HHsearch alignment for GI: 254780421 and conserved domain: TIGR03504

>TIGR03504 FimV_Cterm FimV C-terminal domain. This protein is found at the extreme C-terminus of FimV from Pseudomonas aeruginosa, and of TspA of Neisseria meningitidis. Disruption of the former blocks twitching motility from type IV pili; Semmler, et al. suggest a role in peptidoglycan layer remodelling required by type IV fimbrial systems.
Probab=93.65  E-value=0.2  Score=27.19  Aligned_cols=40  Identities=18%  Similarity=0.395  Sum_probs=29.0

Q ss_pred             HHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH
Q ss_conf             999999889989999999999835589989999999999950
Q gi|254780421|r  168 LGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI  209 (218)
Q Consensus       168 lg~~~~~~Gd~~~A~~~y~~i~~~~~~p~~~r~ra~~~l~~l  209 (218)
T Consensus         5 LA~aYiemGD~egAr~lL~EVi~eg--~~~q~~eA~~LL~~l   44 (44)
T TIGR03504         5 LARAYIEMGDLEGARELLEEVIEEG--DEAQRQEARALLAQL   44 (44)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHC--CHHHHHHHHHHHHHC
T ss_conf             9999998298898999999999849--999999999998709