BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780421|ref|YP_003064834.1| hypothetical protein
CLIBASIA_01530 [Candidatus Liberibacter asiaticus str. psy62]
         (218 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780421|ref|YP_003064834.1| hypothetical protein CLIBASIA_01530 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040098|gb|ACT56894.1| hypothetical protein CLIBASIA_01530 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 218

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 218/218 (100%), Positives = 218/218 (100%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA
Sbjct: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL
Sbjct: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK
Sbjct: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK
Sbjct: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218


>gi|315122135|ref|YP_004062624.1| hypothetical protein CKC_01925 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495537|gb|ADR52136.1| hypothetical protein CKC_01925 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 220

 Score =  278 bits (710), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 143/218 (65%), Positives = 173/218 (79%), Gaps = 1/218 (0%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+SN D +S K  CK+ K  YK I PLLIL++LSLA W YL  GS+ K KN  GE+F+QA
Sbjct: 1   MKSNKDTSSCKEGCKIKKYGYKLIVPLLILIVLSLASWLYLH-GSYNKPKNPAGEDFSQA 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           + L N+NKLDDAR +FEKILS DN+ Y+ ++NMYIASILV KGD K+A+E FLKV NDDL
Sbjct: 60  ISLLNNNKLDDARIAFEKILSYDNRSYDSIANMYIASILVTKGDVKSASEKFLKVGNDDL 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   VRY A L AA ILVDT SY++ISKILQKL +PSNPMH  ANEILGISA+K GK++K
Sbjct: 120 ALPVVRYTAILHAAWILVDTVSYDDISKILQKLIDPSNPMHPAANEILGISAMKCGKIEK 179

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           A++IFEE+ KD NSP GISTRSQ++LANIIAS++  KK
Sbjct: 180 ARSIFEEIVKDPNSPPGISTRSQIMLANIIASNKETKK 217


>gi|16264870|ref|NP_437662.1| hypothetical protein SM_b20996 [Sinorhizobium meliloti 1021]
 gi|15141009|emb|CAC49522.1| HYPOTHETICAL PROTEIN SM_b20996 [Sinorhizobium meliloti 1021]
          Length = 222

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 98/171 (57%), Gaps = 1/171 (0%)

Query: 42  FDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVA 101
           +D   E   +  G+ F  AL L   NK D+A ++  ++       Y  L+ + +A++   
Sbjct: 49  YDYWQESSSSQSGDTFLAALNLARENKSDEALAALTELEKDGYGSYPVLAQLRVATLQAQ 108

Query: 102 KGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMH 161
           KG+T +A   F ++  D   P A+R AA L+AA +L+D  +YE++S  +++L+ P N M 
Sbjct: 109 KGETDSAVAAFSEIGRDTRIPAALRDAARLRAAYLLIDAGTYEQVSSEVEQLAVPQNAMR 168

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
             A E LG+SA K G   KAK+ F+++  D  SP GI  R+QM+L ++IAS
Sbjct: 169 HSAREALGLSAYKAGDYAKAKSWFQQIVDDAQSPRGIMNRAQMLL-DVIAS 218


>gi|307307990|ref|ZP_07587708.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti BL225C]
 gi|306901394|gb|EFN31998.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti BL225C]
          Length = 222

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 105/189 (55%), Gaps = 5/189 (2%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           IA L++L  +    + Y  + S  +     G+ F  AL L   NK D+A ++  ++    
Sbjct: 35  IAVLIVLGTVGKVGYDYWQEASSSQS----GDTFLAALNLARENKSDEALAALTELEKDG 90

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y  L+ + +A++   KG+T +A   F  +  D   P A+R AA L+AA +L+D  +Y
Sbjct: 91  YGSYPVLAQLRVATLQAQKGETDSAVAAFSGIGRDTRIPAALRDAARLRAAYLLIDAGTY 150

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           E++S  +++L+ P N M   A E LG+SA K G   KAK+ F+++  D  SP GI  R+Q
Sbjct: 151 EQVSSEVEQLAVPQNAMRHSAREALGLSAYKAGDYAKAKSWFQQIVDDAQSPRGIMNRAQ 210

Query: 204 MILANIIAS 212
           M+L ++IAS
Sbjct: 211 MLL-DVIAS 218


>gi|227822914|ref|YP_002826886.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
 gi|227341915|gb|ACP26133.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
          Length = 222

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 62/189 (32%), Positives = 106/189 (56%), Gaps = 4/189 (2%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           +A L++L  +    + Y      E   +  G+ F  AL+L   N+ ++A  +  K+  + 
Sbjct: 35  VAALIVLGTVGKVGYDYW----QESSSSQSGDAFLVALDLAKENRSEEALGALTKLEQEG 90

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y  L+ +  A++   KG+T+ A   F ++  D+  P A+R AA L+AA +L+DT +Y
Sbjct: 91  YGSYPVLARLRAATLKAQKGETEAAFAAFSEIGKDNRIPAALRDAARLRAAYLLIDTGTY 150

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           +++S  +++L+ P N M   A E LG++A K G   KAK  F+++A D  SP G++ R+Q
Sbjct: 151 DQVSAEVEQLAVPQNAMRHSAREALGLAAFKAGDYAKAKGWFQQIADDTESPRGVANRAQ 210

Query: 204 MILANIIAS 212
           M+L  I AS
Sbjct: 211 MLLDVIAAS 219


>gi|307319942|ref|ZP_07599365.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti AK83]
 gi|306894482|gb|EFN25245.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti AK83]
          Length = 222

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 104/189 (55%), Gaps = 5/189 (2%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           IA L++L  +    + Y  + S  +     G+ F  AL L   NK D+A ++  ++    
Sbjct: 35  IAVLIVLGTVGKVGYDYWQEASSSQS----GDTFLAALNLARENKSDEALAALTELEKDG 90

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y  L+ + +A++   KG+T  A   F  +  D   P A+R AA L+AA +L+D  +Y
Sbjct: 91  YGSYPVLAQLRVATLQAQKGETDAAVAAFSGIGRDTRIPAALRDAARLRAAYLLIDAGTY 150

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           E++S  +++L+ P N M   A E LG+SA K G   KAK+ F+++  D  SP GI  R+Q
Sbjct: 151 EQVSSEVEQLAVPQNAMRHSAREALGLSAYKAGDYAKAKSWFQQIVDDAQSPRGIMNRAQ 210

Query: 204 MILANIIAS 212
           M+L ++IAS
Sbjct: 211 MLL-DVIAS 218


>gi|150376650|ref|YP_001313246.1| hypothetical protein Smed_4513 [Sinorhizobium medicae WSM419]
 gi|150031197|gb|ABR63313.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
          Length = 222

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 97/171 (56%), Gaps = 1/171 (0%)

Query: 42  FDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVA 101
           +D   E   +  G+ F  AL L   NK D+A ++   +  +    Y  L+ + +A++   
Sbjct: 49  YDYWQESSSSQSGDTFLVALNLARENKSDEALAALTGLEKEGYGSYPVLAQLRLATLQAQ 108

Query: 102 KGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMH 161
           KG+T  A + F  +  D   P A+R AA L+AA +L+D  +YE++S  +++L+ P N M 
Sbjct: 109 KGETDAAVKAFSGIGRDTRIPTALRDAARLRAAYLLIDAGTYEQVSSEVEQLAVPQNAMR 168

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
             A E LG+SA K G   KAK+ F+++  D  SP G+  R+QM+L ++IAS
Sbjct: 169 HSAREALGLSAYKAGDYAKAKSWFQQIVDDTESPRGVMNRAQMLL-DVIAS 218


>gi|116253296|ref|YP_769134.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257944|emb|CAK09042.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 227

 Score =  108 bits (270), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 55/172 (31%), Positives = 100/172 (58%)

Query: 41  LFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILV 100
           L+D   + + +  G+ F  A++L + NK D+A ++ +K+  + +  Y  L+ M  A++ V
Sbjct: 48  LYDYWDDNRSSGTGDQFLAAMKLADENKNDEALAALDKLEKEGHGAYPVLARMRAATVQV 107

Query: 101 AKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM 160
            KGDT  A   F ++  D+  P AVR AA ++A  +L++  +YEE+S  +++++ P N  
Sbjct: 108 QKGDTVAAIAAFNEIGKDNAVPAAVRDAAKMRAGWLLIENGTYEEVSAAIEEMAVPGNAF 167

Query: 161 HQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
              A E LG++A K G + +A+  F+ +  D +SP  ++ R+ M+L  I AS
Sbjct: 168 RHSAREALGLAAYKAGNMAQARQWFQSIVDDTDSPRNVANRAHMMLDLITAS 219


>gi|86358710|ref|YP_470602.1| hypothetical protein RHE_CH03109 [Rhizobium etli CFN 42]
 gi|86282812|gb|ABC91875.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 227

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 109/191 (57%), Gaps = 1/191 (0%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           ++I  + IL++L  A    L++   + + +  G+ F  A++L + NK D+A ++ EK+  
Sbjct: 30  RYIIVVAILIVLGTAG-KVLYEYWDDTRSSGAGDQFLAAMKLADENKNDEALAALEKLEK 88

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           + +  Y  L+ M  A++   KGD   A   F ++  D+  P AVR  A ++A  +L++  
Sbjct: 89  EGHGAYPVLARMRAATVQAQKGDAGAAIAAFNEIGKDNSVPAAVRDVAKMRAGWLLIENG 148

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
           SYE++S ++++++ PSN     A E LG++A K G + +A+  F+ +  D  SP  ++ R
Sbjct: 149 SYEQVSAVIEEMAVPSNAFRHSAREALGLAAYKAGNMAQARQWFQSIVDDAGSPRPVANR 208

Query: 202 SQMILANIIAS 212
           +QM+L  I AS
Sbjct: 209 AQMMLDLITAS 219


>gi|241205815|ref|YP_002976911.1| hypothetical protein Rleg_3116 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859705|gb|ACS57372.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 227

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 99/172 (57%)

Query: 41  LFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILV 100
           L+D   + + +  G+ F  A++L + NK D+A ++  K+  + +  Y  L+ M  A++ V
Sbjct: 48  LYDYWDDNRSSGTGDQFLAAMKLADENKNDEALAALNKLEKEGHGAYPVLARMRAATVQV 107

Query: 101 AKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM 160
            KGDT  A   F ++  D+  P AVR AA ++A  +L++  +YE++S  +++++ P N  
Sbjct: 108 QKGDTAAAITAFNEIGKDNAVPAAVRDAAKMRAGWLLIENGTYEQVSAAIEEMAVPGNAF 167

Query: 161 HQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
              A E LG++A K G + +A+  F+ +  D +SP  ++ R+ M+L  I AS
Sbjct: 168 RHSAREALGLAAYKAGNMAQARQWFQSIVDDTDSPRNVANRAHMMLDLITAS 219


>gi|218516155|ref|ZP_03512995.1| hypothetical protein Retl8_22038 [Rhizobium etli 8C-3]
          Length = 227

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 108/191 (56%), Gaps = 3/191 (1%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           +A +LI++  +  + +  +D S   + +  G+ F  A++L + NK D+A ++ +K+  + 
Sbjct: 34  VAAILIVVGTAGKVLYEYWDDS---RSSGAGDQFLAAMKLADENKNDEALAALDKLEKEG 90

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
           +  Y  L+ M  A++   KGD   A   F ++  D+  P AVR AA ++A  +L++  SY
Sbjct: 91  HGAYPVLARMRAATVQAQKGDAAAAIAAFNEIGKDNGVPAAVRDAARMRAGWLLIENGSY 150

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           E++S  +++++ P N     A E LG++A K G + +A+  F+ +  D  SP  ++ R+Q
Sbjct: 151 EQVSAAIEEMAVPGNAFRHSAREALGLAAYKAGNMAQARQWFQSIIDDAESPRPVANRAQ 210

Query: 204 MILANIIASDQ 214
           M+L  I AS +
Sbjct: 211 MMLDLITASGE 221


>gi|190892853|ref|YP_001979395.1| hypothetical protein RHECIAT_CH0003269 [Rhizobium etli CIAT 652]
 gi|190698132|gb|ACE92217.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
 gi|327189206|gb|EGE56386.1| hypothetical protein RHECNPAF_700018 [Rhizobium etli CNPAF512]
          Length = 227

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 107/189 (56%), Gaps = 3/189 (1%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           +A +LI++  +  +   L+D   + + +  G+ F  A++L + NK D+A ++ +K+  + 
Sbjct: 34  VAAILIVVGTAGKV---LYDYWDDSRSSGAGDQFLAAMKLADENKNDEALAALDKLEKEG 90

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
           +  Y  L+ M  A++   KGD   A   F ++  D+  P AVR AA ++A  +L++  SY
Sbjct: 91  HGAYPVLARMRAATVQAQKGDAAAAIAAFNEIGKDNGVPAAVRDAARMRAGWLLIENGSY 150

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           E++S  +++++ P N     A E LG++A K G + +A+  F+ +  D  SP  ++ R+Q
Sbjct: 151 EQVSAAIEEMAVPGNAFRHSAREALGLAAYKAGNMAQARQWFQSIIDDAESPRPVANRAQ 210

Query: 204 MILANIIAS 212
           M+L  I AS
Sbjct: 211 MMLDLITAS 219


>gi|13476157|ref|NP_107727.1| hypothetical protein mlr7403 [Mesorhizobium loti MAFF303099]
 gi|14026917|dbj|BAB53513.1| mlr7403 [Mesorhizobium loti MAFF303099]
          Length = 221

 Score =  101 bits (251), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 101/181 (55%), Gaps = 5/181 (2%)

Query: 27  LLILMILSLA--IWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
           + IL++L  A  + +  +D   E + N  G+ F+QAL+L N  K DDA ++ +++     
Sbjct: 33  IAILVVLGTAAFVGYRYWD---ETRANRSGDAFSQALKLANDGKNDDALAALDQLEKDGY 89

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y  L+ M  A++  +KGDT  A + F  VA D   P  +R  A L+AA +LVD  S+ 
Sbjct: 90  GAYPLLARMRAATVKASKGDTAAAVKDFDDVAADTAIPQGIRDMARLRAALLLVDHGSFA 149

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
           ++S  ++ L+  +N +   A E LG++A K GK Q A  +F+++A D+ +P     R+ +
Sbjct: 150 DVSSRVEALTSDTNTLRHTAREALGLAAWKEGKTQDALKLFDQIAADDGAPRNTRERATL 209

Query: 205 I 205
           +
Sbjct: 210 M 210


>gi|222149420|ref|YP_002550377.1| hypothetical protein Avi_3303 [Agrobacterium vitis S4]
 gi|221736403|gb|ACM37366.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 223

 Score =  100 bits (250), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 106/195 (54%), Gaps = 3/195 (1%)

Query: 21  YKWIAPLLI---LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFE 77
           ++ + P+ I   ++I+     + L+D   + + +  G+ F  A +L    K D A S  +
Sbjct: 25  WRRLGPVFIGIAVLIVVGTAGYRLYDYYTDDRASKSGDRFLAATKLATDGKNDQALSDLQ 84

Query: 78  KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
            +       Y  L+ +  AS++  KGD K A + F  +  D+  P  +R  A ++AA +L
Sbjct: 85  ALEKDGFGAYPVLAKLRAASLMAEKGDAKAAIDAFTAIGKDNSVPQVIRDVAHIRAAWLL 144

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
           +D  +YE++S  ++ L+ P   +   A E LG++A K G+ ++A+  F+++ +D+ +P  
Sbjct: 145 IDNGTYEQVSTEVEALAVPGQGLRHSAREALGLAAYKAGQTERAREWFQQITEDSEAPRN 204

Query: 198 ISTRSQMILANIIAS 212
           ++ R+Q++L NI A+
Sbjct: 205 VANRAQIMLDNIAAA 219


>gi|209550426|ref|YP_002282343.1| hypothetical protein Rleg2_2847 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536182|gb|ACI56117.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 227

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 98/172 (56%)

Query: 41  LFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILV 100
           L++   + + +  G+ F  A++L + NK D+A ++ +K+  + +  Y  L+ M  A++  
Sbjct: 48  LYEYWDDTRSSGAGDQFLAAMKLADENKNDEALAALDKLEKEGHGAYPVLARMRAATVQA 107

Query: 101 AKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM 160
            KGD   A   F ++  D+  P AVR AA ++A  +L++  SYE++S  +++++ P N  
Sbjct: 108 QKGDAAAAIAAFNEIGKDNGVPAAVRDAAKMRAGWLLIENGSYEQVSAAIEEMAVPGNAF 167

Query: 161 HQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
              A E LG+++ K G + +A+  F+ +  D +SP  ++ R+ M+L  I AS
Sbjct: 168 RHSAREALGLASYKAGNMAQARQWFQSIVDDTDSPRNVTNRAHMMLDLITAS 219


>gi|260460375|ref|ZP_05808627.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259034020|gb|EEW35279.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 221

