HHsearch alignment for GI: 254780421 and conserved domain: COG5010

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion].
Probab=96.24  E-value=0.081  Score=29.65  Aligned_cols=133  Identities=15%  Similarity=0.121  Sum_probs=85.7

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             38766699999997312552069999999999995110057789999998731268957899999999996302699899
Q gi|254780421|r   66 SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE  145 (218)
Q Consensus        66 ~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l~la~~~~~~~~~d~  145 (218)
T Consensus        79 ~G~a~~~l~~~~~~~~~~~~d~~ll~~--~gk~~~~~g~~~~A~~~~rkA~~l~p~d~--~--~~~~lgaaldq~Gr~~~  152 (257)
T COG5010          79 RGDADSSLAVLQKSAIAYPKDRELLAA--QGKNQIRNGNFGEAVSVLRKAARLAPTDW--E--AWNLLGAALDQLGRFDE  152 (257)
T ss_pred             CCCCCCHHHHHHHHHCCCCCCHHHHHH--HHHHHHHHCCHHHHHHHHHHHHCCCCCCH--H--HHHHHHHHHHHCCCHHH
T ss_conf             055550078875540147454999999--99999980456889999999843699974--6--66677899997367567


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             999975311464235689999999999988998999999999983558998999999999
Q gi|254780421|r  146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI  205 (218)
Q Consensus       146 a~~~l~~~~~~~~~~~~~a~ellg~~~~~~Gd~~~A~~~y~~i~~~~~~p~~~r~ra~~~  205 (218)
T Consensus       153 Ar~ay~qAl~L-~~~~p~~~nNlgms~~L~gd~~~A~~lll~a~l~~~ad~~v~~NLAl~  211 (257)
T COG5010         153 ARRAYRQALEL-APNEPSIANNLGMSLLLRGDLEDAETLLLPAYLSPAADSRVRQNLALV  211 (257)
T ss_pred             HHHHHHHHHHH-CCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             78999999984-258844666589999972779899999999986788763899989999