HHsearch alignment for GI: 254780421 and conserved domain: KOG1125

>KOG1125 consensus.
Probab=96.42  E-value=0.064  Score=30.29  Aligned_cols=143  Identities=11%  Similarity=0.095  Sum_probs=78.1

Q ss_pred             HHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCC--------------------
Q ss_conf             984138766699999997312552069999999999995110057789999998731268--------------------
Q gi|254780421|r   62 ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA--------------------  121 (218)
Q Consensus        62 ~~~~~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~--------------------  121 (218)
T Consensus       328 ~qaENE~E~~ai~AL~rcl~LdP~Nl--eaLmaLAVSytNeg~q~~Al~~L~~Wi~~~p~y~~l~~a~~~~~~~~~~s~~  405 (579)
T KOG1125         328 TQAENENEQNAISALRRCLELDPTNL--EALMALAVSYTNEGLQNQALKMLDKWIRNKPKYVHLVSAGENEDFENTKSFL  405 (579)
T ss_pred             HHHHCCCHHHHHHHHHHHHHCCCCCH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHCCCCCCCCCCCCCCCCC
T ss_conf             76503420889999999984699519--9999988888614668889999999998486211114667665666776778


Q ss_pred             -CHHHHHHHHH------------------HHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCHHHHH
Q ss_conf             -9578999999------------------999963026998999999753114642356899999999999889989999
Q gi|254780421|r  122 -PLAVRYAATL------------------QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK  182 (218)
Q Consensus       122 -~~~~~~lA~l------------------~la~~~~~~~~~d~a~~~l~~~~~~~~~~~~~a~ellg~~~~~~Gd~~~A~  182 (218)
T Consensus       406 ~~~~l~~i~~~fLeaa~~~~~~~DpdvQ~~LGVLy~ls~efdraiDcf~~AL~v~-Pnd~~lWNRLGAtLAN~~~s~EAI  484 (579)
T KOG1125         406 DSSHLAHIQELFLEAARQLPTKIDPDVQSGLGVLYNLSGEFDRAVDCFEAALQVK-PNDYLLWNRLGATLANGNRSEEAI  484 (579)
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHCCCCCCHHHH
T ss_conf             8789999999999999857788884277626789740147888999999997049-841778988668860775539999


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHH
Q ss_conf             999999835589989999999999950
Q gi|254780421|r  183 TIFEELAKDNNSPFGISTRSQMILANI  209 (218)
Q Consensus       183 ~~y~~i~~~~~~p~~~r~ra~~~l~~l  209 (218)
T Consensus       485 sAY~rALqLq--P~yVR~RyNlgIS~m  509 (579)
T KOG1125         485 SAYNRALQLQ--PGYVRVRYNLGISCM  509 (579)
T ss_pred             HHHHHHHHCC--CCEEEEEHHHHHHHH
T ss_conf             9999998418--872653010145662