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 102/182 (56%), Gaps = 3/182 (1%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           +A +L+++  +  + +  +D   E + N  G+ F+QAL+L N  K D+A ++ +++    
Sbjct: 32  VAAILVVLGTAAFVGYRYWD---ETRANRSGDAFSQALKLANDGKNDEALAALDQLEKDG 88

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y  L+ M  A++  +KGD   A + F +VA D   P  +R  A L+AA +LVD  S+
Sbjct: 89  YGAYPLLARMRAATVKASKGDVDAAVKDFDEVAADTAIPQGIRDMARLRAALLLVDHGSF 148

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
            ++S  ++ L+  +N +   A E LG++A K GK Q A  +F+++A D+ +P     R+ 
Sbjct: 149 ADVSSRVEALTSDTNTLRHTAREALGLAAWKEGKTQDALKLFDQIASDDGAPRNTRERAT 208

Query: 204 MI 205
           ++
Sbjct: 209 LM 210


>gi|110633048|ref|YP_673256.1| hypothetical protein Meso_0691 [Mesorhizobium sp. BNC1]
 gi|110284032|gb|ABG62091.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 223

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 99/193 (51%), Gaps = 5/193 (2%)

Query: 18  KCCYKWIAPLLI----LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
           +  ++   P+ I    L++L +A W   +D     + N  G+ FAQALEL       +A 
Sbjct: 20  RVLWRRYGPIAIGLAALLVLGMAAWVA-YDHWWTSRANESGDRFAQALELAEEGNSQEAL 78

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
              E++ +     Y  L+ +  A+ L    D   A   F +VAND   P A+R  A L+A
Sbjct: 79  QLLEELENSGAGAYPVLARLRAATTLADSDDIDGAITKFDEVANDAAVPAAIRDVARLRA 138

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           A +LVD  SY +++  ++ LS  +NPM   A E + ++A K G  + A ++F E+A D  
Sbjct: 139 ALLLVDHGSYADVAARVETLSADTNPMRHIARETMALAAWKEGNRENALSLFGEIADDEQ 198

Query: 194 SPFGISTRSQMIL 206
           +P G   R++M++
Sbjct: 199 APAGARQRAEMMM 211


>gi|319784771|ref|YP_004144247.1| hypothetical protein Mesci_5097 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170659|gb|ADV14197.1| Protein of unknown function DUF2133 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 221

 Score = 97.8 bits (242), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 104/196 (53%), Gaps = 3/196 (1%)

Query: 13  KCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSH---EKKKNIVGENFAQALELFNSNKL 69
           + +  +  +    P LI++ + + +    F G     E + N  G+ F+QAL+L N  K 
Sbjct: 15  RREQAQALWDRFGPALIVVAILVVLGTAAFVGYRYWDETRANRSGDAFSQALKLANDGKN 74

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
           D+A ++ +++       Y  L+ M  A++   KGD   A + F +VA D   P ++R  A
Sbjct: 75  DEALTALDQLEKDGYGAYPLLARMRGATVKANKGDVPAAVKDFDEVAADTAIPQSIRDMA 134

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L+AA +LVD  S+ ++S  ++ L+  +N +   A E LG+SA K GK Q A  +F+++A
Sbjct: 135 RLRAALLLVDHGSFADVSSRVEALTSDTNTLRHTAREALGLSAWKEGKTQDALKLFDQIA 194

Query: 190 KDNNSPFGISTRSQMI 205
            D+ +P     R+ ++
Sbjct: 195 ADDGAPRNTRERATLM 210


>gi|153007832|ref|YP_001369047.1| hypothetical protein Oant_0487 [Ochrobactrum anthropi ATCC 49188]
 gi|151559720|gb|ABS13218.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 227

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 104/198 (52%), Gaps = 5/198 (2%)

Query: 13  KCKMGKCCYKWIAPLLI----LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           + +  K  ++   PLLI     ++L  A W   +    + K +  G+ F  AL+L +  K
Sbjct: 15  RSERAKQIWRNFGPLLIGGAVAIVLGTAGWVG-YQHWVDSKASASGDKFLAALDLASEGK 73

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
            D+A ++ + +       Y  L+ +  AS++  KGD   A + F +VA D+  P  +R  
Sbjct: 74  NDEALTALDDLEKTGYGSYPVLARLRAASVIADKGDAAGAVKAFDEVAADNAVPAPLRDV 133

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+A  +LVD+ SY++++K ++ LS   NPM   A E LG++A K  +   A  +F+++
Sbjct: 134 ARLRAGYLLVDSGSYDDVAKHVETLSADGNPMRSSAREALGLAAWKAERFDDAVKLFQQI 193

Query: 189 AKDNNSPFGISTRSQMIL 206
           A D+ +P  I  R+  +L
Sbjct: 194 ANDSLAPANIRQRANTML 211


>gi|222086679|ref|YP_002545213.1| hypothetical protein Arad_3292 [Agrobacterium radiobacter K84]
 gi|221724127|gb|ACM27283.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 227

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 87/159 (54%)

Query: 54  GENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL 113
           G+ F  AL L + NK D+A ++   I    +  Y  L+ +  A++   KGDT  A   F 
Sbjct: 61  GDQFISALTLADQNKTDEALAALAAIEKDGSGSYPLLARLRAATLQAQKGDTAGAVAAFS 120

Query: 114 KVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
            +  +   P  +R AA L+AA +LVDT +Y++++   Q+L+ P+N     A ++LG++A 
Sbjct: 121 AIGKETGLPTVIRDAARLRAAYLLVDTGTYDQVAAEAQELAVPANTFRHSARDVLGLAAY 180

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           K G   KA+  F+ +  D  SP  +  R+QM+L  I AS
Sbjct: 181 KAGDFAKARQWFQAIVDDPQSPRNVGNRAQMLLDLITAS 219


>gi|163761003|ref|ZP_02168081.1| hypothetical protein HPDFL43_03169 [Hoeflea phototrophica DFL-43]
 gi|162281784|gb|EDQ32077.1| hypothetical protein HPDFL43_03169 [Hoeflea phototrophica DFL-43]
          Length = 223

 Score = 95.9 bits (237), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 91/159 (57%), Gaps = 1/159 (0%)

Query: 54  GENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL 113
           G+ F  ALEL      D A + F+++ +  +  Y  L+ M  A++L  +GD+  A   F 
Sbjct: 61  GDAFLAALELARDGNTDAALAGFQELEATGHGSYPVLARMRAATVLADQGDSAAAISAFS 120

Query: 114 KVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
            +  D   P A+R AA ++AA +LVD  SY+++S  ++ L+ P N     A E LG++A 
Sbjct: 121 SIGKDASQPTAIRDAARMRAAYLLVDHGSYDDVSAEVEVLAVPGNAARHAAREALGLAAF 180

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           K G + KA   F E+  DN +P G++ R+++IL ++IA+
Sbjct: 181 KAGDLAKASEWFNEVINDNQTPRGVANRARVIL-DLIAA 218


>gi|159185150|ref|NP_355258.2| hypothetical protein Atu2301 [Agrobacterium tumefaciens str. C58]
 gi|159140421|gb|AAK88043.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 223

 Score = 95.9 bits (237), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 86/159 (54%)

Query: 54  GENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL 113
           G+ F  AL+L + NK DDA  +F  + +  +  Y  L+    A++L  KGD   A   F 
Sbjct: 61  GDQFLAALKLASENKTDDALKAFADLETTGHGNYPVLAKFRSATLLSQKGDAAGAIAAFT 120

Query: 114 KVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
            + ND  AP   R  A ++AA +LVD  +Y+++  + + LS     M   A E LG++A 
Sbjct: 121 AIGNDTSAPQVFRDTARVRAAWLLVDNGTYDQVVALAEPLSTDGQTMRASAREALGLAAY 180

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           K G   KAK  FE++  D  +P  ++ R+Q++L NI AS
Sbjct: 181 KAGDFAKAKQWFEQIMSDTQAPRNVTNRAQIMLDNITAS 219


>gi|239831250|ref|ZP_04679579.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239823517|gb|EEQ95085.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 268

 Score = 95.5 bits (236), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 102/198 (51%), Gaps = 5/198 (2%)

Query: 13  KCKMGKCCYKWIAPLLI----LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           + +  K  ++   PL+I     ++L  A W   +    + K +  G+ F  AL+L +  K
Sbjct: 56  RSERAKQVWRNFGPLVIGAAVAIVLGTAGWVG-YQHWTDSKASASGDKFLAALDLASEGK 114

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
            D+A ++   +       Y  L+ +  AS++  KGD   A + F  VA D+  P  +R  
Sbjct: 115 NDEALAALADLEKTGYGSYPVLARLRAASVIADKGDAAGAVKAFDDVAADNAVPAPLRDV 174

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+A  +LVD+ SY++++K ++ LS   NPM   A E LG++A K  +   A  +F+++
Sbjct: 175 ARLRAGYLLVDSGSYDDVAKRVETLSADGNPMRSSAREALGLAAWKAERFDDAVKLFQQI 234

Query: 189 AKDNNSPFGISTRSQMIL 206
           A D+ +P  I  RS  +L
Sbjct: 235 ANDSLAPANIRQRSNTML 252


>gi|319406080|emb|CBI79710.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 223

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 102/170 (60%)

Query: 49  KKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNA 108
           K N VG+ F   L+L +++  D+A   F+ +   D   Y  L+++  AS+   +GDT  +
Sbjct: 54  KANNVGDTFITGLDLADAHHFDEAIKKFKSVKKSDFGGYPFLADLREASLWTERGDTAKS 113

Query: 109 AEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL 168
            ++F  +A D+ AP  +R  A ++AA ILVD  +++++ + +++++   +PM   A E+L
Sbjct: 114 VKMFDMIAADEKAPQILRKIAKIRAAYILVDIGTFDDVMQRVKEMANDIDPMRMSAREVL 173

Query: 169 GISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           G++A K  K++ A   F+++ ++N   F I+ R++++L  I AS + NK+
Sbjct: 174 GLAAYKADKMENAVYYFQKIVEENALGFKITDRAKIMLELIQASGKVNKE 223


>gi|325293657|ref|YP_004279521.1| hypothetical protein AGROH133_07947 [Agrobacterium sp. H13-3]
 gi|325061510|gb|ADY65201.1| hypothetical protein AGROH133_07947 [Agrobacterium sp. H13-3]
          Length = 223

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 86/159 (54%)

Query: 54  GENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL 113
           G+ F  AL+L + NK D+A  +F  + +  +  Y  L+    A++L  KGD   A   F 
Sbjct: 61  GDQFIAALKLASDNKTDEALKAFADLETSGHGNYPVLAKFRSATLLSQKGDAAGAIAAFT 120

Query: 114 KVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
            + ND  AP   R  A ++AA +LVD  +Y+++  + + LS     M   A E LG++A 
Sbjct: 121 AIGNDTSAPQVFRDTAKVRAAWLLVDNGTYDQVVALAEPLSGEGQTMRASAREALGLAAY 180

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           K G   KAK  FE++  D  +P  ++ R+Q++L NI AS
Sbjct: 181 KAGDFTKAKQWFEQIVSDAQAPRNVTNRAQIMLDNITAS 219


>gi|240850056|ref|YP_002971449.1| hypothetical protein Bgr_04400 [Bartonella grahamii as4aup]
 gi|240267179|gb|ACS50767.1| hypothetical protein Bgr_04400 [Bartonella grahamii as4aup]
          Length = 223

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 107/194 (55%), Gaps = 4/194 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
           A L ILMI++  I+ +       KK   +G+ F ++L+  ++   D A    E + +   
Sbjct: 34  AILFILMIVAYQIYHH----QQIKKAGYIGDAFVKSLDFADTRHFDKAIKQLETVKTSHF 89

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y  L+ +  AS+L+ KGD   + EIF  VA D+ AP  ++  A ++AA ILVDT +  
Sbjct: 90  GGYPFLARLREASLLMEKGDIIKSVEIFDSVAADEKAPEILQKVAKIRAAYILVDTGTLA 149

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
           ++ K ++ ++  ++PMH  A E LG++A K  K+ +A   F+++++       I+ R+++
Sbjct: 150 DVEKRIKDMTSDTDPMHMSAREALGLAAYKADKMDEAVYYFKKISEKGALGSKITDRARI 209

Query: 205 ILANIIASDQRNKK 218
           +L  I A  + NK+
Sbjct: 210 MLELIQAEGKANKE 223


>gi|304391251|ref|ZP_07373195.1| putative tetratricopeptide repeat protein [Ahrensia sp. R2A130]
 gi|303296607|gb|EFL90963.1| putative tetratricopeptide repeat protein [Ahrensia sp. R2A130]
          Length = 228

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 102/189 (53%), Gaps = 2/189 (1%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           I  L + ++L++++W Y+ + S  K+    G+ F  A+ L    K ++A ++ EK+ ++ 
Sbjct: 30  IIALAVAIVLAVSVWRYM-EYSAAKEAAASGDAFMSAVALAEDGKTEEAIAALEKLEAEH 88

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y  ++ +  AS L  +G  K A   +  V  D++A   +R  A L+A  ++VD  + 
Sbjct: 89  GGAYGAMAQLRAASELAKQGQKKEAIAAYDVVVADNMADEDLRSIARLRAGYLMVDEGTV 148

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           E++S  +  LS P  P    A E LG++  K G + KA   F+E+AKD N+P  I  R  
Sbjct: 149 EDVSSRVTSLSAPGAPYRSSALEALGLAYFKAGDLDKAFAQFDEIAKDANAPASIGQRVT 208

Query: 204 MILANIIAS 212
           ++L ++IA+
Sbjct: 209 IML-DVIAA 216


>gi|163867848|ref|YP_001609052.1| hypothetical protein Btr_0618 [Bartonella tribocorum CIP 105476]
 gi|161017499|emb|CAK01057.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 223

 Score = 92.4 bits (228), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 109/191 (57%), Gaps = 1/191 (0%)

Query: 28  LILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLY 87
           ++L IL + I+  ++  +  KK + VG+ F ++LEL ++   D A    E +       Y
Sbjct: 34  VLLFILMITIY-QIYHHTQIKKASYVGDAFVKSLELADTRHFDKAIKQLENVRDSHFGGY 92

Query: 88  NPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEIS 147
             L+ +  AS+L+ +GD   + EIF  VA D+ AP  +R  A ++AA +LVD+ + +++ 
Sbjct: 93  PFLARLREASLLMEQGDFIKSVEIFDSVAADEKAPQILRKVAKIRAAYLLVDSGTLDDVK 152

Query: 148 KILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
           K ++ ++   +PM   A E LG++A K GKV +A   F++++++      I+ R++++L 
Sbjct: 153 KRVKDMTSDIDPMRMSAREALGLAAYKAGKVDEAVDYFQKISEEGVLRSNITDRARIMLE 212

Query: 208 NIIASDQRNKK 218
            + A  + NK+
Sbjct: 213 LMQAEGKVNKE 223


>gi|319404572|emb|CBI78178.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 223

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 100/170 (58%)

Query: 49  KKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNA 108
           K N VG+ F  +L+L +++  D+A    E +   +   Y  L+ +  AS+   +GD   +
Sbjct: 54  KANNVGDIFITSLDLADAHHFDEAIKKLESVKQSNFGGYPFLAGLLEASLWTQRGDNAKS 113

Query: 109 AEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL 168
            +IF  +A D+ AP  +R  A ++AA IL+D  +++++ + +++++   +PM   A E L
Sbjct: 114 VKIFDMIAADEKAPQILREVAKIRAAYILIDIGTFDDVMQRVKEMANDIDPMRMSAREAL 173

Query: 169 GISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           G++A K  K++KA   F+++ ++N   F I+ R++++L  I AS + NK+
Sbjct: 174 GLAAYKANKMEKAVYYFKKIVEENALGFKITDRAKIMLELIQASGKVNKE 223


>gi|218661714|ref|ZP_03517644.1| hypothetical protein RetlI_20621 [Rhizobium etli IE4771]
          Length = 213

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 92/172 (53%), Gaps = 3/172 (1%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           +A +LI++  +  + F  +D   + + +  G+ F  A++L + NK D+A ++  K+  + 
Sbjct: 34  VAAVLIVVGTAGKVLFEYWD---DTRSSGAGDQFLAAMKLADENKNDEALAALGKLEKEG 90

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
           +  Y  L+ M  A++   KGD   A   F ++  D+  P AVR AA ++A  +L++  SY
Sbjct: 91  HGAYPVLARMRAATVQAQKGDANAAITAFNEIGKDNSVPAAVRDAARMRAGWLLIENGSY 150

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSP 195
           E++S  +++++ P N     A E LG+++ K G + +A+  F    +    P
Sbjct: 151 EQVSAAVEEMAVPGNAFRHSAREALGLASYKAGNMAQARQWFPVDCRRRRKP 202


>gi|49475206|ref|YP_033247.1| hypothetical protein BH04070 [Bartonella henselae str. Houston-1]
 gi|49238011|emb|CAF27216.1| hypothetical protein BH04070 [Bartonella henselae str. Houston-1]
          Length = 223

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 105/196 (53%), Gaps = 1/196 (0%)

