HHsearch alignment for GI: 254780421 and conserved domain: COG3118

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones].
Probab=97.53  E-value=0.0064  Score=36.47  Aligned_cols=155  Identities=16%  Similarity=0.156  Sum_probs=117.4

Q ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             99999999999841387666999999973125520699999999999951100577899999987312689578999999
Q gi|254780421|r   52 IVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL  131 (218)
Q Consensus        52 ~as~~y~~al~~~~~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l  131 (218)
T Consensus       133 ~~e~~~~~~~~~~~~e~~~~a~~~~~~al~~~~~~--~~~~~~la~~~l~~g~~e~A~~iL~~lP~~~~~~~~~~l~a~i  210 (304)
T COG3118         133 EEEEALAEAKELIEAEDFGEAAPLLKQALQAAPEN--SEAKLLLAECLLAAGDVEAAQAILAALPLQAQDKAAHGLQAQI  210 (304)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC--CHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             77888987666541654455899999999858456--6377789999998188589999997285001045788899999


Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH--CCCCCHHHHHHHHHHHHHH
Q ss_conf             99996302699899999975311464235689999999999988998999999999983--5589989999999999950
Q gi|254780421|r  132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK--DNNSPFGISTRSQMILANI  209 (218)
Q Consensus       132 ~la~~~~~~~~~d~a~~~l~~~~~~~~~~~~~a~ellg~~~~~~Gd~~~A~~~y~~i~~--~~~~p~~~r~ra~~~l~~l  209 (218)
T Consensus       211 ~ll~qaa~~~~~~~l~~~~aa--dPd---d~~aa~~lA~~~~~~g~~e~Ale~Ll~~l~~d~~~~d~~~Rk~lle~f~~~  285 (304)
T COG3118         211 ELLEQAAATPEIQDLQRRLAA--DPD---DVEAALALADQLHLVGRNEAALEHLLALLRRDRGFEDGEARKTLLELFEAF  285 (304)
T ss_pred             HHHHHHHCCCCHHHHHHHHHH--CCC---CHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHC
T ss_conf             999997459977899999870--999---889999999999973887999999999987503443768999999999963


Q ss_pred             CCCH
Q ss_conf             0340
Q gi|254780421|r  210 IASD  213 (218)
Q Consensus       210 ~~~~  213 (218)
T Consensus       286 g~~D  289 (304)
T COG3118         286 GPAD  289 (304)
T ss_pred             CCCC
T ss_conf             8898