16%) Query: 265 YSSPIICKLVDSGMPMFGICLGHQLLGLALGA---QTVKMYQGH---------HGVNHPV 312 + +I ++ G+P+ GIC G QLL +ALG Q + GH H +H V Sbjct: 95 FELALIRAALERGIPILGICRGLQLLNVALGGTLYQDISEQPGHIDHRQPNPVHIESHEV 154 Query: 313 K--------NISNGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQP-VF 363 I + +V+ H AI L GL + D + + + V Sbjct: 155 HIEPGSKLAKILGESEFMVNSFHHQAIKK--LAPGLVVEARAP-DGTVEAVEVKNDAFVL 211 Query: 364 SVQYHPESSPGPQD-SYYLFSTFIDFMHKRK 393 VQ+HPE S LF F++ K Sbjct: 212 GVQWHPEYLVDTNPLSLALFEAFVNACKKHA 242 >gnl|CDD|153219 cd01748, GATase1_IGP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS). Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS). IGPS incorporates ammonia derived from glutamine into N1-[(5'-phosphoribulosyl)-formimino]-5-aminoimidazole-4- carboxamide ribonucleotide (PRFAR) to form 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR) and imidazole glycerol phosphate (IGP). The glutamine amidotransferase domain generates the ammonia nucleophile which is channeled from the glutaminase active site to the PRFAR active site. IGPS belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 198 Score = 46.0 bits (110), Expect = 2e-05 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 19/93 (20%) Query: 208 VVCIDYG---IRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPG----DPA 260 + IDYG +RS + L LG + I ++I+S D ++L PG A Sbjct: 1 IAIIDYGMGNLRS-VANALERLGAEVIITSDP---EEILSA--DKLIL---PGVGAFGDA 51 Query: 261 VTSVYSSPI---ICKLVDSGMPMFGICLGHQLL 290 + ++ + + + + SG P GICLG QLL Sbjct: 52 MANLRERGLIEALKEAIASGKPFLGICLGMQLL 84 >gnl|CDD|30467 COG0118, HisH, Glutamine amidotransferase [Amino acid transport and metabolism]. Length = 204 Score = 38.6 bits (90), Expect = 0.003 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 19/94 (20%) Query: 208 VVCIDYG---IRSNLLRVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSV 264 V IDYG +RS + + L LG + + ++I L+ D ++L PG A + Sbjct: 4 VAIIDYGSGNLRS-VKKALERLGAEVVVSR---DPEEI--LKADKLIL---PGVGAFGAA 54 Query: 265 YSS-------PIICKLVDSGMPMFGICLGHQLLG 291 ++ I + V+SG P GICLG QLL Sbjct: 55 MANLRERGLIEAIKEAVESGKPFLGICLGMQLLF 88 >gnl|CDD|153218 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. gamma-Glutamyl Hydrolase catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. GATase activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate. gamma-Glutamyl hydrolases belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 273 Score = 38.5 bits (90), Expect = 0.003 Identities = 42/198 (21%), Positives = 66/198 (33%), Gaps = 57/198 (28%) Query: 223 LSSLGCRIT--IVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYS--SPIICKLV---- 274 L S G R+ + Y D + +G+L G D TS Y+ + II L Sbjct: 29 LESAGARVVPIWINESEEYYDKLFKSINGILFPGGAVD-IDTSGYARTAKIIYNLALERN 87 Query: 275 DSG--MPMFGICLGHQLLG-LALGAQTVKMYQGHHGVNHPVKNISN-------------- 317 D+G P++G CLG +LL L G + P+ + Sbjct: 88 DAGDYFPVWGTCLGFELLTYLTSGETLLLEATEATNSALPLNFTEDALQSRLFKRFPPDL 147 Query: 318 ----GTVEIVSMNHGFAIDASSL------------------PAGLEETHISLFDSSNCGF 355 T + NH + I + G+E IS ++ Sbjct: 148 LKSLATEPLTMNNHRYGISPENFTENGLLSDFFNVLTTNDDWNGVE--FISTVEA----- 200 Query: 356 RLIDQPVFSVQYHPESSP 373 P++ VQ+HPE + Sbjct: 201 --YKYPIYGVQWHPEKNA 216 >gnl|CDD|38389 