Query: 23  WIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ 82
           W+    I+ +L + I + ++     KK   +G+ F + L+  ++   D+A    E + + 
Sbjct: 29  WVVFAAIIFVLMIVI-YQIYHHVQMKKAGHIGDAFIEVLDFADTRHFDEAMKRLEDVKAS 87

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSS 142
           +   Y  L+ +  AS+L+ +GD   + E+F  +A D+ AP  +R  A ++AA ILVDT S
Sbjct: 88  NFGGYPFLARLREASLLMEQGDAVKSVEVFDSIAADEKAPPILRAVAKIRAAYILVDTGS 147

Query: 143 YEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRS 202
            +++ K ++ ++     M   A E LG++A K  K+ +A   F +++K+      I+ R+
Sbjct: 148 LDDVKKRVKDMANDLGSMRMSAREALGLAAYKADKMDEAVDYFRKISKEGALGSKITERA 207

Query: 203 QMILANIIASDQRNKK 218
           +++L  + A  + N++
Sbjct: 208 RIMLELMQAEGKANRE 223


>gi|161618353|ref|YP_001592240.1| hypothetical protein BCAN_A0382 [Brucella canis ATCC 23365]
 gi|254703734|ref|ZP_05165562.1| hypothetical protein Bsuib36_07392 [Brucella suis bv. 3 str. 686]
 gi|260567012|ref|ZP_05837482.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261754379|ref|ZP_05998088.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|161335164|gb|ABX61469.1| Hypothetical protein BCAN_A0382 [Brucella canis ATCC 23365]
 gi|260156530|gb|EEW91610.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261744132|gb|EEY32058.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 223

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 103/198 (52%), Gaps = 5/198 (2%)

Query: 13  KCKMGKCCYKWIAPLLI----LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           + +  K  ++   P LI     ++L  A W   +    + K +  G+ F  AL+L  + K
Sbjct: 15  RSERAKQVWRNFGPALIGAAVAVVLGTAGWVG-YQHWTDSKASASGDKFLAALDLAAAGK 73

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
            D+A ++F  +       Y  L+ + +AS+L  KGD   A + F +++ D+  P  +R  
Sbjct: 74  TDEALAAFTDLEKTGYGSYPVLARLRVASVLADKGDAAAAVKAFDEISADNSVPEPLRNI 133

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +F+ +
Sbjct: 134 ARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKLFKLV 193

Query: 189 AKDNNSPFGISTRSQMIL 206
           A+D+ +P     R+ ++L
Sbjct: 194 AEDSLAPANARQRANIML 211


>gi|23501278|ref|NP_697405.1| hypothetical protein BR0374 [Brucella suis 1330]
 gi|23347165|gb|AAN29320.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 223

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 102/198 (51%), Gaps = 5/198 (2%)

Query: 13  KCKMGKCCYKWIAPLLI----LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           + +  K  ++   P LI     ++L  A W   +    + K +  G+ F  AL+L  + K
Sbjct: 15  RSERAKQVWRNFGPALIGVAVAVVLGTAGWVG-YQHWTDSKASASGDKFLAALDLAAAGK 73

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
            D+A ++F  +       Y  L+ + +AS+L  KGD   A + F +++ D+  P  +R  
Sbjct: 74  TDEALAAFTDLEKTGYGSYPVLARLRVASVLADKGDAAAAVKAFDEISADNSVPEPLRNI 133

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +F+ +
Sbjct: 134 ARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKLFKLV 193

Query: 189 AKDNNSPFGISTRSQMIL 206
           A+D  +P     R+ ++L
Sbjct: 194 AEDGLAPANARQRANIML 211


>gi|319407563|emb|CBI81213.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 223

 Score = 85.9 bits (211), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 101/170 (59%)

Query: 49  KKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNA 108
           K N VG+ F  +L+L +++  D+A    E +   +   Y  L+ +  AS+ + +GD   +
Sbjct: 54  KANNVGDIFMTSLDLADAHHFDEAIKKLESVKQSNFGGYPFLAGLREASLWMERGDNAKS 113

Query: 109 AEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL 168
            ++F  +A D+ AP  +R  A ++AA ILVD  +++++ + +++++   +PM   A E L
Sbjct: 114 VKMFDMIAADEKAPQILREVAKIRAAYILVDIGTFDDVMQRVKEIANDIDPMRMSAREAL 173

Query: 169 GISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           G++A K  K++KA   F+++ ++N   F I+ R++++L  I A+ + NK+
Sbjct: 174 GLAAYKENKMEKAVYYFKKIVEENALGFKITDRAKIMLELIQANGKVNKE 223


>gi|319408189|emb|CBI81842.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 223

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 114/216 (52%), Gaps = 2/216 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    K +   G+  +  I   +I  +L++A++     G   K   I G+ F  +L
Sbjct: 9   EVNEELRQEKVRAFWGRYSFLIIVSAIIF-VLAIAVYQIYHYGQMNKASKI-GDTFITSL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L +S + D+A +  E + + D   Y  L+ +  AS+L+ +G+   + E+F  VA D  A
Sbjct: 67  NLADSLQFDEAMNQLESVKTSDFGGYPFLARLREASLLMQQGNAVKSVEVFDAVAADKNA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  ++  A ++A+ ILVD  +++++ K +  ++   +PM   A E+LG++A K  K+  A
Sbjct: 127 PQILQRVAKIRASYILVDIGTFDDVKKRVNDMANDIDPMRMSAREVLGLAAYKANKIDDA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
              F++++++N     I  R++++L  I +  + NK
Sbjct: 187 IYYFQKISEENVLGLKIIDRAKIMLELIQSERKVNK 222


>gi|319899215|ref|YP_004159308.1| hypothetical protein BARCL_1057 [Bartonella clarridgeiae 73]
 gi|319403179|emb|CBI76738.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 223

 Score = 85.1 bits (209), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 107/190 (56%), Gaps = 1/190 (0%)

Query: 30  LMILSLAIWFY-LFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYN 88
           +++  L I FY ++      K + VG+ F ++L+L +++  D+A    E +   D   Y 
Sbjct: 34  IIVFVLMIAFYQIYHHQQMNKASNVGDKFIKSLDLADAHHFDEAIKQLESVKKSDFGGYP 93

Query: 89  PLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISK 148
            L+ +  AS+ + +GD   + ++F  +  ++ AP  +R  A ++AA ILVD  +++++ +
Sbjct: 94  FLAGLREASLWMERGDAVKSVKMFDVIVANERAPQILRKVAKIRAAYILVDIGTFDDVIQ 153

Query: 149 ILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILAN 208
            ++ ++   +PM   A E LG++A K  K++ A   F+++ ++    F I+ R++++L  
Sbjct: 154 RVKDMANDIDPMRMSAREALGLAAYKANKMENAVYYFQKIVEEGAIGFKITDRAKIMLEL 213

Query: 209 IIASDQRNKK 218
           I AS + NK+
Sbjct: 214 IQASGKVNKE 223


>gi|121602031|ref|YP_988692.1| hypothetical protein BARBAKC583_0373 [Bartonella bacilliformis
           KC583]
 gi|120614208|gb|ABM44809.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 223

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 109/197 (55%), Gaps = 10/197 (5%)

Query: 25  APLLILMILSLAIWFYLFDGSHEK---KKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           A + IL I+   ++      SH+K    +NI G+ F ++L L +S+  D A +  E + +
Sbjct: 34  AIIFILAIVGYQVY------SHKKMNEARNI-GDIFIKSLSLADSHDFDQAMNQLELVKA 86

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y  L+ +  AS+L  +GD   A E+F  VA D+ AP  ++  A +QAA ILVD  
Sbjct: 87  SNFAGYPFLARLREASLLSEQGDAVRAVEMFDTVAFDEKAPQILQKVAKIQAAYILVDIG 146

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
           + +++ K +Q ++   +PM   A E LG++A K  K+ +A   F++++++ N    I  R
Sbjct: 147 TLDDVKKRVQDIANDIDPMRISAREALGLAAYKADKMDEAVYYFQKISEEGNLGIKIVER 206

Query: 202 SQMILANIIASDQRNKK 218
           ++++L  I A  + NK+
Sbjct: 207 AKIMLELIQAEGKVNKE 223


>gi|163842661|ref|YP_001627065.1| hypothetical protein BSUIS_A0405 [Brucella suis ATCC 23445]
 gi|163673384|gb|ABY37495.1| Hypothetical protein BSUIS_A0405 [Brucella suis ATCC 23445]
          Length = 223

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 102/198 (51%), Gaps = 5/198 (2%)

Query: 13  KCKMGKCCYKWIAPLLI----LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           + +  K  ++   P LI     ++L  A W   +    + K +  G+ F  AL+L  + K
Sbjct: 15  RSERAKQVWRNFGPALIGAAVAVVLGTAGWVG-YQHWTDSKASASGDKFLAALDLAAAGK 73

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
            D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  +R  
Sbjct: 74  TDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPLRNI 133

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +F+ +
Sbjct: 134 ARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKGERFDDAAKLFKLV 193

Query: 189 AKDNNSPFGISTRSQMIL 206
           A+D+ +P     R+ ++L
Sbjct: 194 AEDSLAPANARQRANIML 211


>gi|225626892|ref|ZP_03784931.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|254701189|ref|ZP_05163017.1| hypothetical protein Bsuib55_10067 [Brucella suis bv. 5 str. 513]
 gi|254709530|ref|ZP_05171341.1| hypothetical protein BpinB_04507 [Brucella pinnipedialis B2/94]
 gi|254713053|ref|ZP_05174864.1| hypothetical protein BcetM6_06734 [Brucella ceti M644/93/1]
 gi|254716594|ref|ZP_05178405.1| hypothetical protein BcetM_09268 [Brucella ceti M13/05/1]
 gi|254718561|ref|ZP_05180372.1| hypothetical protein Bru83_03299 [Brucella sp. 83/13]
 gi|256031024|ref|ZP_05444638.1| hypothetical protein BpinM2_10279 [Brucella pinnipedialis
           M292/94/1]
 gi|256060516|ref|ZP_05450685.1| hypothetical protein Bneo5_09218 [Brucella neotomae 5K33]
 gi|256368831|ref|YP_003106337.1| hypothetical protein BMI_I379 [Brucella microti CCM 4915]
 gi|260168156|ref|ZP_05754967.1| hypothetical protein BruF5_07294 [Brucella sp. F5/99]
 gi|261218393|ref|ZP_05932674.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261317056|ref|ZP_05956253.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261320758|ref|ZP_05959955.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261324510|ref|ZP_05963707.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261751726|ref|ZP_05995435.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261757614|ref|ZP_06001323.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265983536|ref|ZP_06096271.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265988094|ref|ZP_06100651.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|294851759|ref|ZP_06792432.1| hypothetical protein BAZG_00674 [Brucella sp. NVSL 07-0026]
 gi|306837297|ref|ZP_07470180.1| Hypothetical protein BROD_0083 [Brucella sp. NF 2653]
 gi|225618549|gb|EEH15592.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|255998989|gb|ACU47388.1| hypothetical protein BMI_I379 [Brucella microti CCM 4915]
 gi|260923482|gb|EEX90050.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293448|gb|EEX96944.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296279|gb|EEX99775.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261300490|gb|EEY03987.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261737598|gb|EEY25594.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261741479|gb|EEY29405.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|264660291|gb|EEZ30552.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264662128|gb|EEZ32389.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294820348|gb|EFG37347.1| hypothetical protein BAZG_00674 [Brucella sp. NVSL 07-0026]
 gi|306407610|gb|EFM63806.1| Hypothetical protein BROD_0083 [Brucella sp. NF 2653]
          Length = 223

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 102/198 (51%), Gaps = 5/198 (2%)

Query: 13  KCKMGKCCYKWIAPLLI----LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           + +  K  ++   P LI     ++L  A W   +    + K +  G+ F  AL+L  + K
Sbjct: 15  RSERAKQVWRNFGPALIGAAVAVVLGTAGWVG-YQHWTDSKASASGDKFLAALDLAAAGK 73

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
            D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  +R  
Sbjct: 74  TDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPLRNI 133

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +F+ +
Sbjct: 134 ARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKLFKLV 193

Query: 189 AKDNNSPFGISTRSQMIL 206
           A+D+ +P     R+ ++L
Sbjct: 194 AEDSLAPANARQRANIML 211


>gi|256159078|ref|ZP_05456907.1| hypothetical protein BcetM4_09251 [Brucella ceti M490/95/1]
 gi|256254427|ref|ZP_05459963.1| hypothetical protein BcetB_09088 [Brucella ceti B1/94]
 gi|261221595|ref|ZP_05935876.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265997558|ref|ZP_06110115.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260920179|gb|EEX86832.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262552026|gb|EEZ08016.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 223

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 102/198 (51%), Gaps = 5/198 (2%)

Query: 13  KCKMGKCCYKWIAPLLI----LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           + +  K  ++   P LI     ++L  A W   +    + K +  G+ F  AL+L  + K
Sbjct: 15  RSERAKQVWRNFGPALIGAAVAVVLGTAGWAG-YQHWTDSKASASGDKFLAALDLAAAGK 73

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
            D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  +R  
Sbjct: 74  TDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPLRNI 133

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +F+ +
Sbjct: 134 ARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKLFKLV 193

Query: 189 AKDNNSPFGISTRSQMIL 206
           A+D+ +P     R+ ++L
Sbjct: 194 AEDSLAPANARQRANIML 211


>gi|306842333|ref|ZP_07474992.1| Hypothetical protein BIBO2_2108 [Brucella sp. BO2]
 gi|306845010|ref|ZP_07477591.1| Hypothetical protein BIBO1_1695 [Brucella sp. BO1]
 gi|306274642|gb|EFM56431.1| Hypothetical protein BIBO1_1695 [Brucella sp. BO1]
 gi|306287549|gb|EFM59008.1| Hypothetical protein BIBO2_2108 [Brucella sp. BO2]
          Length = 223

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 102/198 (51%), Gaps = 5/198 (2%)

Query: 13  KCKMGKCCYKWIAPLLI----LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           + +  K  ++   P LI     ++L  A W   +    + K +  G+ F  AL+L  + K
Sbjct: 15  RSERAKQVWRNFGPALIGAAVAVVLGTAGWVG-YQHWTDSKASASGDKFLAALDLAAAGK 73

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
            D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  +R  
Sbjct: 74  TDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPLRNI 133

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +F+ +
Sbjct: 134 ARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAVKLFKLV 193

Query: 189 AKDNNSPFGISTRSQMIL 206
           A+D+ +P     R+ ++L
Sbjct: 194 AEDSLAPANARQRANIML 211


>gi|148559135|ref|YP_001258405.1| hypothetical protein BOV_0389 [Brucella ovis ATCC 25840]
 gi|148370392|gb|ABQ60371.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 223

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 102/198 (51%), Gaps = 5/198 (2%)

Query: 13  KCKMGKCCYKWIAPLLI----LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           + +  K  ++   P LI     ++L  A W   +    + K +  G+ F  AL+L  + K
Sbjct: 15  RSERAKQVWRNSGPALIGAAVAVVLGTAGWVG-YQHWTDSKASASGDKFLAALDLAAAGK 73

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
            D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  +R  
Sbjct: 74  TDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPLRNI 133

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +F+ +
Sbjct: 134 ARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKLFKLV 193

Query: 189 AKDNNSPFGISTRSQMIL 206
           A+D+ +P     R+ ++L
Sbjct: 194 AEDSLAPANARQRANIML 211


>gi|62289365|ref|YP_221158.1| hypothetical protein BruAb1_0400 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699290|ref|YP_413864.1| hypothetical protein BAB1_0404 [Brucella melitensis biovar Abortus
           2308]
 gi|189023619|ref|YP_001934387.1| hypothetical protein BAbS19_I03740 [Brucella abortus S19]
 gi|237814854|ref|ZP_04593852.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254688682|ref|ZP_05151936.1| hypothetical protein Babob68_00559 [Brucella abortus bv. 6 str.
           870]
 gi|254693166|ref|ZP_05154994.1| hypothetical protein Babob3T_00550 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696809|ref|ZP_05158637.1| hypothetical protein Babob28_03613 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254707886|ref|ZP_05169714.1| hypothetical protein BpinM_13191 [Brucella pinnipedialis
           M163/99/10]
 gi|254729716|ref|ZP_05188294.1| hypothetical protein Babob42_00560 [Brucella abortus bv. 4 str.
           292]
 gi|256256929|ref|ZP_05462465.1| hypothetical protein Babob9C_06139 [Brucella abortus bv. 9 str.
           C68]
 gi|260545881|ref|ZP_05821622.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260754158|ref|ZP_05866506.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260757378|ref|ZP_05869726.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761202|ref|ZP_05873545.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883183|ref|ZP_05894797.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261213404|ref|ZP_05927685.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261315377|ref|ZP_05954574.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|297247780|ref|ZP_06931498.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
 gi|62195497|gb|AAX73797.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615391|emb|CAJ10360.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|189019191|gb|ACD71913.1| hypothetical protein BAbS19_I03740 [Brucella abortus S19]
 gi|237789691|gb|EEP63901.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260097288|gb|EEW81163.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260667696|gb|EEX54636.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671634|gb|EEX58455.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674266|gb|EEX61087.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260872711|gb|EEX79780.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915011|gb|EEX81872.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261304403|gb|EEY07900.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|297174949|gb|EFH34296.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
          Length = 223

