HHsearch results for GI: 254780421 and protein with PDBid: 1xnf_A

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomics, unkown function; 1.98A {Escherichia coli} SCOP: a.118.8.1
Probab=98.43  E-value=3.7e-05  Score=49.01  Aligned_cols=131  Identities=19%  Similarity=0.162  Sum_probs=76.4

Q ss_pred             HHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH
Q ss_conf             99998413876669999999731255206999999999999511005778999999873126895789999999999630
Q gi|254780421|r   59 QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV  138 (218)
Q Consensus        59 ~al~~~~~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l~la~~~~  138 (218)
                      -+......+++++|+..+++.++..|+.  .-+.+.++.++...|++++|+..+..++...+.+.... + .+.++....
T Consensus        83 lg~~~~~~g~~~~Ai~~~~~al~~~p~~--~~a~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~-~-~~~~~~~~~  158 (275)
T 1xnf_A           83 LGIYLTQAGNFDAAYEAFDSVLELDPTY--NYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRS-L-WLYLAEQKL  158 (275)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHHCTTC--THHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHH-H-HHHHHHHHH
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHCCCCHH--HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHH-H-HHHHHHHHC
T ss_conf             9999988589999999976500138317--89999862321023669999999999987297679999-9-999999984


Q ss_pred             ------------------------------CCCCHHHHHHHHHHHCCC---CCHHHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             ------------------------------269989999997531146---42356899999999999889989999999
Q gi|254780421|r  139 ------------------------------DTSSYEEISKILQKLSEP---SNPMHQFANEILGISALKFGKVQKAKTIF  185 (218)
Q Consensus       139 ------------------------------~~~~~d~a~~~l~~~~~~---~~~~~~~a~ellg~~~~~~Gd~~~A~~~y  185 (218)
                                                    ..................   ..|-...+...+|.++...|++++|.+.|
T Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~  238 (275)
T 1xnf_A          159 DEKQAKEVLKQHFEKSDKEQWGWNIVEFYLGNISEQTLMERLKADATDNTSLAEHLSETNFYLGKYYLSLGDLDSATALF  238 (275)
T ss_dssp             CHHHHHHHHHHHHHHSCCCSTHHHHHHHHTTSSCHHHHHHHHHHHCCSHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             90999999999997377336234689999866532001378999988887738120999999999999878999999999


Q ss_pred             HHHHHCCC
Q ss_conf             99983558
Q gi|254780421|r  186 EELAKDNN  193 (218)
Q Consensus       186 ~~i~~~~~  193 (218)
                      ++++...+
T Consensus       239 ~~Al~~~p  246 (275)
T 1xnf_A          239 KLAVANNV  246 (275)
T ss_dssp             HHHHTTCC
T ss_pred             HHHHHCCC
T ss_conf             99988498