HHsearch results for GI: 254780421 and protein with PDBid: 2vq2_A

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}
Probab=98.70  E-value=3.2e-06  Score=55.57  Aligned_cols=127  Identities=20%  Similarity=0.162  Sum_probs=66.1

Q ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             99999841387666999999973125520699999999999951100577899999987312689578999999999963
Q gi|254780421|r   58 AQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL  137 (218)
Q Consensus        58 ~~al~~~~~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l~la~~~  137 (218)
                      .-+......+++++|+..+++.+...|+.  ..+.+.++.++...|++++|+..|+..++-.+...    .+...++.++
T Consensus        13 ~La~~y~~~g~~~~A~~~~~~al~~~p~~--~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~----~~~~~l~~~~   86 (225)
T 2vq2_A           13 QLAMEYMRGQDYRQATASIEDALKSDPKN--ELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSA----EINNNYGWFL   86 (225)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHHCTTC--HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCH----HHHHHHHHHH
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHCCCC--HHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCC----HHHHHHHHHH
T ss_conf             99999998699999999999999868998--99999999999987899999999999986298621----2356478999


Q ss_pred             H-CCCCHHHHHHHHHHHC-CCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             0-2699899999975311-464235689999999999988998999999999983
Q gi|254780421|r  138 V-DTSSYEEISKILQKLS-EPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK  190 (218)
Q Consensus       138 ~-~~~~~d~a~~~l~~~~-~~~~~~~~~a~ellg~~~~~~Gd~~~A~~~y~~i~~  190 (218)
                      . ..+++++++..+.... .+..|....+...+|.++...|++++|++.|++++.
T Consensus        87 ~~~~~~~~eA~~~~~~al~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~  141 (225)
T 2vq2_A           87 CGRLNRPAESMAYFDKALADPTYPTPYIANLNKGICSAKQGQFGLAEAYLKRSLA  141 (225)
T ss_dssp             HTTTCCHHHHHHHHHHHHTSTTCSCHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             HHHHCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             9981750766566899997223630468875268888885899999999999998