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 102/198 (51%), Gaps = 5/198 (2%)

Query: 13  KCKMGKCCYKWIAPLLI----LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           + +  K  ++   P LI     ++L  A W   +    + K +  G+ F  AL+L  + K
Sbjct: 15  RSERAKQVWRNFGPALIGAAVAVVLGTAGWVG-YQHWTDSKASASGDKFLAALDLAAAGK 73

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
            D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  +R  
Sbjct: 74  TDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPLRNI 133

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+A  +LVD  SY+++++ ++ LS   NPM   A E LG++A K  +   A  +F+ +
Sbjct: 134 ARLRAGYLLVDNGSYDDVAERVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKLFKLV 193

Query: 189 AKDNNSPFGISTRSQMIL 206
           A+D+ +P     R+ ++L
Sbjct: 194 AEDSLAPANARQRANIML 211


>gi|49473956|ref|YP_031998.1| hypothetical protein BQ03100 [Bartonella quintana str. Toulouse]
 gi|49239459|emb|CAF25810.1| hypothetical protein BQ03100 [Bartonella quintana str. Toulouse]
          Length = 223

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 107/196 (54%), Gaps = 5/196 (2%)

Query: 24  IAPLLILMILSL-AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ 82
           +A ++ ++I+++  I+ Y       KK   +G+ F + L+  ++   D+A    + + + 
Sbjct: 32  VAAIIFVLIIAIHQIYHY----EQMKKAGHIGDAFMKVLDFADTRHFDEAMKQLKNVKAS 87

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSS 142
           +   Y  L+ M+ AS+L+ +GD   + E F  VA D+ AP  +R  A ++AA ILVDT +
Sbjct: 88  NFGGYPFLARMHEASLLMEQGDAVKSVEAFDSVAADEKAPPILRKVAKIRAAYILVDTGT 147

Query: 143 YEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRS 202
            +++ K ++ +    +PM   A E LG++A K  K+ +A   F +++K+       + R+
Sbjct: 148 LDDVKKRVKDMENDIDPMRMSAREALGLAAYKADKMDEAVDYFRKISKEGVLGSKATERA 207

Query: 203 QMILANIIASDQRNKK 218
           +++L  + A  + +K+
Sbjct: 208 RIMLELMQAEGKADKE 223


>gi|17987834|ref|NP_540468.1| hypothetical protein BMEI1551 [Brucella melitensis bv. 1 str. 16M]
 gi|225851917|ref|YP_002732150.1| hypothetical protein BMEA_A0411 [Brucella melitensis ATCC 23457]
 gi|256044099|ref|ZP_05447010.1| hypothetical protein Bmelb1R_06372 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112897|ref|ZP_05453813.1| hypothetical protein Bmelb3E_09470 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256264571|ref|ZP_05467103.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260563457|ref|ZP_05833943.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265990511|ref|ZP_06103068.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994339|ref|ZP_06106896.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17983562|gb|AAL52732.1| hypothetical membrane associated protein [Brucella melitensis bv. 1
           str. 16M]
 gi|225640282|gb|ACO00196.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|260153473|gb|EEW88565.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|262765452|gb|EEZ11241.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001295|gb|EEZ13870.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094936|gb|EEZ18644.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408415|gb|ADZ65480.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538129|gb|ADZ86344.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 223

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 101/198 (51%), Gaps = 5/198 (2%)

Query: 13  KCKMGKCCYKWIAPLLI----LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           + +  K  ++   P LI     ++L  A W   +    + K +  G+ F  AL+L  + K
Sbjct: 15  RSERAKQVWRNFGPALIGAAVAVVLGTAGWVG-YQHWTDSKASASGDKFLAALDLAAAGK 73

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
            D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P   R  
Sbjct: 74  TDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPSRNI 133

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+A  +LVD  SY+++++ ++ LS   NPM   A E LG++A K  +   A  +F+ +
Sbjct: 134 ARLRAGYLLVDNGSYDDVAERVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKLFKLV 193

Query: 189 AKDNNSPFGISTRSQMIL 206
           A+D+ +P     R+ ++L
Sbjct: 194 AEDSLAPANARQRANIML 211


>gi|296284227|ref|ZP_06862225.1| hypothetical protein CbatJ_11411 [Citromicrobium bathyomarinum
           JL354]
          Length = 267

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 94/191 (49%), Gaps = 2/191 (1%)

Query: 23  WIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ 82
           +I  +++L +L+ A   + F G  E  +    E    AL+   +  LD A  +   +   
Sbjct: 50  YIIGVVLLGLLAFAAVLF-FSGQSEGNRESESETLVTALDQVEAGNLDQADEALAPLAED 108

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSS 142
                   + M  A I + +G  K AAE+F +VA D+  P ++R  A L+A     D+  
Sbjct: 109 GRGGGKTQAQMLRAGIALEQGRAKEAAELFGQVAADEDVPQSIRDLAELRAVVAGYDSMK 168

Query: 143 YEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRS 202
             E+ + L  L++P  P +  A EIL ++ L+ G  ++A  +F E+A D++ P  I  R+
Sbjct: 169 PAEVIRRLTPLAQPDQPYYGSAGEILAMAYLEGGDKERAGKLFGEIAMDDDVPDTIRGRA 228

Query: 203 QMILANIIASD 213
           +  +A+++  D
Sbjct: 229 RQ-MASVLGVD 238


>gi|312114897|ref|YP_004012493.1| hypothetical protein Rvan_2169 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220026|gb|ADP71394.1| hypothetical protein Rvan_2169 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 239

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 79/148 (53%)

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           A+ L    K  +A  +   +       Y  L+ ++ AS  +A+     AAE +  VA+D+
Sbjct: 66  AITLHEDGKEAEAEKALADLAGSGPGAYRVLARLHAASESLAQKKYDQAAEDYRGVASDE 125

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
            AP  +R  A +Q A++ VD  SYE +S+ L      ++     A ++LGI+A K GK  
Sbjct: 126 NAPATLRDFARVQIAALSVDKESYESLSQTLAPYRSGTSEWRFAAKDVLGIAAFKEGKRD 185

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMILA 207
           +A+ IF E+A D  +P G+  R+Q++LA
Sbjct: 186 EAERIFGEIASDGAAPAGMRQRAQIMLA 213


>gi|90418691|ref|ZP_01226602.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336771|gb|EAS50476.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 360

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 102/189 (53%), Gaps = 3/189 (1%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           +A ++++++++ A+    +D     + N  G+ +  AL+L    K D+A ++ + + +  
Sbjct: 31  LAAVILVVVITAAV--VGWDRYQTAQANASGDAYLAALQLARDGKPDEAITALDALAADS 88

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y  L+ M I  +  A+G    A   F KVA D  AP A+R  A ++AA +LVD  + 
Sbjct: 89  YGAYPDLARMSIGGVYQAQGKFDEAVAAFDKVAADAGAPDALRDMAAVRAAYVLVDHGAL 148

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
            ++   +++L+  S  +   A E + ++A K    + A  +F++L  D  +P GI +R++
Sbjct: 149 SDVRSRVERLTGDSEALRFPAREAVALAAWKAEDTETATMLFQQLVDDPGAPNGIISRAR 208

Query: 204 MILANIIAS 212
           ++L ++IA+
Sbjct: 209 LML-DLIAA 216


>gi|114704715|ref|ZP_01437623.1| hypothetical protein FP2506_07261 [Fulvimarina pelagi HTCC2506]
 gi|114539500|gb|EAU42620.1| hypothetical protein FP2506_07261 [Fulvimarina pelagi HTCC2506]
          Length = 390

 Score = 78.2 bits (191), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 92/178 (51%), Gaps = 1/178 (0%)

Query: 29  ILMILSLAIWFYLFDGSHE-KKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLY 87
           +++I+ LA   Y+    +   + N  G+ +  A +L     +D A  +F  I    +  Y
Sbjct: 33  VVLIVILATGAYVGWQRYSIAQANATGDRYLAAQDLVREGDIDGAIEAFRAIAEDGSGAY 92

Query: 88  NPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEIS 147
             L+ M IA+     G  ++A   +  VAND   P ++R  A L+AA +LVD  S +++ 
Sbjct: 93  PELAQMSIANAEAEAGRNEDAIASYEAVANDSSVPESLREMADLRAAYLLVDHGSLDDVR 152

Query: 148 KILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
              ++L+   NP+   A + +G++A K G  + A+ +++ + +  ++P GIS R+ +I
Sbjct: 153 ARAERLTGDDNPLRYAARDAIGLAAWKAGDTETARDLYQSILEAGDAPNGISQRAGLI 210


>gi|209885508|ref|YP_002289365.1| hypothetical protein OCAR_6387 [Oligotropha carboxidovorans OM5]
 gi|209873704|gb|ACI93500.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 214

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 95/181 (52%), Gaps = 4/181 (2%)

Query: 27  LLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKL 86
           + +++I++ A  + L+     +K    G+ F  AL L +  +   A ++FEKI +   + 
Sbjct: 30  IAVVLIVAAAGGWRLYQHFETQKAEEAGKAFQSALALTDPAQ---AEAAFEKIAASKARG 86

Query: 87  YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEI 146
           Y+ L+ + +A   V K D K A   +  +AND      VR  A ++AA++++DT+SY+EI
Sbjct: 87  YSMLARLQVAGEAV-KQDPKKAIAAYDVIANDGSLDAPVREIARIRAANLMLDTASYDEI 145

Query: 147 SKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMIL 206
            K LQ  +  +N     A E+L +SA +   V+ A+   + +  D  SP  +  R++ + 
Sbjct: 146 EKRLQGDATGTNTFRHSAREVLALSAWRANNVEAARRWIDMIGNDPQSPATLRRRAEALG 205

Query: 207 A 207
           A
Sbjct: 206 A 206


>gi|118588126|ref|ZP_01545536.1| hypothetical protein SIAM614_11133 [Stappia aggregata IAM 12614]
 gi|118439748|gb|EAV46379.1| hypothetical protein SIAM614_11133 [Stappia aggregata IAM 12614]
          Length = 227

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 98/195 (50%), Gaps = 13/195 (6%)

Query: 23  WIAPLLILMILSLAI---WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKI 79
           W+  + +L+++       W Y      E++    G+ F +A++L  +   ++A + + ++
Sbjct: 27  WVLGVAVLIVVGTGGYRGWLYW----QEQQSQSAGDTFFEAVKLSEAQNYEEAAALYGEL 82

Query: 80  LSQDNKL--YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
              DN L  Y  L+ +  A+ L   G T+ A   F  ++ D     A+R  A L+AA + 
Sbjct: 83  ---DNALGGYPALAKLRQATDLSNSGKTEEALAEFDALSRDSSIMEALRDVAALRAAYLA 139

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
           VDT SY +I+  ++KL+  + P    A E+L +SA K G ++ AK     + +D  +P  
Sbjct: 140 VDTQSYGDIADRIEKLTGDTGPFRAAARELLALSAWKAGDIETAKQWISAIEEDTETPAD 199

Query: 198 ISTRSQMILANIIAS 212
           +S R   IL ++I S
Sbjct: 200 VSRRVS-ILGDVIRS 213


>gi|83310441|ref|YP_420705.1| hypothetical protein amb1342 [Magnetospirillum magneticum AMB-1]
 gi|82945282|dbj|BAE50146.1| Uncharacterized protein [Magnetospirillum magneticum AMB-1]
          Length = 227

 Score = 75.5 bits (184), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 90/176 (51%), Gaps = 3/176 (1%)

Query: 42  FDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVA 101
           + G   K++      +++   L    K D+A     K+ ++  K Y  L+++  A +   
Sbjct: 54  WQGWEAKQRQAASARYSETAALIEQGKKDEAVEVLNKLSAEGPKGYRLLADLRKADMAQQ 113

Query: 102 KGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMH 161
            GD   AA ++ K+A D       R  +T++AA +++D+     I K ++ L+  ++   
Sbjct: 114 AGDFTGAAALYGKIAADTSVDKVYRDMSTIRAAYLVLDSGDVAAIEKSVEPLAAEASSWR 173

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
             A EIL ++ALK G+  +A  +F ++A+D  +P G+ TR+  +LA   A+ QR +
Sbjct: 174 HSAREILALAALKRGETPRAAELFAKIAEDAAAPQGLRTRAAEMLA---ATGQRAR 226


>gi|254420734|ref|ZP_05034458.1| hypothetical protein BBAL3_3044 [Brevundimonas sp. BAL3]
 gi|196186911|gb|EDX81887.1| hypothetical protein BBAL3_3044 [Brevundimonas sp. BAL3]
          Length = 248

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 96/197 (48%), Gaps = 3/197 (1%)

Query: 18  KCCYKWIAPLLILMILSL--AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSS 75
           +    W+  + ++++++L  A+ ++ +D  +  K     E + + +E   + K  +AR +
Sbjct: 19  RLARTWLPVVGVILVVALVAALGWWGWDSLNSSKAAKGAEAYDRGMEALRAEKPAEARLA 78

Query: 76  FEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAAS 135
           FE+ + + N  Y  L+    A + V      +A  +F + A     P+ +   A  +AA 
Sbjct: 79  FEETVKEGNDAYKVLALQQQAGLAVTADKIPDAVRLFDQAAKTSSDPI-LSDPAAFKAAL 137

Query: 136 ILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSP 195
           +++DT+   +I   L  L+E   P+H FA E L ++ L+ GK ++A+  F  L    + P
Sbjct: 138 LIMDTAPLADIEARLTPLAEDKRPLHAFAQEALALARLQHGKTKEAREAFVLLQLGQDVP 197

Query: 196 FGISTRSQMILANIIAS 212
             +  R+ + +A I A 
Sbjct: 198 DDVRQRANIAVATIDAG 214


>gi|149186033|ref|ZP_01864348.1| hypothetical protein ED21_24906 [Erythrobacter sp. SD-21]
 gi|148830594|gb|EDL49030.1| hypothetical protein ED21_24906 [Erythrobacter sp. SD-21]
          Length = 259

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 95/191 (49%), Gaps = 7/191 (3%)

Query: 26  PLLILMILSLAIWF-YLF-DGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           PLL ++ L LA +  YL+ D   E      GE     L+   +  +D A    +    + 
Sbjct: 49  PLLGVVALGLAAFGGYLYWDQQQESTMERSGEELVTILDQLEAGNIDTATGQLDGFDGEG 108

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
           +   +  + +  A I   +G+T+ AA +F +VA+D+ AP A+R  A ++  +++ D    
Sbjct: 109 SPAIS--AKLLRAGIAADEGETQKAATLFGEVADDENAPEALRNLALVRRTALMFDEMGP 166

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           +E+   ++ L+ P  P    A E++  + L   K  +A  +F E+A+D N+P     R++
Sbjct: 167 DEVIAAMKPLAVPGEPFFTSAGELVAHAYLAQDKRAEAGALFAEIARDENTPE--VARAR 224

Query: 204 MI-LANIIASD 213
           M+ +A I+  D
Sbjct: 225 MLNMAGILGVD 235


>gi|46201386|ref|ZP_00055151.2| COG2976: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 227

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 90/179 (50%), Gaps = 3/179 (1%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  + G   K++      + +   L    K D+A     K+ ++  K Y  L+++  A +
Sbjct: 51  WQAWQGWDAKQRQAASARYLETSSLIEQGKKDEAAEVLGKLSAEGPKGYRLLADLRRADM 110

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            +  GD   AA ++ KVA D       R  A ++AA + +D   +  + K ++ L+  ++
Sbjct: 111 ALQAGDAAGAAALYGKVAADTSVDKVYRDMAVIRAAYLTLDGGDFATMEKSVEPLAAEAS 170

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           P    A EIL ++ALK G+  +A  +F ++A+D  +P G+ TR+  +LA   A+ QR +
Sbjct: 171 PWRHSAREILALAALKRGETPRAAELFAKIAEDAAAPQGLRTRAAEMLA---ATGQRAR 226


>gi|83945264|ref|ZP_00957613.1| hypothetical protein OA2633_00815 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851434|gb|EAP89290.1| hypothetical protein OA2633_00815 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 253

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 91/179 (50%), Gaps = 2/179 (1%)

Query: 23  WIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ 82
           W+      ++L +  + ++ + S +++ +   E +  A EL+ +  L  A S F+ ++  
Sbjct: 27  WVGGAAAAIVLGVGAYQFM-EWSSKQRADAASEQYQAAAELYEAGNLLQADSQFQALVES 85

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSS 142
             + Y  L+ M  A I +++GD + AA +F +       PL +R  A  QAA    D  S
Sbjct: 86  GPRGYETLALMRRAEIALSQGDAEEAARLFNRAGEISPEPL-IRDLARYQAALAQFDQLS 144

