HHsearch results for GI: 254780421 and protein with PDBid: 1elw_A

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1
Probab=98.26  E-value=4e-05  Score=48.80  Aligned_cols=104  Identities=11%  Similarity=0.035  Sum_probs=77.8

Q ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             99999999511005778999999873126895789999999999630269989999997531146423568999999999
Q gi|254780421|r   92 NMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGIS  171 (218)
Q Consensus        92 ~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l~la~~~~~~~~~d~a~~~l~~~~~~~~~~~~~a~ellg~~  171 (218)
                      ....+..++..|++++|+..|...+.-.+.+.    .+...++.++...+++++|+..+.....- .|....++..+|.+
T Consensus         7 L~~~G~~~~~~g~y~~A~~~~~~ai~~~p~~~----~~~~~~a~~~~~~~~~~~A~~~~~~a~~~-~~~~~~~~~~lg~~   81 (118)
T 1elw_A            7 LKEKGNKALSVGNIDDALQCYSEAIKLDPHNH----VLYSNRSAAYAKKGDYQKAYEDGCKTVDL-KPDWGKGYSRKAAA   81 (118)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCH----HHHHHHHHHHHHHTCHHHHHHHHHHHHHH-CTTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCH----HHHHHHHHHHHHCCCCCCHHHHHHHHHHH-CCCCHHHHHHHHHH
T ss_conf             99999999996999999999999998689989----99999999999848832000689999986-98979999999999


Q ss_pred             HHHCCCHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             99889989999999999835589989999
Q gi|254780421|r  172 ALKFGKVQKAKTIFEELAKDNNSPFGIST  200 (218)
Q Consensus       172 ~~~~Gd~~~A~~~y~~i~~~~~~p~~~r~  200 (218)
                      +...|++++|...|++++...+....+..
T Consensus        82 ~~~~~~~~~A~~~~~~a~~l~p~~~~~~~  110 (118)
T 1elw_A           82 LEFLNRFEEAKRTYEEGLKHEANNPQLKE  110 (118)
T ss_dssp             HHHTTCHHHHHHHHHHHHTTCTTCHHHHH
T ss_pred             HHHCCCHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             99949999999999999971989899999