KOG3179, KOG3179, KOG3179, Predicted glutamine synthetase [Nucleotide transport and metabolism]. Length = 245 Score = 33.8 bits (77), Expect = 0.098 Identities = 24/116 (20%), Positives = 40/116 (34%), Gaps = 21/116 (18%) Query: 269 IICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHH---GVNHPVKNISNG------- 318 + KL + GIC GHQ++ A G + + +G G VK+ Sbjct: 85 FVKKLDFMKKKVLGICFGHQIIARAKGGKVGRAPKGPDLGLGSITIVKDAEKPEKYFGEI 144 Query: 319 --TVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQP--VFSVQYHPE 370 ++ I+ + ++ L E L S C + + Q HPE Sbjct: 145 PKSLNIIKCHQDEVLE-------LPEGAELLASSEKCEVEMFSIEDHLLCFQGHPE 193 >gnl|CDD|163621 cd07378, MPP_ACP5, Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain. Acid phosphatase 5 (ACP5) removes the mannose 6-phosphate recognition marker from lysosomal proteins. The exact site of dephosphorylation is not clear. Evidence suggests dephosphorylation may take place in a prelysosomal compartment as well as in the lysosome. ACP5 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 277 Score = 31.5 bits (72), Expect = 0.46 Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Query: 185 WSEKIWKWGEETSFLKSSDAKYHVVCIDYGIRSN 218 +E+ W E+T L +S A + +V + I S+ Sbjct: 149 LAEEQLAWLEKT--LAASTADWKIVVGHHPIYSS 180 >gnl|CDD|35320 KOG0097, KOG0097, KOG0097, GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]. Length = 215 Score = 31.2 bits (70), Expect = 0.56 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 13/56 (23%) Query: 77 EDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRALT 132 E F +++R ++GA G ++ +IT S Y H +WL D R LT Sbjct: 71 ERFRAVTRSYYRGAAGALMVYDITRRSTYN---HLSSWLT----------DARNLT 113 >gnl|CDD|146348 pfam03663, Glyco_hydro_76, Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases. Length = 367 Score = 30.0 bits (68), Expect = 1.0 Identities = 10/39 (25%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Query: 170 GAELAKHVTVSQRRDWSEKIWKWGEETSFLKSSDAKYHV 208 A LA++ +W+EK+W W + + + D + V Sbjct: 163 AARLARYTGNDTYLEWAEKVWDWSVDVGLIDTDD--WLV 199 >gnl|CDD|32416 COG2235, ArcA, Arginine deiminase [Amino acid transport and metabolism]. Length = 409 Score = 30.2 bits (68), Expect = 1.1 Identities = 36/167 (21%), Positives = 62/167 (37%), Gaps = 23/167 (13%) Query: 79 FESISRKNFKGAVGL--VIKAEITEPSNYRANMHFDAWLKSCG----IIGLSGIDTRALT 132 E++++ FK VG VI EI RA MH D + ++ L Sbjct: 241 VEALAKLLFKDDVGFKRVIAIEI---PKNRAFMHLDTVFTMVDRDKFTVHPEVLEAGTLE 297 Query: 133 VWIRDYGVSNSVIAHHPDGQFDLEDLKERAKNWSGLKGAELAKHVTVSQRRDWSEKIWKW 192 V+ G + +E+L + + + G + + + + + +W Sbjct: 298 VYSLTPG---------GNKLIIIEELGDLLEYLAEALGIDKVRLIETGGGDVIAAEREQW 348 Query: 193 GEETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCR-ITIVGAETS 238 + T+ L + VV D I +N L L G + ITI G+E Sbjct: 349 DDGTNTLTIAPGV--VVAYDRNIYTNNL--LREAGIKVITIPGSELG 391 >gnl|CDD|153221 cd01750, GATase1_CobQ, Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ). Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ). CobQ plays a role in cobalamin biosythesis. CobQ catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin. CobQ belongs to the triad family of amidotransferases. Two of the three residues of the catalytic triad that are involved in glutamine binding, hydrolysis and transfer of the resulting ammonia to the acceptor substrate in other triad aminodotransferases are conserved in CobQ. Length = 194 Score = 29.9 bits (68), Expect = 1.