Query: 143 YEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
           Y++++  L+ L+E + P+   A E++  +AL+  +  +A+  ++ L+   + P  +S R
Sbjct: 145 YDDLANRLEPLTEGAAPVGLLARELMAAAALRDQRWDEARQRYQLLSVALDLPQAMSQR 203


>gi|158425954|ref|YP_001527246.1| hypothetical protein AZC_4330 [Azorhizobium caulinodans ORS 571]
 gi|158332843|dbj|BAF90328.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 238

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 80/160 (50%), Gaps = 1/160 (0%)

Query: 46  HEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDT 105
            +++       F  A++L +  K  +A ++F  +       Y  L+    A+ L  + D 
Sbjct: 49  QQREAQATSVRFEAAVKLADEGKHQEAEAAFNALAKDAPAGYRALARFRAATELATR-DK 107

Query: 106 KNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFAN 165
             A   F  +A D     A R  A ++AA ILVDT +  ++ + +Q L++ ++P+   A 
Sbjct: 108 AAAVAAFDTLAADTGLTAAERDLARIRAAMILVDTGAVADVKQRVQALADGTSPLRHSAR 167

Query: 166 EILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
           E++ +S  K G ++ A T    + +D  +P+G+ +R+++I
Sbjct: 168 ELIALSQYKAGDLKGANTTASLILEDQETPYGVRSRAELI 207


>gi|115525348|ref|YP_782259.1| hypothetical protein RPE_3347 [Rhodopseudomonas palustris BisA53]
 gi|115519295|gb|ABJ07279.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 217

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 72/135 (53%), Gaps = 1/135 (0%)

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
           NK  +A ++F K+++     Y  L+ + +A+ + A+ DT   A+ F ++A D   P   R
Sbjct: 70  NKHAEAEAAFAKLMATAPSGYRTLARLRLAAEIAAR-DTTAGAKAFDEIAADSAVPAVDR 128

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             A L+AA++L++T+SY ++ + L+  +  +      A E+L +SA + G    A+   E
Sbjct: 129 EVAKLRAATLLLETASYPDMVQRLEPSAAATGTFRHSARELLALSAWRTGDAAAARKWLE 188

Query: 187 ELAKDNNSPFGISTR 201
            +A D  +P  +  R
Sbjct: 189 LIATDAETPSSLRQR 203


>gi|87198965|ref|YP_496222.1| hypothetical protein Saro_0943 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134646|gb|ABD25388.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 253

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 93/196 (47%), Gaps = 10/196 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIV----GENFAQALELFNSNKLDDARSSFE 77
           K +   +I  +L LA W +     +E   N V    GE   +AL+   +  L  A     
Sbjct: 48  KPVGAAIIAGLLGLAGWLW-----YENHNNAVAGEQGEVLTKALDQLETRNLKAAADELG 102

Query: 78  KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
            +    N+ Y   S M  A IL  +G T  AA+ F  +A D  AP A R  AT++  ++ 
Sbjct: 103 PLAKDGNEGYRATSRMLEAGILAEQGKTAEAAKAFAAIAADGGAPQAYRDLATIREVALD 162

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
            D  + +++ + L+ L+ P N     A E++G++ LK GK   A  +F ++AK+   P  
Sbjct: 163 FDKLAPDKVVERLKPLAVPGNAWFGNAGELVGVAYLKQGKNDLAGALFAQIAKEKTVPDS 222

Query: 198 ISTRSQMILANIIASD 213
           +  R++  +A ++  D
Sbjct: 223 LRRRARQ-MAGMLGVD 237


>gi|218507875|ref|ZP_03505753.1| hypothetical protein RetlB5_09820 [Rhizobium etli Brasil 5]
          Length = 160

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 74/130 (56%), Gaps = 3/130 (2%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           +A +LI++  +  +   L+D   + + +  G+ F  A++L + NK D+A ++ +K+  + 
Sbjct: 34  VAAILIVVGTAGKV---LYDYWDDTRSSGAGDQFLAAMKLADENKNDEALAALDKLEKEG 90

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
           +  Y  L+ M  A++   KGD   A   F ++  D+  P AVR AA ++A  +L++  SY
Sbjct: 91  HGAYPVLARMRAATVQAQKGDANAAIAAFNEIGKDNGVPAAVRDAARMRAGWLLIENGSY 150

Query: 144 EEISKILQKL 153
           E++S  ++++
Sbjct: 151 EQVSAAIEEM 160


>gi|326386675|ref|ZP_08208297.1| hypothetical protein Y88_2569 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208990|gb|EGD59785.1| hypothetical protein Y88_2569 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 262

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 75/148 (50%)

Query: 54  GENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL 113
           GE  A AL+   + + D AR+S  +I +     +   S +    I + +  + +AA+ F 
Sbjct: 92  GEQMAIALDQVEAGRYDAARTSLAQIAATGGAGFRAASQLVTGGIALDQHKSADAAKAFG 151

Query: 114 KVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
            VA D  AP   R  AT++  +   DT   +++   L+ L+ P NP    A E+LG++ +
Sbjct: 152 AVAADGSAPQVYRDLATVREVAAQFDTMQPQQVVDRLKPLAVPGNPWFGSAGEMLGVAYM 211

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTR 201
           K GK  +A ++F  +AKD + P  +  R
Sbjct: 212 KMGKNDQAASLFAAIAKDKSVPDSLRGR 239


>gi|260753036|ref|YP_003225929.1| hypothetical protein Za10_0798 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258552399|gb|ACV75345.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 254

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 95/196 (48%), Gaps = 12/196 (6%)

Query: 18  KCCYKWIAP-LLILMILSLAIWFYLFDGSHEKKKNIV---GENFAQAL-ELFNSNKLDDA 72
           +C    IA  LL++ + S+  W Y     H  K+  +   G+  A A+  +    ++ D 
Sbjct: 40  RCITAAIAVILLVVGVGSIGCWSY-----HRHKQEAINSRGDALAAAIAPVIQGGQVKDV 94

Query: 73  RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQ 132
            ++ +K+++ ++ +Y  L     A +L  KGD K+A  ++  V ND  A   +   ATL 
Sbjct: 95  -ATLDKLIASNDPVYANLGRFLKAGVLSDKGDVKSATALYQTVLNDPAAGDILHAVATLH 153

Query: 133 AASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
            ++I +DT   E + K LQ L  P +     A E+   + LK  K ++A  I++ +  D 
Sbjct: 154 LSAIELDTVPPENVIKRLQPLVAPGSRWLGSAGEMQAAAYLKENKPEQAVKIYQRIYSDT 213

Query: 193 NSPFGISTRSQMILAN 208
           + P  I  R++  LAN
Sbjct: 214 SVPEDIRERAKS-LAN 228


>gi|283856260|ref|YP_162184.2| hypothetical protein ZMO0449 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775255|gb|AAV89073.2| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 254

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 94/196 (47%), Gaps = 12/196 (6%)

Query: 18  KCCYKWIAP-LLILMILSLAIWFYLFDGSHEKKKNIV---GENFAQAL-ELFNSNKLDDA 72
           +C    IA  LL++ +  +  W Y     H  K+  +   G+  A A+  +    ++ D 
Sbjct: 40  RCITAAIAVILLVVGVGGIGCWSY-----HRHKQEAINSRGDALAAAIAPVIQGGQVKDV 94

Query: 73  RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQ 132
            ++ +K+++ ++ +Y  L     A IL  KGD K+A  ++  V ND  A   +   ATL 
Sbjct: 95  -ATLDKLIASNDPVYANLGRFLKAGILSDKGDVKSATALYQTVLNDPAAGDILHAVATLH 153

Query: 133 AASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
            ++I +DT   E + K LQ L  P +     A E+   + LK  K ++A  I++ +  D 
Sbjct: 154 LSAIELDTVPPENVIKRLQPLVAPGSRWLGSAGEMQAAAYLKENKPEQAVKIYQRIYSDT 213

Query: 193 NSPFGISTRSQMILAN 208
           + P  I  R++  LAN
Sbjct: 214 SVPEDIRERAKS-LAN 228


>gi|241760998|ref|ZP_04759087.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241374617|gb|EER64078.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 254

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 94/196 (47%), Gaps = 12/196 (6%)

Query: 18  KCCYKWIAP-LLILMILSLAIWFYLFDGSHEKKKNIV---GENFAQAL-ELFNSNKLDDA 72
           +C    IA  LL++ +  +  W Y     H  K+  +   G+  A A+  +    ++ D 
Sbjct: 40  RCITAAIAVILLVVGVGGIGCWSY-----HRHKQEAINSRGDALAAAIAPVIQGGQVKDV 94

Query: 73  RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQ 132
            ++ +K+++ ++ +Y  L     A +L  KGD K+A  ++  V ND  A   +   ATL 
Sbjct: 95  -ATLDKLIASNDPVYANLGRFLKAGVLSDKGDVKSATALYQTVLNDPAAGDILHAVATLH 153

Query: 133 AASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
            ++I +DT   E + K LQ L  P +     A E+   + LK  K ++A  I++ +  D 
Sbjct: 154 LSAIELDTVPPENVIKRLQPLVAPGSRWLGSAGEMQAAAYLKENKPEQAVKIYQRIYSDT 213

Query: 193 NSPFGISTRSQMILAN 208
           + P  I  R++  LAN
Sbjct: 214 SVPEDIRERAKS-LAN 228


>gi|90423780|ref|YP_532150.1| hypothetical protein RPC_2277 [Rhodopseudomonas palustris BisB18]
 gi|90105794|gb|ABD87831.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 217

 Score = 61.2 bits (147), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 77/151 (50%), Gaps = 1/151 (0%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           F QA EL   NK  +A + F K+ +     Y  L+ +  A+  +A  D + AA+ + ++A
Sbjct: 60  FNQASELSEQNKHAEAEAVFAKLATTAPAGYRTLARLRNAAE-IATRDPQAAAKAYDEIA 118

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
            D   P   R  A ++AA +L++T+SY ++ + L+  +         A E+L +SA + G
Sbjct: 119 ADRAVPAVDRDLAKVRAAGLLLETASYSDLLQRLEPATTADGTYRHTARELLALSAWRGG 178

Query: 177 KVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
               A+   E ++ D  +P  + +R+ ++ A
Sbjct: 179 DATAARKWLELISTDAETPSSLRSRADVLQA 209


>gi|91977475|ref|YP_570134.1| hypothetical protein RPD_3007 [Rhodopseudomonas palustris BisB5]
 gi|91683931|gb|ABE40233.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 217

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 74/141 (52%), Gaps = 1/141 (0%)

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
           NK  +A ++F KI +  +  Y  L+ +  A+  VA+ D K A +++  +A D   P   R
Sbjct: 70  NKHAEAEAAFNKIAATTSTGYRTLARLRAAA-EVAQRDPKEAVKLYDAIAADRSVPAQDR 128

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             AT++AA +L+D++ Y ++ + L+ +S  +      A E+L +SA +   V   +   E
Sbjct: 129 DLATIRAAQLLMDSAGYTDLQQRLEPISGANGAYRHTAREMLALSAWRANNVAATRQWIE 188

Query: 187 ELAKDNNSPFGISTRSQMILA 207
            +  D  +P  +  R++++ A
Sbjct: 189 MINTDAETPASLRNRAEVLQA 209


>gi|92117232|ref|YP_576961.1| hypothetical protein Nham_1684 [Nitrobacter hamburgensis X14]
 gi|91800126|gb|ABE62501.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 217

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 77/160 (48%), Gaps = 1/160 (0%)

Query: 48  KKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKN 107
           +K    G  F  A  L + NK  +A ++F K+ +     Y  LS +  A+  V K D K 
Sbjct: 51  QKSAEAGSAFEAAATLADQNKYAEAEAAFTKLAATAPPGYRNLSRLRAAAEAV-KRDPKE 109

Query: 108 AAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEI 167
           A +++  +A D     A R  A ++AA +L+DT +Y  + + L+  + P       A E+
Sbjct: 110 AVKLYDAIAADSGFGSAERDLARVRAAGLLLDTETYNNMLQRLEPATAPQAAFRHTAREL 169

Query: 168 LGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
           L +SA +      A+   + + +D  +P  + +R++ + A
Sbjct: 170 LALSAWRANDTTAARKWLDMIGEDGQTPSSLRSRAEALQA 209


>gi|85373405|ref|YP_457467.1| hypothetical protein ELI_02890 [Erythrobacter litoralis HTCC2594]
 gi|84786488|gb|ABC62670.1| hypothetical protein ELI_02890 [Erythrobacter litoralis HTCC2594]
          Length = 270

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 82/175 (46%), Gaps = 1/175 (0%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +DG  E       E    AL+   +  L     + E + + DN      + M  A I
Sbjct: 69  YLWWDGQREAALEQDSEVLVSALDQIEAGNLQTGTETLEPLTTSDNAGAQAAALMLQAGI 128

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
              +GD   AA +F +VAN+  AP A R  AT++  ++  D     E+ + L  ++ P N
Sbjct: 129 AAQQGDLARAATLFGQVANNSDAPPAYRDLATVRQVALQFDRLEPAEVIQRLSAIAVPDN 188

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
                A E++ ++ L+ G    A  +F E+AK +++P  + +R++  +A ++  D
Sbjct: 189 AFFGSAGELVAMAHLEKGDRAAAGKLFGEIAKSDDAPQSLRSRARQ-MAGMLGVD 242


>gi|299133683|ref|ZP_07026877.1| Protein of unknown function DUF2133 [Afipia sp. 1NLS2]
 gi|298591519|gb|EFI51720.1| Protein of unknown function DUF2133 [Afipia sp. 1NLS2]
          Length = 214

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 91/174 (52%), Gaps = 15/174 (8%)

Query: 27  LLILMILSLAIW--FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
           L++L++  +  W  +  F+    +K    G+ F  A+ L +  +   A+++F+KI S + 
Sbjct: 31  LIVLIVGGVGGWRAYQYFEN---QKAEAAGKAFEAAVALTDPAQ---AQAAFDKIASSNA 84

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
           + Y+ L+ ++ A+   AK D++     F  VAND      +R  A L+AAS+L+DT+ Y 
Sbjct: 85  QGYSTLARLHAAAE-AAKQDSQKGIAAFDAVANDGKVEAPIREIARLRAASLLLDTAPYA 143

Query: 145 EISKILQKLSEPSNPMHQF---ANEILGISALKFGKVQKAKTIFEELAKDNNSP 195
           +I K   +LS+ ++  H F   A E+L +SA +      A+   + +  D  SP
Sbjct: 144 DIEK---RLSDDASGTHTFRHSARELLALSAWRAKNNDAARKWLDMIGDDPQSP 194


>gi|315499683|ref|YP_004088486.1| hypothetical protein Astex_2696 [Asticcacaulis excentricus CB 48]
 gi|315417695|gb|ADU14335.1| hypothetical protein Astex_2696 [Asticcacaulis excentricus CB 48]
          Length = 243

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 88/184 (47%), Gaps = 5/184 (2%)

Query: 27  LLILMILSLAIWFYL-FDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNK 85
           L + +I +L  W Y  +D S   K +   E +  A E    N    A++ F+K++     
Sbjct: 32  LAVALIGALGFWGYTSWDASRVSKAS---EAYVAAQEALTKNDKAAAKADFQKVVDAGAP 88

Query: 86  LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE 145
            Y  L+   +A + V    T  A ++  + +     PL +   ATL+A  +++D +S+E+
Sbjct: 89  GYKALALSQLAGLAVEDNKTDEAVKLLEEASKTSSDPL-IADLATLKATFLIMDKASFED 147

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
           + K L  L++   P    A E L ++ ++ G +Q A+   + LA   ++   +  R+QM 
Sbjct: 148 VEKRLTPLTKEGRPYAPLAKEALAMAKIQKGDIQGARGDLQALAFSLDASDPLKQRAQMA 207

Query: 206 LANI 209
           +A I
Sbjct: 208 VALI 211


>gi|85708007|ref|ZP_01039073.1| hypothetical protein NAP1_02190 [Erythrobacter sp. NAP1]
 gi|85689541|gb|EAQ29544.1| hypothetical protein NAP1_02190 [Erythrobacter sp. NAP1]
          Length = 256

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 83/187 (44%), Gaps = 1/187 (0%)

Query: 27  LLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKL 86
           L I ++L+    FY +DG +E       E    AL+  + N  + A    + ++ + +  
Sbjct: 49  LAISLLLAGMFGFYFWDGRNEAALERQSEQIISALDSVDVNDFEGASEKVDGLVDEGSIG 108

Query: 87  YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEI 146
               +    A+  + +G+   A E++  +A D   P  +R  A ++  S   D     ++
Sbjct: 109 ARTSAKFLQAAAALEEGNPAKAVELYASIAADPETPGPLRNLAVIREVSTNFDERDPADV 168

Query: 147 SKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMIL 206
              L  L+ P NP    A E+  I+ L+ G   +A  +F E+A D   P  + +R++  +
Sbjct: 169 IAKLSDLAVPGNPYFGSAGELTAIAHLEAGNRDEAGALFAEMANDEALPETLRSRARQ-M 227

