HHsearch results for GI: 254780421 and protein with PDBid: 2ooe_A

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7
Probab=98.09  E-value=0.00027  Score=43.61  Aligned_cols=130  Identities=13%  Similarity=0.028  Sum_probs=90.3

Q ss_pred             HHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH-HH
Q ss_conf             99984138766699999997312552069999999999995110057789999998731268957899999999996-30
Q gi|254780421|r   60 ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI-LV  138 (218)
Q Consensus        60 al~~~~~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l~la~~-~~  138 (218)
                      +......++.+.|...+++.....++. .....+..+..+...|+.+.|+..|...+...+....    +-+.++.+ ..
T Consensus       328 ~~~~~~~~~~~~A~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~~~~----~~~~~a~l~~~  402 (530)
T 2ooe_A          328 ADYEESRMKYEKVHSIYNRLLAIEDID-PTLVYIQYMKFARRAEGIKSGRMIFKKAREDARTRHH----VYVTAALMEYY  402 (530)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHSSSSC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCTTCCTH----HHHHHHHHHHH
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHCCCH-HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHH----HHHHHHHHHHH
T ss_conf             999863021899999999877626614-5899999999999806689999999999984899799----99999999988


Q ss_pred             CCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             269989999997531146423568999999999998899899999999998355899
Q gi|254780421|r  139 DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSP  195 (218)
Q Consensus       139 ~~~~~d~a~~~l~~~~~~~~~~~~~a~ellg~~~~~~Gd~~~A~~~y~~i~~~~~~p  195 (218)
                      ..++++.+.+.+....... |..+......|..+.+.|++++|++.|++++...+.+
T Consensus       403 ~~~~~~~A~~~~~~al~~~-p~~~~~~~~~~~~~~~~g~~~~Ar~~~e~al~~~~~~  458 (530)
T 2ooe_A          403 CSKDKSVAFKIFELGLKKY-GDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLP  458 (530)
T ss_dssp             HTCCHHHHHHHHHHHHHHH-TTCHHHHHHHHHHHTTTTCHHHHHHHHHHHHHSCCSC
T ss_pred             HCCCHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCC
T ss_conf             6547999999999998649-9969999999999988889999999999998668998