HHsearch results for GI: 254780421 and protein with PDBid: 3edt_B

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics consortium, SGC, coiled coil, microtubule, motor protein; 2.70A {Homo sapiens} PDB: 3ceq_A
Probab=98.26  E-value=0.00011  Score=46.04  Aligned_cols=129  Identities=12%  Similarity=0.071  Sum_probs=75.1

Q ss_pred             HHHHCCCHHHHHHHHHHHHHC------CCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHC----CCCHHHHHHHHH
Q ss_conf             984138766699999997312------5520699999999999951100577899999987312----689578999999
Q gi|254780421|r   62 ELFNSNKLDDARSSFEKILSQ------DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD----LAPLAVRYAATL  131 (218)
Q Consensus        62 ~~~~~~~~~~A~~~l~~l~~~------~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~----~~~~~~~~lA~l  131 (218)
                      .....+++++|+..+++..+-      ..+.....+...++.++...|++++|+..|+..++-.    ..+.+-...+..
T Consensus        94 ~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~i~~~~~~~~~~~~a~~~~  173 (283)
T 3edt_B           94 LYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLNNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKN  173 (283)
T ss_dssp             HHHTTTCHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHSCTTCHHHHHHHH
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             99986887889987888999999861668868999999871765503755889998888999999862899989999999


Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHC------------------------------------------------CCCCHHHHH
Q ss_conf             99996302699899999975311------------------------------------------------464235689
Q gi|254780421|r  132 QAASILVDTSSYEEISKILQKLS------------------------------------------------EPSNPMHQF  163 (218)
Q Consensus       132 ~la~~~~~~~~~d~a~~~l~~~~------------------------------------------------~~~~~~~~~  163 (218)
                      .++.++...+++++|+..+....                                                ..+.|....
T Consensus       174 ~Lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  253 (283)
T 3edt_B          174 NLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREESKDKRRDSAPYGEYGSWYKACKVDSPTVNT  253 (283)
T ss_dssp             HHHHHHHHHTCHHHHHHHHHHHHHHHHHHHSSSCCSSCCCHHHHHHHHHHTTCCCCC------------CCCCCCHHHHH
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             99999987687999999999999987776554425667888888775552146999999999999999986438846999


Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             999999999988998999999999983
Q gi|254780421|r  164 ANEILGISALKFGKVQKAKTIFEELAK  190 (218)
Q Consensus       164 a~ellg~~~~~~Gd~~~A~~~y~~i~~  190 (218)
                      +...+|.+|..+|++++|.+.+++++.
T Consensus       254 ~~~~La~~y~~~G~~~eA~~l~e~Al~  280 (283)
T 3edt_B          254 TLRSLGALYRRQGKLEAAHTLEDCASR  280 (283)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             999999999981999999999999998