HHsearch results for GI: 254780421 and protein with PDBid: 2h6f_A

>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ...
Probab=95.87  E-value=0.073  Score=28.57  Aligned_cols=50  Identities=16%  Similarity=0.179  Sum_probs=21.1

Q ss_pred             CHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHC
Q ss_conf             7666999999973125520699999999999951100577899999987312
Q gi|254780421|r   68 KLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD  119 (218)
Q Consensus        68 ~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~  119 (218)
                      ++++++..+++++...+..|..  ...++.++...|++++|+..+..++...
T Consensus       147 ~~~~al~~~~~~l~~~pk~~~~--~~~~g~~~~~l~~~~~Al~~~~~al~~~  196 (382)
T 2h6f_A          147 DLHEEMNYITAIIEEQPKNYQV--WHHRRVLVEWLRDPSQELEFIADILNQD  196 (382)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHH--HHHHHHHHHHHTCCTTHHHHHHHHHHHC
T ss_pred             CHHHHHHHHHHHHHHCCCCHHH--HHHHHHHHHHCCCHHHHHHHHHHHHHHC
T ss_conf             8999999999999878998899--9999999998257999999999998638