HHsearch results for GI: 254780421 and protein with PDBid: 3gw4_A

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.49A {Deinococcus radiodurans R1}
Probab=98.09  E-value=0.00047  Score=42.17  Aligned_cols=126  Identities=10%  Similarity=0.098  Sum_probs=97.9

Q ss_pred             HHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHHHHCC
Q ss_conf             841387666999999973125520699999999999951100577899999987312--689578999999999963026
Q gi|254780421|r   63 LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD--LAPLAVRYAATLQAASILVDT  140 (218)
Q Consensus        63 ~~~~~~~~~A~~~l~~l~~~~~~~ya~lA~l~lA~~~~~~g~~~~A~~~l~~i~~~~--~~~~~~~~lA~l~la~~~~~~  140 (218)
                      .++.++++.|...++.++...++  ...+++.++.++...|++++|+..++..+...  ..+......+...++.++...
T Consensus         2 a~~~~~y~~A~~~~~~~l~~~~~--~~~a~~~LG~~~~~~g~~~eA~~~~~~a~~~~~~~~~~~~~a~a~~~lg~~~~~~   79 (203)
T 3gw4_A            2 AFEAHDYALAERQAQALLAHPAT--ASGARFMLGYVYAFMDRFDEARASFQALQQQAQKSGDHTAEHRALHQVGMVERMA   79 (203)
T ss_dssp             -----CHHHHHHHHHHHHTSTTT--HHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHT
T ss_pred             CHHCCCHHHHHHHHHHHHCCCCC--CHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             54247999999999998768975--5999999999999879999999999999998988589868999999999999980


Q ss_pred             CCHHHHHHHHHHHC------CCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             99899999975311------464235689999999999988998999999999983
Q gi|254780421|r  141 SSYEEISKILQKLS------EPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK  190 (218)
Q Consensus       141 ~~~d~a~~~l~~~~------~~~~~~~~~a~ellg~~~~~~Gd~~~A~~~y~~i~~  190 (218)
                      +++++++..+....      ..............|..+...|+.++|...+++.+.
T Consensus        80 ~~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~l~  135 (203)
T 3gw4_A           80 GNWDAARRCFLEERELLASLPEDPLAASANAYEVATVALHFGDLAGARQEYEKSLV  135 (203)
T ss_dssp             TCHHHHHHHHHHHHHHHHHSCCCHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH
T ss_conf             76777688877888763654211268899887578998861104887799999999