HHsearch results for GI: 254780421 and protein with PDBid: 1wao_1

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3
Probab=97.61  E-value=4.8e-05  Score=48.29  Aligned_cols=124  Identities=10%  Similarity=-0.009  Sum_probs=83.8

Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             99999999841387666999999973125520699999999999951100577899999987312689578999999999
Q gi|254780421|r   55 ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA  134 (218)
Q Consensus        55 ~~y~~al~~~~~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l~la  134 (218)
                      +....+....+.+++++|+..+++.++..+..  ..+.+.+|.++...|++++|+..++.+++-.+...    -|.++++
T Consensus         8 ~lk~~Gn~~~~~g~y~~Ai~~y~kal~~~p~~--~~~~~~la~~~~~l~~~~~Ai~~~~~al~l~p~~~----~a~~~lg   81 (477)
T 1wao_1            8 ELKTQANDYFKAKDYENAIKFYSQAIELNPSN--AIYYGNRSLAYLRTECYGYALGDATRAIELDKKYI----KGYYRRA   81 (477)
T ss_dssp             TSSSSSSSTTTTTCHHHHHHHHHHHHHHCTTC--HHHHHHHHHHHHHTTCHHHHHHHHHHHHHSCTTCH----HHHHHHH
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC--HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCH----HHHHHHH
T ss_conf             99999999998589999999999999809998--99999999999983999999999999998499989----9999999


Q ss_pred             HHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHH--HHHHHCCCHHHHHHHH
Q ss_conf             96302699899999975311464235689999999--9999889989999999
Q gi|254780421|r  135 SILVDTSSYEEISKILQKLSEPSNPMHQFANEILG--ISALKFGKVQKAKTIF  185 (218)
Q Consensus       135 ~~~~~~~~~d~a~~~l~~~~~~~~~~~~~a~ellg--~~~~~~Gd~~~A~~~y  185 (218)
                      .++...+++++|+..+.....-. |....+...++  ..++++.++++|....
T Consensus        82 ~~~~~~g~~~~A~~~~~~al~l~-P~~~~a~~~l~~~~~~~~~~~~e~A~~~~  133 (477)
T 1wao_1           82 ASNMALGKFRAALRDYETVVKVK-PHDKDAKMKYQECNKIVKQKAFERAIAGD  133 (477)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHS-TTCTTHHHHHHHHHHHHHHHHHCCC----
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998599999999999989868-89799999999999998888888755545