HHsearch alignment for GI: 254780421 and conserved domain: KOG1129

>KOG1129 consensus.
Probab=95.23  E-value=0.2  Score=27.17  Aligned_cols=52  Identities=13%  Similarity=-0.050  Sum_probs=30.1

Q ss_pred             CCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCC
Q ss_conf             876669999999731255206999999999999511005778999999873126
Q gi|254780421|r   67 NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL  120 (218)
Q Consensus        67 ~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~  120 (218)
T Consensus       270 dQP~~AL~~~~~gld~fP~~VT--~l~g~ARi~eam~~~~~a~~lYk~vlk~~~  321 (478)
T KOG1129         270 DQPERALLVIGEGLDSFPFDVT--YLLGQARIHEAMEQQEDALQLYKLVLKLHP  321 (478)
T ss_pred             CCHHHHHHHHHHHHHCCCCHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             3588999998646523883256--666369999999707889999999984087