HHsearch alignment for GI: 254780421 and conserved domain: TIGR03302

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO. Members of this protein family include YfiO, a near-essential protein of the outer membrane, part of a complex involved in protein insertion into the bacterial outer membrane. Many proteins in this family are annotated as ComL, based on the involvement of this protein in natural transformation with exogenous DNA in Neisseria gonorrhoeae. This protein family shows sequence similarity to, but is distinct from, the tol-pal system protein YbgF (TIGR02795).
Probab=98.27  E-value=0.00018  Score=46.15  Aligned_cols=129  Identities=14%  Similarity=0.124  Sum_probs=102.7

Q ss_pred             HHHHHCCCHHHHHHHHHHHHHCCC-CCHHHHHHHHHHHHHHH--------CCHHHHHHHHHHHHHHHCCCCHHHHHHHH-
Q ss_conf             998413876669999999731255-20699999999999951--------10057789999998731268957899999-
Q gi|254780421|r   61 LELFNSNKLDDARSSFEKILSQDN-KLYNPLSNMYIASILVA--------KGDTKNAAEIFLKVANDDLAPLAVRYAAT-  130 (218)
Q Consensus        61 l~~~~~~~~~~A~~~l~~l~~~~~-~~ya~lA~l~lA~~~~~--------~g~~~~A~~~l~~i~~~~~~~~~~~~lA~-  130 (218)
T Consensus        78 ~a~y~~~~y~~A~~~~~~Fi~~yP~~~~~~ya~y~~a~s~~~~~~~~~rDq~~~~~A~~~f~~~i~~yP~S-~ya~dA~~  156 (235)
T TIGR03302        78 YAYYKSGDYAEAIAAADRFIRLHPNHPDADYAYYLRGLSNYKQIDDSDRDQTAAREAFEAFQELIRRYPNS-EYAPDAKK  156 (235)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCC-HHHHHHHH
T ss_conf             99997643999999999999988774349999999879988736654458089999999999999888996-57999999


Q ss_pred             -------------HHHHHHHHCCCCHHHHHHHHHHHCC--CCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             -------------9999963026998999999753114--64235689999999999988998999999999983
Q gi|254780421|r  131 -------------LQAASILVDTSSYEEISKILQKLSE--PSNPMHQFANEILGISALKFGKVQKAKTIFEELAK  190 (218)
Q Consensus       131 -------------l~la~~~~~~~~~d~a~~~l~~~~~--~~~~~~~~a~ellg~~~~~~Gd~~~A~~~y~~i~~  190 (218)
T Consensus       157 ~i~~l~~~LA~~e~~ia~~Y~k~~~y~aAi~r~~~vl~~Yp~t~~~~eAl~~l~eay~~lg~~~~A~~~~~~l~~  231 (235)
T TIGR03302       157 RMDYLRNRLAGKELYVARFYLKRGAYVAAINRFETVVENYPDTPATEEALARLVEAYLALGLTDLAQDAAAVLGA  231 (235)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             999999999999999999999841709999999999986899851399999999999986998999999999975