HHsearch results for GI: 254780421 and protein with PDBid: 2vyi_A

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1
Probab=98.12  E-value=0.00012  Score=45.89  Aligned_cols=120  Identities=15%  Similarity=0.035  Sum_probs=96.4

Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             99999999999984138766699999997312552069999999999995110057789999998731268957899999
Q gi|254780421|r   51 NIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT  130 (218)
Q Consensus        51 ~~as~~y~~al~~~~~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~~~~~~~~~lA~  130 (218)
                      ..+-..+..+......+++++|+..|++.+...++.  ..+.+.++.++...|++++|+..+..++...+.+.    .+.
T Consensus        10 ~~~e~l~~~G~~~~~~~~y~~A~~~~~~al~~~p~~--~~~~~~l~~~~~~~~~~~~A~~~~~~~l~~~p~~~----~~~   83 (131)
T 2vyi_A           10 AEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPAN--AVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYS----KAY   83 (131)
T ss_dssp             HHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTC--HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCH----HHH
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC--HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH----HHH
T ss_conf             999999999999999589999999999999868998--99998488998872776889999999998863237----999


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999630269989999997531146423568999999999998899
Q gi|254780421|r  131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK  177 (218)
Q Consensus       131 l~la~~~~~~~~~d~a~~~l~~~~~~~~~~~~~a~ellg~~~~~~Gd  177 (218)
                      +.++.++...+++++|+..+.....- .|....+...+|.++.+.++
T Consensus        84 ~~lg~~~~~~~~~~~A~~~~~~al~~-~p~~~~~~~~l~~~~~~l~e  129 (131)
T 2vyi_A           84 GRMGLALSSLNKHVEAVAYYKKALEL-DPDNETYKSNLKIAELKLRE  129 (131)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHHH-STTCHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHCC
T ss_conf             88999985025699999999999976-96989999999999998738