HHsearch alignment for GI: 254780421 and conserved domain: KOG2376

>KOG2376 consensus.
Probab=97.07  E-value=0.021  Score=33.26  Aligned_cols=45  Identities=16%  Similarity=0.173  Sum_probs=22.2

Q ss_pred             CHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             7666999999973125520699999999999951100577899999
Q gi|254780421|r   68 KLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL  113 (218)
Q Consensus        68 ~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~  113 (218)
T Consensus       356 ~~~ka~e~L~~~~~~~p~~-s~~v~L~~aQl~is~gn~~~A~~il~  400 (652)
T KOG2376         356 KHKKAIELLLQFADGHPEK-SKVVLLLRAQLKISQGNPEVALEILS  400 (652)
T ss_pred             HHHHHHHHHHHHHCCCCCH-HHHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             8764499999874158730-39999999999986589889999998