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 272 KLVDSGMPMFGICLGHQLLG 291 +G P+ GIC G+Q+LG Sbjct: 67 NYARAGGPVLGICGGYQMLG 86 >gnl|CDD|36918 KOG1706, KOG1706, KOG1706, Argininosuccinate synthase [Amino acid transport and metabolism]. Length = 412 Score = 30.0 bits (67), Expect = 1.3 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 11/80 (13%) Query: 115 LKSCGIIGLSGIDTRALTVWIRDYGVSNSVIAHHPD-GQF-DLEDLKERAKNWSGLKGAE 172 KS + G+DT + W+++ G VIA+ + GQ D E+ +++A SG K Sbjct: 5 KKSVVLAYSGGLDTSCILAWLKEQGY--EVIAYLANVGQKEDFEEARKKALK-SGAK--- 58 Query: 173 LAKHVTVSQRRDWSEK-IWK 191 K V R ++ E IW Sbjct: 59 --KVVVEDVREEFVEDFIWP 76 >gnl|CDD|133269 cd01866, Rab2, Rab2 subfamily. Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 168 Score = 29.7 bits (67), Expect = 1.4 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Query: 76 SEDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSC 118 E F SI+R ++GA G ++ +IT + H +WL+ Sbjct: 63 QESFRSITRSYYRGAAGALLVYDITRRETFN---HLTSWLEDA 102 >gnl|CDD|35842 KOG0623, KOG0623, KOG0623, Glutamine amidotransferase/cyclase [Amino acid transport and metabolism]. Length = 541 Score = 29.6 bits (66), Expect = 1.7 Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 270 ICKLVDSGMPMFGICLGHQLL 290 + K ++SG P GIC+G Q L Sbjct: 67 LRKYIESGKPFMGICVGLQAL 87 >gnl|CDD|133630 CHL00188, hisH, imidazole glycerol phosphate synthase subunit hisH; Provisional. Length = 210 Score = 29.1 bits (65), Expect = 2.3 Identities = 34/121 (28%), Positives = 49/121 (40%), Gaps = 26/121 (21%) Query: 211 IDYGIRSNLLRV---LSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSS 267 IDY + NL V + G + I+ +E+ + +L GV G D A+ + Sbjct: 7 IDYSM-GNLHSVSRAIQQAGQQPCIINSESELAQVHALVLPGV----GSFDLAMKKLEKK 61 Query: 268 PI---ICKLVDSGMPMFGICLGHQLL----------GLALGAQTVKMYQGHHGVNHPVKN 314 + I K + G P GICLG LL GL + VK + + PVK Sbjct: 62 GLITPIKKWIAEGNPFIGICLGLHLLFETSEEGKEEGLGIYKGQVKRLK-----HSPVKV 116 Query: 315 I 315 I Sbjct: 117 I 117 >gnl|CDD|133322 cd04122, Rab14, Rab14 subfamily. Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles. Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments. Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation. In addition, Rab14 is believed to play a role in the regulation of phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 166 Score = 29.0 bits (65), Expect = 2.3 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 13/56 (23%) Query: 77 EDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLKSCGIIGLSGIDTRALT 132 E F +++R ++GA G ++ +IT S Y H +WL D R LT Sbjct: 62 ERFRAVTRSYYRGAAGALMVYDITRRSTYN---HLSSWLT----------DARNLT 104 >gnl|CDD|133313 cd04113, Rab4, Rab4 subfamily. Rab4 has been implicated in numerous functions within the cell. It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A. Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane. It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 161 Score = 28.8 bits (65), Expect = 2.9 Identities = 10/31 (32%), Positives = 20/31 (64%) Query: 77 EDFESISRKNFKGAVGLVIKAEITEPSNYRA 107 E F S++R ++GA G ++ +IT +++ A Sbjct: 60 ERFRSVTRSYYRGAAGALLVYDITNRTSFEA 90 >gnl|CDD|30850 COG0504, PyrG, CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]. Length = 533 Score = 28.5 bits (64), Expect = 3.1 Identities = 30/152 (19%), Positives = 51/152 (33%), Gaps = 42/152 (27%) Query: 277 GMPMFGICLGHQLLGLALGAQTVKMYQGHHG-----VNHPVKNISNGTVEIVSM------ 325 +P GICLG QL + + + + +PV ++ ++V + Sbjct: 372 NIPFLGICLGMQLAVIEFARNVLGLEGANSTEFDPDTKYPVVDLMPEQKDVVDLGGTMRL 431 Query: 326 -NHGFAIDASSLPAGL------EETHISLFDSSN--------CGFR-------------- 356 + + +L A L E H ++ +N G Sbjct: 432 GAYPCRLKPGTLAAKLYGKDEIYERHRHRYEVNNDYRDQLEKAGLVFSGTSPDGGLVEIV 491 Query: 357 -LIDQPVF-SVQYHPESSPGPQDSYYLFSTFI 386 L D P F + Q+HPE P + LF F+ Sbjct: 492 ELPDHPFFVATQFHPEFKSRPLRPHPLFVGFV 523 >gnl|CDD|146223 pfam03468, XS, XS domain. The XS (rice gene X and SGS3) domain is found in a family of plant proteins including gene X and SGS3. SGS3 is thought to be involved in post-transcriptional gene silencing (PTGS). This domain contains a conserved aspartate residue that may be functionally important. The XS domain has recently been predicted to possess an RRM-like RNA-binding domain by fold recognition. Length = 118 Score = 28.5 bits (64), Expect = 3.2 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Query: 162 AKNWSGLKGA-ELAKHVTVSQ--RRDW 185 AK+WSG K A KH ++DW Sbjct: 66 AKDWSGFKNALAFEKHFEKDGHGKKDW 92 >gnl|CDD|133307 cd04107, Rab32_Rab38, Rab38/Rab32 subfamily. Rab32 and Rab38 are members of the Rab family of small GTPases. Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Length = 201 Score = 28.0 bits (63), Expect = 4.2 Identities = 12/31 (38%), Positives = 20/31 (64%) Query: 77 EDFESISRKNFKGAVGLVIKAEITEPSNYRA 107 E F ++R ++GAVG +I ++T PS + A Sbjct: 61 ERFGGMTRVYYRGAVGAIIVFDVTRPSTFEA 91 >gnl|CDD|37598 KOG2387, KOG2387, KOG2387, CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]. Length = 585 Score = 27.9 bits (62), Expect = 4.7 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Query: 248 DGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMFGICLGHQL 289 DG+L+ G GD V + + ++ +P GICLG QL Sbjct: 365 DGILVPGGFGDRGVEGKILAAKWAR--ENKIPFLGICLGMQL 404 >gnl|CDD|112781 pfam03982, DAGAT, Diacylglycerol acyltransferase. The terminal step of triacylglycerol (TAG) formation is catalysed by the enzyme diacylglycerol acyltransferase (DAGAT). Length = 297 Score = 28.2 bits (63), Expect = 4.8 Identities = 19/72 (26%), Positives = 31/72 (43%), Gaps = 10/72 (13%) Query: 34 SIQAEICFNTSLTGYQEILTD-PSYLGQIV-NFTFP-------HIGNVGVNSEDFESISR 84 S+ A F+T+ TG+ + + + F P +G + V+ E E + Sbjct: 76 SVGAFSNFSTNATGFMDKFPGIRPNICTLAGQFYTPFRREILLSLGLIEVSRESIEYVLD 135 Query: 85 KNFKG-AVGLVI 95 K KG AV LV+ Sbjct: 136 KCGKGRAVVLVV 147 >gnl|CDD|34648 COG5043, MRS6, Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion]. Length = 2552 Score = 27.7 bits (61), Expect = 6.0 Identities = 14/77 (18%), Positives = 24/77 (31%), Gaps = 2/77 (2%) Query: 262 TSVYSSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVNHPVK--NISNGT 319 T+V I +L C+ L + G +K K +I N Sbjct: 2413 TTVLDYHDIPRLRLPRYVWDDGCVAPYDLRESQGQYWLKTLDAGKYPLDEYKFHDIINNV 2472 Query: 320 VEIVSMNHGFAIDASSL 336 I+S + + + L Sbjct: 2473 AVIISRDIHAIVTSKIL 2489 >gnl|CDD|35309 