HHsearch alignment for GI: 254780421 and conserved domain: pfam09986

>pfam09986 DUF2225 Uncharacterized protein conserved in bacteria (DUF2225). This domain, found in various hypothetical bacterial proteins, has no known function.
Probab=93.58  E-value=0.48  Score=24.86  Aligned_cols=83  Identities=11%  Similarity=0.119  Sum_probs=54.4

Q ss_pred             HHHHHHHHHHHHHHHCCCCHHH-------HHHHHHH-HC---CCCCHH-HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHC
Q ss_conf             7899999999996302699899-------9999753-11---464235-6899999999999889989999999999835
Q gi|254780421|r  124 AVRYAATLQAASILVDTSSYEE-------ISKILQK-LS---EPSNPM-HQFANEILGISALKFGKVQKAKTIFEELAKD  191 (218)
Q Consensus       124 ~~~~lA~l~la~~~~~~~~~d~-------a~~~l~~-~~---~~~~~~-~~~a~ellg~~~~~~Gd~~~A~~~y~~i~~~  191 (218)
T Consensus       115 s~~A~~~LriAWlyR~~~~~e~E~~fl~~Al~~y~~ay~~e~~~~~~~~e~~l~YLigeL~rRlG~~~eA~~wfs~vi~~  194 (214)
T pfam09986       115 SKKAMLCLRLAWLYRLLGDEEKELLFLKKALELYKEAYEKEDFPIEGIDEATLMYLIGELSRRLGNKEEALRWFSKVIGS  194 (214)
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCC
T ss_conf             89999999999986225885899999999999999999606688777118899999999999949999999999999639


Q ss_pred             CCC--CHHHHHHHHHHH
Q ss_conf             589--989999999999
Q gi|254780421|r  192 NNS--PFGISTRSQMIL  206 (218)
Q Consensus       192 ~~~--p~~~r~ra~~~l  206 (218)
T Consensus       195 ~~~s~~~~i~~~aRe~w  211 (214)
T pfam09986       195 PKASKPSKLKDLAREQW  211 (214)
T ss_pred             CCCCCCHHHHHHHHHHH
T ss_conf             66663188999989888