Query: 207 ANIIASD 213
           A ++  D
Sbjct: 228 AGLLGVD 234


>gi|148255172|ref|YP_001239757.1| hypothetical protein BBta_3774 [Bradyrhizobium sp. BTAi1]
 gi|146407345|gb|ABQ35851.1| hypothetical protein BBta_3774 [Bradyrhizobium sp. BTAi1]
          Length = 217

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 80/164 (48%), Gaps = 1/164 (0%)

Query: 48  KKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKN 107
           KK    G  F +A+EL   NK ++A  +F ++ +     Y  L+  + A+    + D   
Sbjct: 51  KKAAEAGSAFNKAIELSEQNKREEAEKAFAEVAATAPAGYRMLARFHQAAEAAGR-DKAA 109

Query: 108 AAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEI 167
           A  ++ ++A D       +  A L+AA +LVDT+ Y ++ + L+  +    P    A E+
Sbjct: 110 AVRLYDELAADRSIGAEQQSMARLRAAGLLVDTAPYPDLKQRLEGEAASGAPFRHAAREL 169

Query: 168 LGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           L +SA K      A+   + +A D  +P G+ +R++ + A + A
Sbjct: 170 LALSAWKANDAAAARQWLDMIALDGETPPGLRSRAEALQALLPA 213


>gi|300022383|ref|YP_003754994.1| hypothetical protein Hden_0856 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299524204|gb|ADJ22673.1| Protein of unknown function DUF2133 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 264

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 86/164 (52%)

Query: 50  KNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAA 109
           +   G +++ A  L ++ K ++A ++F+KI  +    Y  L+ + +A+ L+  G T +A 
Sbjct: 57  EQAAGADYSAAETLSDNKKKEEAEAAFKKIAEEGPAGYGSLARLQLAAALLKDGKTADAI 116

Query: 110 EIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILG 169
             +  +A +  A   ++  A LQAAS+ +  + Y EI   L  ++    P  + A E+LG
Sbjct: 117 ATYEALAKESGADNLLKSFAQLQAASLRMPDADYAEIQNRLTPIAGDDAPFSKSARELLG 176

Query: 170 ISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           ++A K GK  +A+   E L  D N    +  R +++++ I A++
Sbjct: 177 VAAYKAGKFDEARKYLEPLLIDPNVSEALQERVKILMSGIAAAE 220


>gi|298291069|ref|YP_003693008.1| hypothetical protein Snov_1069 [Starkeya novella DSM 506]
 gi|296927580|gb|ADH88389.1| Protein of unknown function DUF2133 [Starkeya novella DSM 506]
          Length = 235

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 88/180 (48%), Gaps = 4/180 (2%)

Query: 27  LLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKL 86
           L +L++L++A W   ++    ++    G  F  AL+L    K  +A ++F+ +       
Sbjct: 31  LAVLIVLAVAGW-RGYEWWKLQRDQAAGAKFEAALQLAADGKAAEAEAAFQALEKDGTSG 89

Query: 87  YNPLSNMYIASILVAKGDTKNAAEIFLKVAND-DLAPLAVRYAATLQAASILVDTSSYEE 145
           Y  LS    A+ L AK D   A   +  +A D  ++PL ++  A ++AA +LVDT+   +
Sbjct: 90  YRVLSRFRAATEL-AKTDAAKAVAEYDSLAKDPSISPL-MQNVAQVRAALLLVDTAPLAD 147

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
           +   ++ L  P       A EI+G++  K G  + A   F  +  D  +P G+  R++++
Sbjct: 148 VEGRMKPLDTPEGAFRHSAREIIGLAQYKAGDFKAATDTFSAILNDGQTPPGLRRRAELM 207


>gi|114328957|ref|YP_746114.1| hypothetical protein GbCGDNIH1_2293 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317131|gb|ABI63191.1| hypothetical membrane associated protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 227

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 90/192 (46%), Gaps = 15/192 (7%)

Query: 27  LLILMILSLAIWFYLFDGSHEK-----------KKNIVGENFAQALELFNSNKLDDARSS 75
           L++L+IL  A W       H +            +N V +  A  + +    K + A ++
Sbjct: 36  LVLLVILGAAGWQGWLWYKHRQDATAAERFLALTRNPV-DPLAPPVHIVPDAKTEQALTA 94

Query: 76  FEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAAS 135
           F K  S +N  Y  L+ +  A++L A G+ K A  I+  V+ND+ A  A+R  ATLQ+  
Sbjct: 95  FAKD-SPEN--YATLARLRAAALLTAGGNKKGAEAIYGTVSNDNAALPALRDLATLQSVW 151

Query: 136 ILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSP 195
             +D      +   L  L    NP   FA E   +  ++ G++  A+   + L++D N+P
Sbjct: 152 NRIDDGDPATLRGQLAPLLADGNPWQPFAREGTALLDIRQGRMDDARRGLQTLSQDENAP 211

Query: 196 FGISTRSQMILA 207
            G+  R+  +LA
Sbjct: 212 PGVRNRATGLLA 223


>gi|254503672|ref|ZP_05115823.1| hypothetical protein SADFL11_3711 [Labrenzia alexandrii DFL-11]
 gi|222439743|gb|EEE46422.1| hypothetical protein SADFL11_3711 [Labrenzia alexandrii DFL-11]
          Length = 225

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 78/169 (46%), Gaps = 7/169 (4%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
           W Y  D     +    G+ F +A+ L  + +  +A   + ++ S     Y  L+ M  A+
Sbjct: 45  WLYWQD----TQSQSAGDTFLEAVSLSEAGQYSEASQLYTELGSSIGG-YPALAQMRQAT 99

Query: 98  ILVAKGDTKNAAEIFLKVAND-DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
                GD   A   F  ++ D +LAP A++  A L+AA I VD+  Y+ I+  ++ L+  
Sbjct: 100 DKANAGDATAALAEFDALSRDSNLAP-ALQNVAALRAAYIAVDSEPYDAIADRIESLTGD 158

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
           ++     A E+L +SA K G  + A T    L  D  +P  I  R  ++
Sbjct: 159 TDAFRAAARELLALSAWKNGDAETALTWITALEDDAETPQDIRQRVTLL 207


>gi|114569752|ref|YP_756432.1| hypothetical protein Mmar10_1201 [Maricaulis maris MCS10]
 gi|114340214|gb|ABI65494.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 261

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 83/180 (46%), Gaps = 1/180 (0%)

Query: 30  LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNP 89
           L +++ ++ +  FD      +    + F  A+    S +L  A +  E +       Y  
Sbjct: 33  LAVIAGSVAWQSFDAWQTGGRQTASDAFIAAMTHSESGELALAAAGLETLAENGTPGYVS 92

Query: 90  LSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKI 149
           L+ +   ++ + +GD   A   F + A     PL +R  A ++A     D+ S+ +I   
Sbjct: 93  LALIQRGNVAIEQGDNAAATGFFEQAAAQASDPL-LRDMAEIRAVWSSWDSLSFSDIDLR 151

Query: 150 LQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
           L +L    +P    A E +  +AL+   +++A+T ++ L+  +++P G+  R+Q  +A I
Sbjct: 152 LSRLVNADSPYRHIARETIAAAALRADNIERARTQYQFLSFSSDAPAGVQRRAQEAMALI 211


>gi|254440175|ref|ZP_05053669.1| hypothetical protein OA307_5045 [Octadecabacter antarcticus 307]
 gi|198255621|gb|EDY79935.1| hypothetical protein OA307_5045 [Octadecabacter antarcticus 307]
          Length = 229

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 82/191 (42%), Gaps = 12/191 (6%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WIA L++LMI+    +        E     VG+    ALE      +DD +     + 
Sbjct: 27  YGWIAVLVVLMIVGGTAFSEFRKAQSEGAAQAVGDEILVALE------IDDDQGRAAALQ 80

Query: 81  SQDNKLYNP---LSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
           + D  +  P   ++ +  A+ L    D   AA     VA D   P   R  A L++  I 
Sbjct: 81  AID--VIGPAAAVTGLLTAANLTEIDDISGAAGALDAVALDADIPQVYRDLAALKSVMIK 138

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
            DT S E+   +L  L+    P    A E L + +++ G +  A T F  LA+D  +  G
Sbjct: 139 GDTLSIEDRRTMLADLAVAGAPFRVVAQEQLALISVEAGDIDTAVTQFAALAQDAEATRG 198

Query: 198 ISTRS-QMILA 207
           +  R+  MI+A
Sbjct: 199 LRERAFSMIVA 209


>gi|220924492|ref|YP_002499794.1| hypothetical protein Mnod_4624 [Methylobacterium nodulans ORS 2060]
 gi|219949099|gb|ACL59491.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 236

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 86/183 (46%), Gaps = 8/183 (4%)

Query: 27  LLILMILSLAIWFYLFDGSHEKK--KNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
           + +L++L +  W +     HE++         F +A+     +K  DA  +FE + +   
Sbjct: 33  IAVLVVLGIGGWRFW---QHEQQVQAEAASRRFDEAVRT-AKDKGADAAKTFEAVAADAP 88

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y  +     A+    K +    A+ +  +A+D+     +R  A L+ A + +D    E
Sbjct: 89  GGYR-VLARLRAAAEAGKVEPAAGAKAYAAIADDNAVGQGLRDVARLRGALLRLDADDPE 147

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
            ++  LQ L+ P+N     A E+LG+SAL+ G    A   F+++A D  +P G+  R ++
Sbjct: 148 ALN-TLQGLATPTNAFRHTAREMLGLSALRKGDFDGAGRWFDQIAADRETPQGLRQRLEV 206

Query: 205 ILA 207
            +A
Sbjct: 207 YIA 209


>gi|27379161|ref|NP_770690.1| hypothetical protein blr4050 [Bradyrhizobium japonicum USDA 110]
 gi|27352311|dbj|BAC49315.1| blr4050 [Bradyrhizobium japonicum USDA 110]
          Length = 217

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 79/147 (53%), Gaps = 1/147 (0%)

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +EL   +K  +A ++F ++ ++    Y  L+ +  A+   ++ D K AA+++  +A D  
Sbjct: 64  VELSEQDKHAEAETAFTELAAKAPSGYRTLARLRAAAEAASR-DPKAAAKMYDDIAADRG 122

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                +  A ++AA +LVD++SY ++ + L+  + P +     A E+L +SA +      
Sbjct: 123 VGGEWQDLAKIRAAGLLVDSASYADMQQRLEASATPKSTFRHSARELLALSAWRNNDTTA 182

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILA 207
           A+   + +A+D  +P G+ +R++ + A
Sbjct: 183 ARKWLDAIAEDGETPPGLRSRAEALQA 209


>gi|316933669|ref|YP_004108651.1| hypothetical protein Rpdx1_2327 [Rhodopseudomonas palustris DX-1]
 gi|315601383|gb|ADU43918.1| Protein of unknown function DUF2133 [Rhodopseudomonas palustris
           DX-1]
          Length = 218

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 73/141 (51%), Gaps = 1/141 (0%)

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
           NK  +A ++F+KI +     Y  L+ +  A+  VA  D   A + + ++A D   P   R
Sbjct: 70  NKHAEAEAAFDKIAASAPSGYRMLARLRAAA-EVATRDPALAVKRYDEIAADRRLPAPYR 128

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             A ++AA +++DT++Y ++ + L+ ++   +     A E+L +SA +   V   +   +
Sbjct: 129 DLAGIRAAGLVMDTANYNDLVQRLEPIATADSAFRHTARELLALSAWRANNVAATRQWID 188

Query: 187 ELAKDNNSPFGISTRSQMILA 207
           ++  D  +P  + +R+ ++ A
Sbjct: 189 KITTDAETPGSLRSRADVLQA 209


>gi|209964705|ref|YP_002297620.1| hypothetical protein RC1_1403 [Rhodospirillum centenum SW]
 gi|209958171|gb|ACI98807.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 219

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 74/165 (44%), Gaps = 1/165 (0%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
           W       ++++   +G   AQAL    S    +A        ++ +  +  L+  Y A 
Sbjct: 45  WQRWQSARNQEQTAELGRALAQALPAGASAPATNAADLLAGAAARTDGAHAALARFYEAG 104

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
           +   +GD + A  ++ ++A  +  P+  R  A L A    VD+   +++   L  L    
Sbjct: 105 LRARQGDREGAVALYDQLAGTEADPV-FRDLAQLLAVLHQVDSGDPKQLLSRLTPLMGSD 163

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRS 202
           NP +  A E+ G+ + + G   +A+ +F +LA D  +P G+  R+
Sbjct: 164 NPWNWSARELAGLLSARDGDTARARELFSQLADDPQTPAGVRARA 208


>gi|328544036|ref|YP_004304145.1| hypothetical protein SL003B_2418 [polymorphum gilvum SL003B-26A1]
 gi|326413780|gb|ADZ70843.1| hypothetical protein SL003B_2418 [Polymorphum gilvum SL003B-26A1]
          Length = 229

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 82/186 (44%), Gaps = 8/186 (4%)

Query: 23  WIAPLLILMILSLAI---WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKI 79
           WI  L ++++        W Y      + K    G+ F +A+ L  S +  +A+  F ++
Sbjct: 27  WIIVLAVVIVAGTGGYRGWSYW----QQTKAREAGDMFLRAVALAESGQHLEAQELFGRL 82

Query: 80  LSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
            +     Y  L+ +  A+ L   G+ + A   F  +A D      +R  A+L+A  + +D
Sbjct: 83  ETATGG-YPVLARLRGATDLAVAGNPEEAIARFDAIAADRSVDSLMRDLASLRAGYLALD 141

Query: 140 TSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
           +  +  +   L+ ++  +NP    A EIL  SA K G    A+   + +  D  +P  +S
Sbjct: 142 SLDHAAVQDRLEGVAGDANPWRFAAREILAFSAWKAGDTAAARDWIDRIVDDAAAPADVS 201

Query: 200 TRSQMI 205
            R  ++
Sbjct: 202 GRVGIL 207


>gi|146340693|ref|YP_001205741.1| hypothetical protein BRADO3744 [Bradyrhizobium sp. ORS278]
 gi|146193499|emb|CAL77515.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 217

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 72/151 (47%), Gaps = 1/151 (0%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           F +ALEL   NK  +A  +F  + +     Y  L+  + A+    + D   A +++  +A
Sbjct: 60  FNKALELSEQNKHAEAEKAFADVAATAPSGYRMLARFHQAAEAAVR-DKAAAVKLYDDLA 118

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
            D       +  A L+AA +LVDT+ Y ++   L+  +    P    A E+L +SA K  
Sbjct: 119 ADRGIGAEQQSMARLRAAGLLVDTAPYADLKPRLEGETAAGAPFRHAARELLALSAWKAN 178

Query: 177 KVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
               A+   + +A D  +P G+ +R++ + A
Sbjct: 179 DAAAARQWLDMIALDGETPPGLRSRAEALQA 209


>gi|39936160|ref|NP_948436.1| hypothetical protein RPA3097 [Rhodopseudomonas palustris CGA009]
 gi|39650015|emb|CAE28538.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 229

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 75/141 (53%), Gaps = 1/141 (0%)

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
           NK  +A ++F+KI +     Y  L+ +  A+ +  + D + A + + ++A D       R
Sbjct: 81  NKHAEAEAAFDKIAASAPAGYRTLARLRAAAEIGTR-DAQAAVKRYDEIAADRSLAAPFR 139

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             A+++AA+++++T+SY ++ + L+ ++  +      A E+L +SA +   V   +   +
Sbjct: 140 ELASIRAANLVLETASYNDLVQRLEPVASGNGAFRHTARELLALSAWRANNVAATRQWID 199

Query: 187 ELAKDNNSPFGISTRSQMILA 207
           ++  D  +P  + +R+ ++ A
Sbjct: 200 KITTDAETPGSLRSRADVLQA 220


>gi|192291878|ref|YP_001992483.1| hypothetical protein Rpal_3507 [Rhodopseudomonas palustris TIE-1]
 gi|192285627|gb|ACF02008.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 218

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 75/141 (53%), Gaps = 1/141 (0%)

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
           NK  +A ++F+KI +     Y  L+ +  A+ +  + D + A + + ++A D       R
Sbjct: 70  NKHAEAEAAFDKIAASAPAGYRTLARLRAAAEIGTR-DAQAAVKRYDEIAADRSLAAPFR 128

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             A+++AA+++++T+SY ++ + L+ ++  +      A E+L +SA +   V   +   +
Sbjct: 129 ELASIRAANLVLETASYNDLVQRLEPVASGNGAFRHTARELLALSAWRANNVAATRQWID 188

Query: 187 ELAKDNNSPFGISTRSQMILA 207
           ++  D  +P  + +R+ ++ A
Sbjct: 189 KITTDAETPGSLRSRADVLQA 209


>gi|85716389|ref|ZP_01047361.1| hypothetical protein NB311A_02311 [Nitrobacter sp. Nb-311A]
 gi|85696746|gb|EAQ34632.1| hypothetical protein NB311A_02311 [Nitrobacter sp. Nb-311A]
          Length = 217

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 82/187 (43%), Gaps = 8/187 (4%)

