HHsearch alignment for GI: 254780421 and conserved domain: COG4105

>COG4105 ComL DNA uptake lipoprotein [General function prediction only].
Probab=98.57  E-value=2.3e-05  Score=51.63  Aligned_cols=166  Identities=14%  Similarity=0.083  Sum_probs=117.0

Q ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCC-CCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             99999999999998413876669999999731255-20699999999999951100577899999987312689578999
Q gi|254780421|r   50 KNIVGENFAQALELFNSNKLDDARSSFEKILSQDN-KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA  128 (218)
Q Consensus        50 ~~~as~~y~~al~~~~~~~~~~A~~~l~~l~~~~~-~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~l  128 (218)
T Consensus        31 ~~p~~~LY~~g~~~L~~gn~~~A~~~fe~l~~~~p~~~~~~qa~l~l~yA~Yk~~~y~~A~~~~drFi~lyP~~~n-~dY  109 (254)
T COG4105          31 NLPASELYNEGLTELQKGNYEEAIKYFEALDSRHPFSPYSEQAQLDLAYAYYKNGEYDLALAYIDRFIRLYPTHPN-ADY  109 (254)
T ss_pred             CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCC-HHH
T ss_conf             7889999999999986378899999999998709998112899999999988135589999999999987899987-169


Q ss_pred             HHHHHHHHHHCCCC-----HH---HHHHHHHHHCC--CCCHHHHHHHH--------------HHHHHHHHCCCHHHHHHH
Q ss_conf             99999996302699-----89---99999753114--64235689999--------------999999988998999999
Q gi|254780421|r  129 ATLQAASILVDTSS-----YE---EISKILQKLSE--PSNPMHQFANE--------------ILGISALKFGKVQKAKTI  184 (218)
Q Consensus       129 A~l~la~~~~~~~~-----~d---~a~~~l~~~~~--~~~~~~~~a~e--------------llg~~~~~~Gd~~~A~~~  184 (218)
T Consensus       110 ~~YlkgLs~~~~i~~~~rDq~~~~~A~~~f~~~i~ryPnS~Ya~dA~~~i~~~~d~LA~~Em~IaryY~kr~~~~AA~nR  189 (254)
T COG4105         110 AYYLKGLSYFFQIDDVTRDQSAARAAFAAFKELVQRYPNSRYAPDAKARIVKLNDALAGHEMAIARYYLKRGAYVAAINR  189 (254)
T ss_pred             HHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             99999998752677544477999999999999998788970235599999999999889999999999990576999999


Q ss_pred             HHHHHHCCCCCHHHHH---HHHHHHHHHCCCHHHH
Q ss_conf             9999835589989999---9999999500340320
Q gi|254780421|r  185 FEELAKDNNSPFGIST---RSQMILANIIASDQRN  216 (218)
Q Consensus       185 y~~i~~~~~~p~~~r~---ra~~~l~~l~~~~~~~  216 (218)
T Consensus       190 ~~~v~e~y~~t~~~~eaL~~l~eaY~~lgl~~~a~  224 (254)
T COG4105         190 FEEVLENYPDTSAVREALARLEEAYYALGLTDEAK  224 (254)
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHH
T ss_conf             99998714555204778999999999828727899