BLAST/PSIBLAST alignment of GI: 254780421 and GI: 307307990 at iteration 1
>gi|307307990|ref|ZP_07587708.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti BL225C] Length = 222
>gi|306901394|gb|EFN31998.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti BL225C] Length = 222
 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 105/189 (55%), Gaps = 5/189 (2%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           IA L++L  +    + Y  + S  +     G+ F  AL L   NK D+A ++  ++    
Sbjct: 35  IAVLIVLGTVGKVGYDYWQEASSSQS----GDTFLAALNLARENKSDEALAALTELEKDG 90

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y  L+ + +A++   KG+T +A   F  +  D   P A+R AA L+AA +L+D  +Y
Sbjct: 91  YGSYPVLAQLRVATLQAQKGETDSAVAAFSGIGRDTRIPAALRDAARLRAAYLLIDAGTY 150

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           E++S  +++L+ P N M   A E LG+SA K G   KAK+ F+++  D  SP GI  R+Q
Sbjct: 151 EQVSSEVEQLAVPQNAMRHSAREALGLSAYKAGDYAKAKSWFQQIVDDAQSPRGIMNRAQ 210

Query: 204 MILANIIAS 212
           M+L ++IAS
Sbjct: 211 MLL-DVIAS 218