HHsearch alignment for GI: 254780421 and conserved domain: COG4105

>COG4105 ComL DNA uptake lipoprotein [General function prediction only].
Probab=95.45  E-value=0.17  Score=27.59  Aligned_cols=123  Identities=11%  Similarity=0.053  Sum_probs=66.2

Q ss_pred             HHCCCHHHHHHHHHHHHHCCC-CCHHHHHHHHHHHHHH--------HCCHHHHHHHHHHHHHHHCCCCHHHHHHHHH---
Q ss_conf             413876669999999731255-2069999999999995--------1100577899999987312689578999999---
Q gi|254780421|r   64 FNSNKLDDARSSFEKILSQDN-KLYNPLSNMYIASILV--------AKGDTKNAAEIFLKVANDDLAPLAVRYAATL---  131 (218)
Q Consensus        64 ~~~~~~~~A~~~l~~l~~~~~-~~ya~lA~l~lA~~~~--------~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l---  131 (218)
T Consensus        82 Yk~~~y~~A~~~~drFi~lyP~~~n~dY~~YlkgLs~~~~i~~~~rDq~~~~~A~~~f~~~i~ryP-nS~Ya~dA~~~i~  160 (254)
T COG4105          82 YKNGEYDLALAYIDRFIRLYPTHPNADYAYYLKGLSYFFQIDDVTRDQSAARAAFAAFKELVQRYP-NSRYAPDAKARIV  160 (254)
T ss_pred             HHCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCC-CCCCHHHHHHHHH
T ss_conf             813558999999999998789998716999999998752677544477999999999999998788-9702355999999


Q ss_pred             -----------HHHHHHHCCCCHHHHHHHHHHHCCC--CCHHHHHHHHHHHHHHHHCCCHHHHHHHHHH
Q ss_conf             -----------9999630269989999997531146--4235689999999999988998999999999
Q gi|254780421|r  132 -----------QAASILVDTSSYEEISKILQKLSEP--SNPMHQFANEILGISALKFGKVQKAKTIFEE  187 (218)
Q Consensus       132 -----------~la~~~~~~~~~d~a~~~l~~~~~~--~~~~~~~a~ellg~~~~~~Gd~~~A~~~y~~  187 (218)
T Consensus       161 ~~~d~LA~~Em~IaryY~kr~~~~AA~nR~~~v~e~y~~t~~~~eaL~~l~eaY~~lgl~~~a~~~~~v  229 (254)
T COG4105         161 KLNDALAGHEMAIARYYLKRGAYVAAINRFEEVLENYPDTSAVREALARLEEAYYALGLTDEAKKTAKV  229 (254)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             999998899999999999905769999999999871455520477899999999982872789999999