KOG0086, KOG0086, KOG0086, GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]. Length = 214 Score = 27.7 bits (61), Expect = 6.3 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Query: 77 EDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWL 115 E F S++R ++GA G ++ +IT ++ A WL Sbjct: 69 ERFRSVTRSYYRGAAGALLVYDITSRDSFNA---LTNWL 104 >gnl|CDD|30949 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]. Length = 326 Score = 27.7 bits (61), Expect = 6.4 Identities = 16/84 (19%), Positives = 32/84 (38%), Gaps = 3/84 (3%) Query: 194 EETSFLKSSDAKYHVVCIDYGIRSNLLRVLSSLGCRITI--VGAETSYKDIMSLQPDGVL 251 E+ LK A + + + + + G + + VG +T + +L P G L Sbjct: 178 EKLELLKELGADHVINYREEDFVEQVRELTGGKGVDVVLDTVGGDTFAASLAALAPGGRL 237 Query: 252 LSNG-PGDPAVTSVYSSPIICKLV 274 +S G + P++ K + Sbjct: 238 VSIGALSGGPPVPLNLLPLLGKRL 261 >gnl|CDD|33246 COG3442, COG3442, Predicted glutamine amidotransferase [General function prediction only]. Length = 250 Score = 27.6 bits (61), Expect = 6.6 Identities = 9/18 (50%), Positives = 14/18 (77%) Query: 274 VDSGMPMFGICLGHQLLG 291 +++G P+ IC G+QLLG Sbjct: 84 IENGKPVLAICGGYQLLG 101 >gnl|CDD|33564 COG3769, COG3769, Predicted hydrolase (HAD superfamily) [General function prediction only]. Length = 274 Score = 27.3 bits (60), Expect = 7.8 Identities = 9/37 (24%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Query: 159 KERAKNWSGLKGAELAKHVTVSQRRDWSEKIWKWGEE 195 E W+GL + A ++ R++SE I + Sbjct: 127 DEEIAEWTGLPREQAA----LAMLREYSETIIWRSSD 159 >gnl|CDD|144346 pfam00708, Acylphosphatase, Acylphosphatase. Length = 90 Score = 27.2 bits (61), Expect = 8.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 306 HGVNHPVKNISNGTVEIV 323 G+ V+N+ +GTVEIV Sbjct: 29 LGLKGYVRNLPDGTVEIV 46 >gnl|CDD|144950 pfam01546, Peptidase_M20, Peptidase family M20/M25/M40. This family includes a range of zinc metallopeptidases belonging to several families in the peptidase classification. Family M20 are Glutamate carboxypeptidases. Peptidase family M25 contains X-His dipeptidases. Length = 310 Score = 27.1 bits (60), Expect = 8.9 Identities = 10/26 (38%), Positives = 17/26 (65%) Query: 138 YGVSNSVIAHHPDGQFDLEDLKERAK 163 +G + +AH P+ DL+DL++ AK Sbjct: 277 FGPGDGALAHSPNEYVDLDDLEKGAK 302 >gnl|CDD|35314 KOG0091, KOG0091, KOG0091, GTPase Rab39, small G protein superfamily [General function prediction only]. Length = 213 Score = 26.9 bits (59), Expect = 9.8 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Query: 77 EDFESISRKNFKGAVGLVIKAEITEPSNYRANMHFDAWLK 116 E F SI++ ++ +VG+++ +IT N + H + W+K Sbjct: 69 ERFRSITKSYYRNSVGVLLVYDIT---NRESFEHVENWVK 105 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.136 0.417 Gapped Lambda K H 0.267 0.0672 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,886,595 Number of extensions: 257434 Number of successful extensions: 660 Number of sequences better than 10.0: 1 Number of HSP's gapped: 620 Number of HSP's successfully gapped: 54 Length of query: 396 Length of database: 6,263,737 Length adjustment: 96 Effective length of query: 300 Effective length of database: 4,189,273 Effective search space: 1256781900 Effective search space used: 1256781900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 58 (26.2 bits)