Query: 24  IAPLLILMILSLAIWF---YLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           I   +IL+I ++  W    YL      +K       F  A  L   NK  +A ++F K+ 
Sbjct: 28  IVAAVILVIAAVGGWRGYQYL----QTQKAAEASSTFEAAAALAAQNKHAEAEAAFTKLA 83

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
                 Y  LS +  A+      DT  A +++  +A+D     A R  A + AA +LVDT
Sbjct: 84  ETAPSGYRTLSRLRAAAEAARH-DTNAAVKLYDAIASDSGLSSAERDLARVSAARLLVDT 142

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
            +Y  +   L+  + P       A E+L +SA   G    A+   + +++D  +P  +  
Sbjct: 143 ETYNNMLPRLEPATAPEATYRHTARELLALSAWSNGDTTAARKWLDMISEDGQTPSSLRR 202

Query: 201 RSQMILA 207
           R++ + A
Sbjct: 203 RAEALQA 209


>gi|258542807|ref|YP_003188240.1| hypothetical protein APA01_17320 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633885|dbj|BAH99860.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636944|dbj|BAI02913.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639997|dbj|BAI05959.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256643053|dbj|BAI09008.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256646108|dbj|BAI12056.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256649161|dbj|BAI15102.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256652148|dbj|BAI18082.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655205|dbj|BAI21132.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 231

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 59/133 (44%)

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
           +S +K+ S D K    L+ +    +  A+GD K A   +  V  D  A  A+R  ATL  
Sbjct: 91  ASLQKLASSDAKGVAVLARLQEGGVQAARGDVKGALAAWDAVQKDPNADSALRDLATLLW 150

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
               +DT     +   L  L+    P +  A E L +  ++ G V +A+  F  L    +
Sbjct: 151 CQKQLDTGEPATLRSRLALLTGKGKPWNGLAMEALAVLDVREGHVAEARQKFAALQAAQD 210

Query: 194 SPFGISTRSQMIL 206
            P G+  R+Q ++
Sbjct: 211 VPQGVRNRAQDMM 223


>gi|162149031|ref|YP_001603492.1| hypothetical protein GDI_3261 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545220|ref|YP_002277449.1| hypothetical protein Gdia_3104 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787608|emb|CAP57204.1| conserved protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532897|gb|ACI52834.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 229

 Score = 48.1 bits (113), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 58/123 (47%)

Query: 90  LSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKI 149
           L+ +  A++L + GDT+ A  ++ +VA+D  A   +R  A+L      +D      +   
Sbjct: 105 LARLERAALLASSGDTRGALSLWTQVADDGAADPQLRSLASLLWVQRQIDDGDPATLRSR 164

Query: 150 LQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
           L  L     P    A E   +  L+ G+   A+  F +L+ + + P G+ +R+  +L  +
Sbjct: 165 LTTLDGVGKPWRALAIECEAMLDLRQGRTADARRRFAQLSAEADVPDGLRSRAGGLLQTL 224

Query: 210 IAS 212
            AS
Sbjct: 225 NAS 227


>gi|16125898|ref|NP_420462.1| hypothetical protein CC_1652 [Caulobacter crescentus CB15]
 gi|221234661|ref|YP_002517097.1| hypothetical protein CCNA_01724 [Caulobacter crescentus NA1000]
 gi|13423058|gb|AAK23630.1| hypothetical protein CC_1652 [Caulobacter crescentus CB15]
 gi|220963833|gb|ACL95189.1| hypothetical membrane associated protein [Caulobacter crescentus
           NA1000]
          Length = 250

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 75/154 (48%), Gaps = 3/154 (1%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           + +  AL+   +     A + F+ +   + K Y  L+ M + +I + +  T+ A   F +
Sbjct: 58  QAYQAALQTAQTQGPAKAFAGFKAVADTNAKGYKSLALMQMGAIRLEEKKTQEAVGYFDE 117

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALK 174
            A    +P+ +   A L++A  L+DT+SY++I   L  L+   +P   +A E L  + L+
Sbjct: 118 AAKVAPSPM-IGDLARLKSAFALMDTASYKDIETRLTPLAGEKSPYRVYAKEALAFAKLQ 176

Query: 175 FGKVQKAKTIFEELAK--DNNSPFGISTRSQMIL 206
            G +  A++ F  LA   D N+   I  R+Q  +
Sbjct: 177 AGDLAGARSEFVILANSLDANTSEAIRQRAQAAM 210


>gi|257092260|ref|YP_003165901.1| tetratricopeptide repeat-containing protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257044784|gb|ACV33972.1| Tetratricopeptide TPR_2 repeat protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 412

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 13/115 (11%)

Query: 54  GENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL 113
           G+    A +   +N+LDDARS +E++L  D +  + L  + +A I   +G T+ A +I+L
Sbjct: 227 GQAIEHAYDALQANRLDDARSGYEQVLRGDPRNADAL--LGLAVIATRQGQTERAQQIYL 284

Query: 114 KVANDDLAPLAVRYAATLQAASILV----DTSSYEEISKILQKLSEPSNPMHQFA 164
           +V   D A +      T QAA I +    D+   E   KIL   S+P +P   FA
Sbjct: 285 RVLEADPANV------TAQAALINLRGHSDSGQSESRLKIL-LASQPDSPSLHFA 332


>gi|163853440|ref|YP_001641483.1| hypothetical protein Mext_4042 [Methylobacterium extorquens PA1]
 gi|163665045|gb|ABY32412.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 236

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%)

Query: 150 LQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
           LQ L+ P+N     A E+LG++ALK G ++ A   F++++ D  +P G+  R ++  A
Sbjct: 155 LQGLAAPTNAFRHTAREMLGLTALKRGDIEGAGRWFDQISTDGETPQGLRQRVEIYQA 212


>gi|240140860|ref|YP_002965340.1| hypothetical protein MexAM1_META1p4432 [Methylobacterium extorquens
           AM1]
 gi|254563369|ref|YP_003070464.1| hypothetical protein METDI5036 [Methylobacterium extorquens DM4]
 gi|240010837|gb|ACS42063.1| hypothetical protein MexAM1_META1p4432 [Methylobacterium extorquens
           AM1]
 gi|254270647|emb|CAX26651.1| hypothetical protein METDI5036 [Methylobacterium extorquens DM4]
          Length = 236

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%)

Query: 150 LQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
           LQ L+ P+N     A E+LG++ALK G ++ A   F++++ D  +P G+  R ++  A
Sbjct: 155 LQGLAAPTNAFRHTAREMLGLTALKRGDIEGAGRWFDQISADGETPQGLRQRVEIYQA 212


>gi|218532300|ref|YP_002423116.1| hypothetical protein Mchl_4412 [Methylobacterium chloromethanicum
           CM4]
 gi|218524603|gb|ACK85188.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 236

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%)

Query: 150 LQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
           LQ L+ P+N     A E+LG++ALK G ++ A   F++++ D  +P G+  R ++  A
Sbjct: 155 LQGLAAPTNAFRHTAREMLGLTALKRGDIEGAGRWFDQISADGETPQGLRQRVEIYQA 212


>gi|144898967|emb|CAM75831.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 227

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 72/154 (46%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
            F +A ++ +         + + +++     Y  LS + +A + +A GD   AA ++ ++
Sbjct: 68  RFTEASQMLDKGDKAKGTEALQALVASGPSGYKLLSELKLAQVKLADGDAAAAAALYDRI 127

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
           A D       R  A L++A I ++T     + K +  L+  S      A EIL + ALK 
Sbjct: 128 AADGGVDDIYRDMAVLKSAYIKLETGDIALVEKSVAPLAVESGAWRHSAREILALLALKA 187

Query: 176 GKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
           G   KA  +  ++A D  +P GI  R+  +LA +
Sbjct: 188 GDNAKAMDLLRKVADDVAAPAGIRGRAAELLAAL 221


>gi|114799082|ref|YP_759500.1| hypothetical protein HNE_0772 [Hyphomonas neptunium ATCC 15444]
 gi|114739256|gb|ABI77381.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 238

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 84/180 (46%), Gaps = 4/180 (2%)

Query: 31  MILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPL 90
           +I+ +A+  ++     E+++          +      + ++A ++F KI+++D KL  PL
Sbjct: 35  LIIGVAVNEFVLKPQAEQRRQERALALESGIRALEDARYEEAEAAFTKIMNEDPKL-APL 93

Query: 91  SNMYIASI-LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKI 149
           +  ++A       GD   AAE+   V   +  P      A L++A    DT S EE+   
Sbjct: 94  AAHFLAQTKYEGGGDAAAAAELLASVGGTEGGPY--ERLALLKSAYFKADTQSLEELELS 151

Query: 150 LQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
           L  L+   + +   A E++   A + G   +A+T +  L  D  +P G+  R+++ LA I
Sbjct: 152 LGSLANDDSTVGALARELIAAKAFEAGDFARARTAYNRLRLDAFAPQGLVRRAEIALAAI 211


>gi|188583712|ref|YP_001927157.1| hypothetical protein Mpop_4524 [Methylobacterium populi BJ001]
 gi|179347210|gb|ACB82622.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 237

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 34/55 (61%)

Query: 150 LQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
           LQ L+ P+N     A E+LG++ALK G ++ A   F++++ D  +P G+  R ++
Sbjct: 155 LQGLAAPTNAFRHTAREMLGLTALKRGDIEGAGRWFDQISADAETPQGLRQRVEV 209


>gi|170750286|ref|YP_001756546.1| hypothetical protein Mrad2831_3889 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656808|gb|ACB25863.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 236

 Score = 45.4 bits (106), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 86/189 (45%), Gaps = 4/189 (2%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           I  L +L++  +A W Y +         +    F  A  L    K+ +A  +FE + +Q 
Sbjct: 31  IIALAVLVVAGVAGWRY-WQAQQRAAAEVASVRFDDANRLAKDGKVAEADKAFETLEAQG 89

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y  L+  + A+    K D    A  F K+A+D      +R  A L+AA + +D  + 
Sbjct: 90  PAGYRLLAR-FRAAAETGKRDPAAGAAEFDKLADDTGLGDGLRDLARLRAALLRLDGPNP 148

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           +     LQ L+    P    A E+LG++ALK G  + A   F+++  D ++P  +  R +
Sbjct: 149 DPALANLQGLAA-GTPFRHTAREMLGLAALKKGDYEDASRWFDQIVADPDTPRNLRERIE 207

Query: 204 MILANIIAS 212
            + A I+A 
Sbjct: 208 -VYAAIVAG 215


>gi|288958552|ref|YP_003448893.1| hypothetical protein AZL_017110 [Azospirillum sp. B510]
 gi|288910860|dbj|BAI72349.1| hypothetical protein AZL_017110 [Azospirillum sp. B510]
          Length = 214

 Score = 45.1 bits (105), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 51/103 (49%)

Query: 100 VAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNP 159
           + +G   +AA ++  +A     P+  R  ATL A           +++  L  L+  ++P
Sbjct: 102 IRQGKPADAATVYDGIAGHGSVPVEYRDLATLLAVMQRAGDGDAAQLTAKLLPLTAETSP 161

Query: 160 MHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRS 202
               A E+  + A + G  +KA+T++++LA D  +P G+  R+
Sbjct: 162 WRFTARELTAMLAARSGDTEKARTLYKQLADDQLAPSGVRGRA 204


>gi|163797495|ref|ZP_02191446.1| hypothetical protein BAL199_23462 [alpha proteobacterium BAL199]
 gi|159177244|gb|EDP61803.1| hypothetical protein BAL199_23462 [alpha proteobacterium BAL199]
          Length = 212

 Score = 45.1 bits (105), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 71/161 (44%), Gaps = 7/161 (4%)

Query: 50  KNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAA 109
           K  +G+ +  A EL  S    D   +F  +       Y  L+ +  A+ L   GDT+ A 
Sbjct: 53  KAEMGDRYEAAAELVVSGNPKDGAQAFAALADDAGAGYATLARLREAAALATAGDTEAAI 112

Query: 110 EIFLKVANDDLAPLAVRYA--ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEI 167
            +F KVA D   P    YA  A L+A  + + T     +   L  +    NP    A E 
Sbjct: 113 LVFRKVATDAKPP----YADLARLRAVRLGIGTGDTSALLSELAPVLAAGNPWRPLAAET 168

Query: 168 LGISALKFGKVQKAKTIFEELAKDNNSPFGISTR-SQMILA 207
                L+ G+  KA TI++ LA D ++P  +  R ++M+ A
Sbjct: 169 EAAIHLRAGETGKALTIYKSLADDASTPSQLRARAAEMVRA 209


>gi|295689709|ref|YP_003593402.1| hypothetical protein Cseg_2324 [Caulobacter segnis ATCC 21756]
 gi|295431612|gb|ADG10784.1| Protein of unknown function DUF2133 [Caulobacter segnis ATCC 21756]
          Length = 249

 Score = 44.7 bits (104), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 4/154 (2%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           E +  ALE   +     A   F+ +     + Y  L+ + +  I + +  TK A   F +
Sbjct: 58  EAYQAALETAQTAGPAKAFGQFKAVADGGARGYKALALLQMGDIRIEENKTKEAVAYFDE 117

Query: 115 VANDDLAPLAV-RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
            A    AP A+    A L++A  L+DT+SY++I   L  L+   +P   +A E L  + L
Sbjct: 118 AAK--AAPDAILGDLARLKSAFALMDTASYKDIESRLTPLAGEKSPYRVYAKEALAFAKL 175

Query: 174 KFGKVQKAKTIFEELAKD-NNSPFGISTRSQMIL 206
           + G V  A+  F  LA   +N+   +  R+Q  +
Sbjct: 176 QAGDVAGARGDFVVLANSLDNTSEEVRQRAQAAM 209


>gi|83952355|ref|ZP_00961086.1| hypothetical protein ISM_09396 [Roseovarius nubinhibens ISM]
 gi|83836028|gb|EAP75326.1| hypothetical protein ISM_09396 [Roseovarius nubinhibens ISM]
          Length = 206

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 84/193 (43%), Gaps = 16/193 (8%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WIA L +L+++  A +      +       +G+    ALE       D+A +    + 
Sbjct: 4   YGWIAVLAVLLLVGGAAYNEWRKANERAAAEALGDGILAALE------QDEAEARVTALQ 57

Query: 81  SQDNKLYNPLSNMYIASILVAKG-----DTKNAAEIFLKVANDDLAPLAVRYAATLQAAS 135
           + D    +P ++  +   L+A G     D K  AE  + +A     P+  R  ATL+AA+
Sbjct: 58  AIDAP--DPSADAVV--TLLAAGESLGSDPKATAEALVALAERGDVPMVYRQIATLKAAA 113

Query: 136 ILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSP 195
           I  +  + E   ++L  L+  +  +   A E L    ++ G  + A T  E L  D  + 
Sbjct: 114 IGAEGLAAETRRELLDGLALGTGTIRVLAEEQLAYLDIETGNQEAALTRLEALYVDAEAS 173

Query: 196 FGISTR-SQMILA 207
            G+  R  Q++LA
Sbjct: 174 EGLRQRVGQIVLA 186


>gi|302383645|ref|YP_003819468.1| hypothetical protein Bresu_2537 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194273|gb|ADL01845.1| Protein of unknown function DUF2133 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 267

 Score = 43.5 bits (101), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 59/133 (44%), Gaps = 8/133 (6%)

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL---AVRYAATLQAASILVDT 140
           N  Y  L+    A + V      +A ++F   A  D  P+     RY A L    +L+D 
Sbjct: 87  NGAYKALALQQRAGLAVQANRIPDAIKLFDDAAKADSDPMLADPARYKAAL----LLMDN 142

Query: 141 S-SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
             +  ++   L  L+E   PM  FA E LG++ L+F K  +A+  F  L    + P  + 
Sbjct: 143 GGTLADLEARLLPLTEDDRPMRPFAQEALGLTRLQFNKPAEAREQFVLLTLGQDVPESVR 202

Query: 200 TRSQMILANIIAS 212
            R+Q  ++ I A 
Sbjct: 203 QRAQAAISMIDAG 215


>gi|302779944|ref|XP_002971747.1| hypothetical protein SELMODRAFT_95641 [Selaginella moellendorffii]
 gi|300160879|gb|EFJ27496.1| hypothetical protein SELMODRAFT_95641 [Selaginella moellendorffii]
          Length = 288

 Score = 42.7 bits (99), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 65/146 (44%), Gaps = 14/146 (9%)

Query: 52  IVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEI 111
           IVG       E      L D+R  FE++  ++   +  L + Y      A G  + A EI
Sbjct: 56  IVGTEVITMYE--KCGSLRDSRLVFERMPQKNLVTWTTLISSY------AHGHGREAMEI 107

Query: 112 FLKV-ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
           F ++ A+  L P AV   + L A S +       ++ +I+      SN +   +NE L  
Sbjct: 108 FERLLAHGGLEPDAVACVSALDACSSMASLEQGRKVHRIVVSRGFESNTVFA-SNEALCH 166

