HHsearch alignment for GI: 254780421 and conserved domain: pfam10140

>pfam10140 essB Predicted membrane protein essB. Members of this family of prokaryotic proteins include the virulence factor essB, which is required for the synthesis and secretion of EsxA and EsxB, both ESAT-6 like proteins.
Probab=95.90  E-value=0.12  Score=28.67  Aligned_cols=129  Identities=16%  Similarity=0.126  Sum_probs=76.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             99999751999999999999999999999999999999999999999984138766699999997312552069999999
Q gi|254780421|r   15 KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMY   94 (218)
Q Consensus        15 ~~~~~~yk~ii~~~i~~i~~~~~~~~~~~~~q~~~~~~as~~y~~al~~~~~~~~~~A~~~l~~l~~~~~~~ya~lA~l~   94 (218)
T Consensus       188 Kkk~~~~K~~~i~~~~l~v~l~~~~~Y~~f~~~P~q~----~i~~a~~~fi~~dYs~VI~~L~~~---~~~~lp~~~kY~  260 (359)
T pfam10140       188 KKKWKIFKYLGIGLIALLVPLIIPLIYLLFFAQPKQE----AILEANTAFLNVDYSKVITTLEKY---DPESLPKSVKYE  260 (359)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHH----HHHHHHHHHHHCCHHHHHHHHHHC---CHHHCCHHHHHH
T ss_conf             5468999999999999999999999999998170488----999999999862589999876207---932499777778


Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCC
Q ss_conf             99999511005778999999873126895789999999999630269989999997531146
Q gi|254780421|r   95 IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP  156 (218)
Q Consensus        95 lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l~la~~~~~~~~~d~a~~~l~~~~~~  156 (218)
T Consensus       261 LA~SyV~~e~Ls~~QK--~~Ilnnitlk----Sde~yLlYWIyiGrg~~eeAldiA~~L~D~  316 (359)
T pfam10140       261 LAYSYVQVEKLSDDQK--ENILNNVTLK----SDELYLLYWIYIGRGEFEEALDIARRLDDN  316 (359)
T ss_pred             HHHHHHHCCCCCHHHH--HHHHHCCCCC----CCHHHHHHHHHHCCCCHHHHHHHHHHCCCH
T ss_conf             9899996166679999--9998307756----778999999997687649999999847978