HHsearch alignment for GI: 254780421 and conserved domain: TIGR02917

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein; InterPro: IPR014266 This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system , analogous to the LPXTG/sortase system common in Gram-positive bacteria. The proteins in this entry occur in a species if, and only if, a transmembrane histidine kinase (IPR014265 from INTERPRO) and a DNA-binding response regulator (IPR014264 from INTERPRO) also occur. The present of tetratricopeptide repeats (TPR) suggests they may be involved in protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator..
Probab=99.07  E-value=2.1e-08  Score=70.45  Aligned_cols=149  Identities=14%  Similarity=0.165  Sum_probs=117.5

Q ss_pred             HHHHHHHHHHHHHHCCC---HHHHHHHH--------HHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCC
Q ss_conf             99999999999841387---66699999--------99731255206999999999999511005778999999873126
Q gi|254780421|r   52 IVGENFAQALELFNSNK---LDDARSSF--------EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL  120 (218)
Q Consensus        52 ~as~~y~~al~~~~~~~---~~~A~~~l--------~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~  120 (218)
T Consensus       269 ~p~a~y~kAlv~~q~~~naG~~~A~~~~aqvlDhls~~~l~~~p~~~~--a~~lAG~~~y~lg~~~~A~~yl~~~l~~~P  346 (924)
T TIGR02917       269 SPQAAYLKALVDFQKKNNAGYEDARETLAQVLDHLSQAALKSAPEYLP--ALLLAGASEYQLGNLEQAEQYLNQILKAAP  346 (924)
T ss_pred             CCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             846899999999983357744899999999999999999961877425--999999999996138999999999998668


Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             89578999999999963026998999999753114642356899999999999889989999999999835589989999
Q gi|254780421|r  121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST  200 (218)
Q Consensus       121 ~~~~~~~lA~l~la~~~~~~~~~d~a~~~l~~~~~~~~~~~~~a~ellg~~~~~~Gd~~~A~~~y~~i~~~~~~p~~~r~  200 (218)
T Consensus       347 ~~----~~A~rllA~i~L~~g~~~~A~~~l~~~~~~~~-~d~~~l~~lG~~~L~~g~~~~A~~yl~ka~~~~P~--~a~~  419 (924)
T TIGR02917       347 NS----HQARRLLAAIQLREGRVDEAIATLSPALGLDS-DDSALLSLLGEAYLAKGDFEKAAEYLAKASELDPE--NAAA  419 (924)
T ss_pred             CC----HHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCC-CCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCC--HHHH
T ss_conf             86----68999999999862897899999998861588-77689999999998638967899999876105898--0889


Q ss_pred             HHHHHHHHH
Q ss_conf             999999950
Q gi|254780421|r  201 RSQMILANI  209 (218)
Q Consensus       201 ra~~~l~~l  209 (218)
T Consensus       420 ~t~lG~~~L  428 (924)
T TIGR02917       420 RTKLGISKL  428 (924)
T ss_pred             HHHHHHHHH
T ss_conf             999998862