HHsearch results for GI: 254780421 and protein with PDBid: 1wao_1

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3
Probab=98.17  E-value=2.7e-05  Score=49.88  Aligned_cols=91  Identities=13%  Similarity=0.010  Sum_probs=50.0

Q ss_pred             HHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             99511005778999999873126895789999999999630269989999997531146423568999999999998899
Q gi|254780421|r   98 ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK  177 (218)
Q Consensus        98 ~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l~la~~~~~~~~~d~a~~~l~~~~~~~~~~~~~a~ellg~~~~~~Gd  177 (218)
                      .++.+|++++|+..|+.+++-.+.+.    .+...++..+...+++++|+..+.....-+ |....++..+|.++...|+
T Consensus        15 ~~~~~g~y~~Ai~~y~kal~~~p~~~----~~~~~la~~~~~l~~~~~Ai~~~~~al~l~-p~~~~a~~~lg~~~~~~g~   89 (477)
T 1wao_1           15 DYFKAKDYENAIKFYSQAIELNPSNA----IYYGNRSLAYLRTECYGYALGDATRAIELD-KKYIKGYYRRAASNMALGK   89 (477)
T ss_dssp             STTTTTCHHHHHHHHHHHHHHCTTCH----HHHHHHHHHHHHTTCHHHHHHHHHHHHHSC-TTCHHHHHHHHHHHHHHTC
T ss_pred             HHHHCCCHHHHHHHHHHHHHHCCCCH----HHHHHHHHHHHHCCCHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHCCC
T ss_conf             99985899999999999998099989----999999999998399999999999999849-9989999999999998599


Q ss_pred             HHHHHHHHHHHHHCCC
Q ss_conf             8999999999983558
Q gi|254780421|r  178 VQKAKTIFEELAKDNN  193 (218)
Q Consensus       178 ~~~A~~~y~~i~~~~~  193 (218)
                      +++|.+.|++++...+
T Consensus        90 ~~~A~~~~~~al~l~P  105 (477)
T 1wao_1           90 FRAALRDYETVVKVKP  105 (477)
T ss_dssp             HHHHHHHHHHHHHHST
T ss_pred             HHHHHHHHHHHHHHCC
T ss_conf             9999999999898688