HHsearch alignment for GI: 254780421 and conserved domain: pfam10300

>pfam10300 IML2 Putative mitochondrial outer membrane protein. This is a family of proteins conserved from fungi to humans. Members of this family also carry a TPR_2 domain pfam07719 at their C-terminus. Many of them are annotated as being mitochondrial outer membrane protein IML2.
Probab=96.96  E-value=0.026  Score=32.66  Aligned_cols=121  Identities=17%  Similarity=0.178  Sum_probs=95.2

Q ss_pred             HCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             13876669999999731255206999999999999511005778999999873126895789999999999630269989
Q gi|254780421|r   65 NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE  144 (218)
Q Consensus        65 ~~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l~la~~~~~~~~~d  144 (218)
T Consensus       228 ~~~~~~~a~~lL~~~~~~yP~s--~l~l~~~gR~~~~~g~l~~Ai~~~~~~~~~~~~~kQ~~~lc~~El~w~~~~~~~w~  305 (446)
T pfam10300       228 GEGPLEEAEALLEPSRKRFPNS--ALWLFFEARIESLKGNLDEALELFEECIESQSEWKQIHHLCYWELAWCHVFLHRWK  305 (446)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCC--HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9988999999999988538994--68999999999973799999999998674465449999999999999999997899


Q ss_pred             HHHHHHHHHCCCCCHH-HHHHHHHHHHHHHHCCCHH------HHHHHHHHH
Q ss_conf             9999975311464235-6899999999999889989------999999999
Q gi|254780421|r  145 EISKILQKLSEPSNPM-HQFANEILGISALKFGKVQ------KAKTIFEEL  188 (218)
Q Consensus       145 ~a~~~l~~~~~~~~~~-~~~a~ellg~~~~~~Gd~~------~A~~~y~~i  188 (218)
T Consensus       306 ~A~~~~~~L~~~-s~WSka~Y~Y~~a~c~~~~~~~~~~~~~~~a~~l~~~v  355 (446)
T pfam10300       306 QAANYFLLLSDE-SKWSKALYAYLAAACLLMLGREEEKAEGEKAVELFREV  355 (446)
T ss_pred             HHHHHHHHHHHH-CCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHC
T ss_conf             999999999984-54189999999999998653301056798999999977