HHsearch alignment for GI: 254780421 and conserved domain: pfam04348

>pfam04348 LppC LppC putative lipoprotein. This family includes several bacterial outer membrane antigens, whose molecular function is unknown.
Probab=96.48  E-value=0.059  Score=30.50  Aligned_cols=101  Identities=11%  Similarity=0.033  Sum_probs=74.2

Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCC--CHHHHHHH
Q ss_conf             9999999999995110057789999998731268957899999999996302699899999975311464--23568999
Q gi|254780421|r   88 NPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS--NPMHQFAN  165 (218)
Q Consensus        88 a~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l~la~~~~~~~~~d~a~~~l~~~~~~~--~~~~~~a~  165 (218)
T Consensus        23 ~~~~~L~Aa~a~i~eg~~~qA~~ll~~l~~-~~L~~~q~~e~~Ll~A~l~~~~~~~~~Al~~L~~~~~~~L~~~q~~r~~  101 (535)
T pfam04348        23 QNTYKLLAARVLIEENKIAQAQALLRELSV-QQLTDEQKLDKSLLEAELAAAKRQNEVALQQLSHQHLSGLSPSQQSRYY  101 (535)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCHHHHHHHH
T ss_conf             999999999999977999999999997404-1199999999999999999975999999998557981107999999999


Q ss_pred             HHHHHHHHHCCCHHHHHHHHHHHH
Q ss_conf             999999998899899999999998
Q gi|254780421|r  166 EILGISALKFGKVQKAKTIFEELA  189 (218)
Q Consensus       166 ellg~~~~~~Gd~~~A~~~y~~i~  189 (218)
T Consensus       102 ~l~A~~~~~~~~~l~a~r~~i~l~  125 (535)
T pfam04348       102 EGRARIAEARGDAIEAAKARIQMD  125 (535)
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             999999997698699999999862