HHsearch alignment for GI: 254780421 and conserved domain: PRK10049

>PRK10049 pgaA outer membrane protein PgaA; Provisional.
Probab=97.91  E-value=0.0011  Score=41.21  Aligned_cols=137  Identities=15%  Similarity=0.141  Sum_probs=95.2

Q ss_pred             HHHHHCCCHHHHHHHHHHHHHCCC--CCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHH-HHHHHHHHHHHHH
Q ss_conf             998413876669999999731255--2069999999999995110057789999998731268957-8999999999963
Q gi|254780421|r   61 LELFNSNKLDDARSSFEKILSQDN--KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA-VRYAATLQAASIL  137 (218)
Q Consensus        61 l~~~~~~~~~~A~~~l~~l~~~~~--~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~-~~~lA~l~la~~~  137 (218)
T Consensus       297 ~aL~~r~r~~~vi~eYq~L~a~~~~~P~Ya~~a---vadayL~~~qP~kA~~iy~~l~~~~~~~~~~~~~e~~~~LfYA~  373 (818)
T PRK10049        297 GALLVRDRYADVISEYQRLKAEGQKIPDYARRW---VASAYLDRRQPEKAAPILTELFYHPETIAPDLSDEELADLFYSL  373 (818)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHH---HHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHH
T ss_conf             999987659999999999974689885799999---99999863996899999999973485457653567887789998


Q ss_pred             HCCCCHHHHHHHHHHHCCCCCHH--------------HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             02699899999975311464235--------------6899999999999889989999999999835589989999
Q gi|254780421|r  138 VDTSSYEEISKILQKLSEPSNPM--------------HQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST  200 (218)
Q Consensus       138 ~~~~~~d~a~~~l~~~~~~~~~~--------------~~~a~ellg~~~~~~Gd~~~A~~~y~~i~~~~~~p~~~r~  200 (218)
T Consensus       374 ~e~e~~~eA~~l~~~~~~~~p~~~~~~g~~~~~PNddy~~~~~l~a~~~~~~ndL~~Ae~~le~l~~~APgN~~L~~  450 (818)
T PRK10049        374 LESEQYPGALQVAVHTIETTPYFVRLYGLPTSIPNDDWLQGQSLLVQSLKASNDLPQAEKRLEELAYTAPGNQGLRI  450 (818)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             61111899999999865328960430688889888279999999999999757849999999999863999879999