HHsearch results for GI: 254780421 and protein with PDBid: 2vsy_A

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCNACYLATION; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2vsn_A*
Probab=98.81  E-value=2.5e-07  Score=62.36  Aligned_cols=131  Identities=12%  Similarity=0.066  Sum_probs=102.7

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             38766699999997312552069999999999995110057789999998731268957899999999996302699899
Q gi|254780421|r   66 SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE  145 (218)
Q Consensus        66 ~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~l~la~~~~~~~~~d~  145 (218)
                      +++..+|+..|++.++..|+.  ..+.+.+|.++...|++++|+..|+.+++-.+.+.    -+...++.++...+++++
T Consensus         2 ~~D~~~Al~~l~~al~~~P~~--~~a~~~Lg~~~~~~g~~~~A~~~~~~Al~l~P~~~----~a~~~Lg~~~~~~g~~~~   75 (568)
T 2vsy_A            2 TADGPRELLQLRAAVRHRPQD--FVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHP----EAVARLGRVRWTQQRHAE   75 (568)
T ss_dssp             -------------------CC--HHHHHHHHHHHHHHTCHHHHHHHHHHHHTTSTTCH----HHHHHHHHHHHHTTCHHH
T ss_pred             CCCHHHHHHHHHHHHHHCCCC--HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCH----HHHHHHHHHHHHCCCHHH
T ss_conf             998899999999999968999--99999999999987899999999999998298999----999999999998599999


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCC-CHHHHHHHH
Q ss_conf             9999753114642356899999999999889989999999999835589-989999999
Q gi|254780421|r  146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS-PFGISTRSQ  203 (218)
Q Consensus       146 a~~~l~~~~~~~~~~~~~a~ellg~~~~~~Gd~~~A~~~y~~i~~~~~~-p~~~r~ra~  203 (218)
                      |+..+.....- .|....++..+|.++...|++++|+..|++++...+. |.....++.
T Consensus        76 A~~~~~~al~l-~P~~~~~~~~lg~~~~~~g~~~~A~~~~~~Al~l~P~~~~~~~~l~~  133 (568)
T 2vsy_A           76 AAVLLQQASDA-APEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLN  133 (568)
T ss_dssp             HHHHHHHHHHH-CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHH
T ss_pred             HHHHHHHHHHC-CCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             99999999971-99999999999999998297123357777652238862377888887