HHsearch alignment for GI: 254780421 and conserved domain: KOG4626

>KOG4626 consensus.
Probab=97.83  E-value=0.0013  Score=40.73  Aligned_cols=120  Identities=19%  Similarity=0.174  Sum_probs=79.2

Q ss_pred             HCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             13876669999999731255206999999999999511005778999999873126895789999999999630269989
Q gi|254780421|r   65 NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE  144 (218)
Q Consensus        65 ~~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l~la~~~~~~~~~d  144 (218)
T Consensus       298 eqG~ldlAI~~Ykral~~~P~F--~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~p---~had-am~NLgni~~E~~~~e  371 (966)
T KOG4626         298 EQGLLDLAIDTYKRALELQPNF--PDAYNNLANALKDKGSVTEAVDCYNKALRLCP---NHAD-AMNNLGNIYREQGKIE  371 (966)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCC--HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCC---CCHH-HHHHHHHHHHHHCCCH
T ss_conf             1442788899999987039995--67775799997750546799999999987587---6377-8887989998861221


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHC
Q ss_conf             99999753114642356899999999999889989999999999835
Q gi|254780421|r  145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD  191 (218)
Q Consensus       145 ~a~~~l~~~~~~~~~~~~~a~ellg~~~~~~Gd~~~A~~~y~~i~~~  191 (218)
T Consensus       372 ~A~~ly~~al~v-~p~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI  417 (966)
T KOG4626         372 EATRLYLKALEV-FPEFAAAHNNLASIYKQQGNLDDAIMCYKEALRI  417 (966)
T ss_pred             HHHHHHHHHHHH-CHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHC
T ss_conf             889999999863-8024556422999999605477899999988714