Query: 171 SAL----KFGKVQKAKTIFEELAKDN 192
           S +    K G+V+  + IFE++A  N
Sbjct: 167 SLMTMYSKLGRVESVREIFEKMASKN 192


>gi|154246484|ref|YP_001417442.1| hypothetical protein Xaut_2543 [Xanthobacter autotrophicus Py2]
 gi|154160569|gb|ABS67785.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 237

 Score = 42.7 bits (99), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%)

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  VR  A L+AA ILVDT+   E+ + +  ++  + P+   A E L ++ LK G    A
Sbjct: 124 PSLVRELAQLRAALILVDTAGLAEVKQRVAAIAAGTGPLRNAAREALALAELKAGDAAAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMI 205
                E+  D+ +P G+ +R+++I
Sbjct: 184 NKTATEITSDSETPPGVRSRAELI 207


>gi|94495670|ref|ZP_01302250.1| hypothetical protein SKA58_06460 [Sphingomonas sp. SKA58]
 gi|94425058|gb|EAT10079.1| hypothetical protein SKA58_06460 [Sphingomonas sp. SKA58]
          Length = 232

 Score = 42.4 bits (98), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 85/189 (44%), Gaps = 4/189 (2%)

Query: 27  LLILMILSLAIWF-YLFDGSHEKKKN-IVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
           L++++++ LA +  +L+   H+K ++  V E     L+        D +     +     
Sbjct: 35  LIVVLVVGLAAFGGWLYWQHHQKTQSEAVSEQMDTLLDTAVGGGTPDPKQ-LAALTKASQ 93

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y   + +  A +   KGD K A   +  +A DD      R  A ++  S+  D+   E
Sbjct: 94  PGYRASALLVQAGVAARKGDAKAAIAAYRAIAADDSLDQPYRDLALIRQTSLEFDSLKPE 153

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
           ++   L+ L+    P    A E++ ++ +K GK   A  +F  +AKD+  P  I +R++ 
Sbjct: 154 QVVDRLKPLAVEGAPWFGSAGELVAVAYMKMGKNDLAGPMFAAMAKDDKVPQSIRSRARQ 213

Query: 205 ILANIIASD 213
            +A ++  D
Sbjct: 214 -MAGVMGID 221


>gi|148556029|ref|YP_001263611.1| hypothetical protein Swit_3124 [Sphingomonas wittichii RW1]
 gi|148501219|gb|ABQ69473.1| Uncharacterized protein [Sphingomonas wittichii RW1]
          Length = 235

 Score = 42.4 bits (98), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 31/164 (18%), Positives = 75/164 (45%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           F  +  + EKK    GE  +  +    +++  +A    + ++++    Y   + +  A++
Sbjct: 49  FLYWRQASEKKAEAQGEQMSALIADVQASRKAEAAKKIDTLVAEGGDGYRIAALLTKATL 108

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
              +GDTK+A  I+  +A D+ A    R  + ++   +  D  + +++   L+ L+   N
Sbjct: 109 AADRGDTKSAIGIYAGIAADEKAAQPYRDVSLIRQTLLEYDGLTPQQVIDRLKPLAVEGN 168

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRS 202
                A E+  ++ ++  +  +A  +   +A+D   P  + TR+
Sbjct: 169 AFFGTAGEMTAVAMIQANRGAEAGRLLAAVARDKTVPDTLRTRA 212


>gi|315425421|dbj|BAJ47085.1| conserved hypothetical protein [Candidatus Caldiarchaeum
           subterraneum]
          Length = 350

 Score = 42.4 bits (98), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 9/95 (9%)

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG-------KV 178
           RYA   +   I+V     EE++KI +    P+ P+ +  NEI  IS  K         + 
Sbjct: 184 RYATEGEEQEIIVPRLHGEEVTKIPRAQYRPNWPLEKVENEIQKISDEKLKNRLSRILEF 243

Query: 179 QKAKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
            K + IF +L   ++  FGI+ R ++IL+  I +D
Sbjct: 244 AKRRNIFYQLKNRHSPAFGIAYRGKLILS--IGTD 276


>gi|296116362|ref|ZP_06834977.1| hypothetical protein GXY_11204 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977062|gb|EFG83825.1| hypothetical protein GXY_11204 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 220

 Score = 41.6 bits (96), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 60/140 (42%), Gaps = 3/140 (2%)

Query: 73  RSSFEKILSQDNKLYNPL---SNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
           +++ E++ + +     PL   S M  A++LV  GDT  A  ++ +V  D  A   +   A
Sbjct: 74  KTALEQLATLEKTARPPLRALSRMERAALLVNSGDTARALALWAQVNADQGADPTISSLA 133

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L      +DT+    +   L  L     P    A E   +  L+ G   +A+   E L+
Sbjct: 134 GLLWVQHQIDTADPAMLRSRLALLDGAQQPWRGLALECEALLDLRQGHDDEARRRLERLS 193

Query: 190 KDNNSPFGISTRSQMILANI 209
            D N   G+ TR+  +L  +
Sbjct: 194 MDMNVSDGVRTRADGLLQTL 213


>gi|15644443|ref|NP_229495.1| hypothetical protein TM1695 [Thermotoga maritima MSB8]
 gi|4982272|gb|AAD36762.1|AE001810_1 conserved hypothetical protein [Thermotoga maritima MSB8]
          Length = 357

 Score = 41.6 bits (96), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 78/155 (50%), Gaps = 14/155 (9%)

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAK-GDTKNAAEIFLKVANDDLAP 122
           +  N+ D A  + E++L  D    + +  +Y  S L  + G+ + A E+  K+ N     
Sbjct: 210 YEMNRKDLAVKTLERLLEIDP---DNIPALYQLSQLYRELGNEEKAREMEEKIMN----- 261

Query: 123 LAVRYAATLQA-ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +Y   L+  A +++    Y+E+++ L+K+ E S+P++  A  +L +  +K G++ KA
Sbjct: 262 CKPKYPTELEPWARVMLKHGRYKEVAEELEKIVE-SSPLNTLARLLLVVPYVKLGQIDKA 320

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           + I +++ + N   F      + IL  ++  +++ 
Sbjct: 321 REILDDIGQSN---FWYYYGKKEILDELLTEEEKR 352


>gi|94967854|ref|YP_589902.1| TPR repeat-containing protein [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549904|gb|ABF39828.1| Tetratricopeptide repeat protein [Candidatus Koribacter versatilis
           Ellin345]
          Length = 502

 Score = 41.6 bits (96), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 61/133 (45%), Gaps = 13/133 (9%)

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
            +  F SNK  DA  +FE +   D  + +       A+ L   GD K AA++     N +
Sbjct: 262 GMSYFGSNKYADAAKTFEPL--GDRGMQDTSVGYAWATSLARTGDLKKAADVLNHFENSN 319

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQK--LSEPSNPMHQFANEILGISALKFGK 177
           L+P A+     L    +  + + Y+    + QK  L +PS P   F     G++ LK+ K
Sbjct: 320 LSPDAL-----LLVGQLWTEMTDYQHAVSVFQKVLLRDPSLPKAHF---FEGLAYLKWEK 371

Query: 178 VQKAKTIFE-ELA 189
             +A + F+ ELA
Sbjct: 372 WNEAASDFQAELA 384


>gi|148270125|ref|YP_001244585.1| TPR repeat-containing protein [Thermotoga petrophila RKU-1]
 gi|147735669|gb|ABQ47009.1| Tetratricopeptide TPR_2 repeat protein [Thermotoga petrophila
           RKU-1]
          Length = 357

 Score = 41.2 bits (95), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 70/131 (53%), Gaps = 11/131 (8%)

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAK-GDTKNAAEIFLKVANDDLAP 122
           +  N+ D A  + E++L  D    + +  +Y  S L  + G+ + A E+  K+ N     
Sbjct: 210 YEMNRKDLAVKALERLLEIDP---DNIPALYQLSQLYRELGNEEKAREMEEKIMN----- 261

Query: 123 LAVRYAATLQA-ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +Y   L+  A +++    Y+E+++ L+K+ E S+P++  A  +L +  +K G++ KA
Sbjct: 262 CKPKYPTELEPWARVMLKHGRYKEVAEELEKIVE-SSPLNTLARLLLVVPYVKLGQIDKA 320

Query: 182 KTIFEELAKDN 192
           + I +++ ++N
Sbjct: 321 REILDDIGQNN 331


>gi|217976949|ref|YP_002361096.1| hypothetical protein Msil_0763 [Methylocella silvestris BL2]
 gi|217502325|gb|ACK49734.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 328

 Score = 41.2 bits (95), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 69/167 (41%), Gaps = 1/167 (0%)

Query: 46  HEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDT 105
           H +     G  +  AL L    K  +A + F++I +   K Y  L+++     +V + D 
Sbjct: 49  HLQAAEAAGARYEAALRLSQDGKSAEAEAEFKEIAASGPKGYATLAHLRAVDEIVGR-DP 107

Query: 106 KNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFAN 165
             A   +  +  D     + + AA  +AA + VD    +   +    L++PS   H    
Sbjct: 108 AAAIAAYDALGADPTFDQSFKEAAQTRAAVLRVDRDDPKAFEEKYGALAQPSFTYHDTIR 167

Query: 166 EILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           E+L ++A K    + A    + +  D  +P  +  R++  L  + A 
Sbjct: 168 ELLALAAFKREDFEAAGRWLDMIVGDPRAPGPLRQRAEAFLGLVQAG 214


>gi|154253926|ref|YP_001414750.1| hypothetical protein Plav_3494 [Parvibaculum lavamentivorans DS-1]
 gi|154157876|gb|ABS65093.1| conserved hypothetical protein [Parvibaculum lavamentivorans DS-1]
          Length = 240

 Score = 41.2 bits (95), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 66/121 (54%), Gaps = 1/121 (0%)

Query: 87  YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEI 146
           Y  L+ ++ A   +A G+   A  ++ +VAN   AP  VR  A ++   +LVDT+SY+++
Sbjct: 90  YAVLARLHEADKRLAAGERDVALAVYGEVANGG-APAIVRGMARIKEGLLLVDTASYDDM 148

Query: 147 SKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMIL 206
              +  L + ++P  + A E+L ++A++ G+ + A      +  +  +P G+  R+ +I 
Sbjct: 149 KARMSPLVDSASPWRENALELLALAAMRDGEWEDANRNAAAIIANQATPAGLRDRAHVIQ 208

Query: 207 A 207
           A
Sbjct: 209 A 209


>gi|159896623|ref|YP_001542870.1| TPR repeat-containing protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159889662|gb|ABX02742.1| Tetratricopeptide TPR_2 repeat protein [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 1090

 Score = 41.2 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 58  AQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           A A  LF++NKL  A   ++++L ++    NP+   YIA I  A+GDT  A E+F+++A
Sbjct: 47  AVATALFHTNKLPQALQLWQELLKRNPD--NPIFTEYIAKIYRAQGDTDQAIELFMQLA 103


>gi|126667425|ref|ZP_01738397.1| hypothetical protein MELB17_14201 [Marinobacter sp. ELB17]
 gi|126628181|gb|EAZ98806.1| hypothetical protein MELB17_14201 [Marinobacter sp. ELB17]
          Length = 809

 Score = 40.8 bits (94), Expect = 0.12,   Method: Composition-based stats.
 Identities = 33/138 (23%), Positives = 66/138 (47%), Gaps = 12/138 (8%)

Query: 80  LSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA---NDDLAPLAVRYAATLQAASI 136
           L+ DN    P +++ +A++  +  ++  A E  L  A    + + PL        QA  +
Sbjct: 511 LTTDNPNMQP-AHLALANLYASTDNSDKAVEQLLAAAVITPEVIGPLQ-------QAGQL 562

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
                S EE+ + L  ++E   P+   A+ +  +  ++ G V++A+T+ E +A ++N P 
Sbjct: 563 YASNHSVEEVQQWLGTVAETHPPLAPNASLLSALIHIQQGDVEQARTLLEPMANEDN-PI 621

Query: 197 GISTRSQMILANIIASDQ 214
           G     Q++ A  + S Q
Sbjct: 622 GYRAYGQLLAAESVLSAQ 639


>gi|170723582|ref|YP_001751270.1| response regulator receiver protein [Pseudomonas putida W619]
 gi|169761585|gb|ACA74901.1| response regulator receiver protein [Pseudomonas putida W619]
          Length = 535

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 72/144 (50%), Gaps = 17/144 (11%)

Query: 77  EKILSQDNKLYNPLSNMY--IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
           + +  Q  K +  + ++Y  +A +LVA+G+TK A  +  +     L+PLAVR  A L   
Sbjct: 218 QGVYEQALKAFPIMPSLYDGMADVLVAQGETKRAQNMLEEAVR--LSPLAVRRQAAL--G 273

Query: 135 SILVDTSSYEEISKILQK-LSEPSNPMHQFANEILG-ISAL-----KFGKVQKAK----T 183
            + +D   +E  SK  +  +++  +  ++ A   LG + AL      FG   + +    T
Sbjct: 274 KLALDNEDFEGASKAFRHAVNQGQSSRYKDAESNLGLVQALMNKNAGFGLDARTRVEINT 333

Query: 184 IFEELAKDNNSPFGISTRSQMILA 207
           +  E+AKDN    G+  R++++ A
Sbjct: 334 VLSEVAKDNVEDQGLQVRARLMKA 357


>gi|225444173|ref|XP_002268853.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 853

 Score = 40.4 bits (93), Expect = 0.16,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 65/126 (51%), Gaps = 12/126 (9%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           + DAR  F+++ S+D  L+N + N Y     V  GD  NA  +F+++   +  P +V +A
Sbjct: 198 IHDARYLFDRMPSKDGVLWNVMLNGY-----VKNGDWDNATGVFMEMRRTETNPNSVTFA 252

Query: 129 ATLQ--AASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             L   A+ I+++  S +    ++    E  +P+   AN +L + A K G +  A+ +F+
Sbjct: 253 CVLSVCASEIMINFGS-QLHGLVVSSGLEMDSPV---ANTLLAMYA-KCGHLFDARRLFD 307

Query: 187 ELAKDN 192
            + K +
Sbjct: 308 MMPKTD 313


>gi|147794059|emb|CAN66615.1| hypothetical protein VITISV_022030 [Vitis vinifera]
          Length = 818

 Score = 40.4 bits (93), Expect = 0.16,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 65/126 (51%), Gaps = 12/126 (9%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           + DAR  F+++ S+D  L+N + N Y     V  GD  NA  +F+++   +  P +V +A
Sbjct: 198 IHDARYLFDRMPSKDGVLWNVMLNGY-----VKNGDWDNATGVFMEMRRTETNPNSVTFA 252

Query: 129 ATLQ--AASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             L   A+ I+++  S +    ++    E  +P+   AN +L + A K G +  A+ +F+
Sbjct: 253 CVLSVCASEIMINFGS-QLHGLVVSSGLEMDSPV---ANTLLAMYA-KCGHLFDARRLFD 307

Query: 187 ELAKDN 192
            + K +
Sbjct: 308 MMPKTD 313


>gi|79369396|ref|NP_176481.2| unknown protein [Arabidopsis thaliana]
 gi|193806495|sp|Q9LQ14|PPR96_ARATH RecName: Full=Pentatricopeptide repeat-containing protein
           At1g62930, chloroplastic; Flags: Precursor
 gi|332195902|gb|AEE34023.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
          Length = 629

 Score = 40.4 bits (93), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 57/133 (42%), Gaps = 12/133 (9%)

Query: 67  NKLDDARSSFEKILSQDN----KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           ++LD+A+  FE ++S+D       YN L   +  +  V +G      E+F +++   L  
Sbjct: 374 DRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEG-----MELFREMSQRGLVG 428

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             V Y   +Q    L      +   KI +K+     P       IL     K+GK++KA 
Sbjct: 429 NTVTYNTLIQG---LFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKYGKLEKAL 485

Query: 183 TIFEELAKDNNSP 195
            +FE L K    P
Sbjct: 486 VVFEYLQKSKMEP 498


>gi|8493580|gb|AAF75803.1|AC011000_6 Contains weak similarity to leaf protein from Ipomea nil gb|D85101
           and contains a RepB PF|01051 protein and multiple PPR
           PF|01535 repeats [Arabidopsis thaliana]
          Length = 613

 Score = 40.4 bits (93), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 57/133 (42%), Gaps = 12/133 (9%)

Query: 67  NKLDDARSSFEKILSQDN----KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           ++LD+A+  FE ++S+D       YN L   +  +  V +G      E+F +++   L  
Sbjct: 358 DRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEG-----MELFREMSQRGLVG 412

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             V Y   +Q    L      +   KI +K+     P       IL     K+GK++KA 
Sbjct: 413 NTVTYNTLIQG---LFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKYGKLEKAL 469

Query: 183 TIFEELAKDNNSP 195
            +FE L K    P
Sbjct: 470 VVFEYLQKSKMEP 482


>gi|118346940|ref|XP_977297.1| TPR Domain containing protein [Tetrahymena thermophila]
 gi|89288714|gb|EAR86702.1| TPR Domain containing protein [Tetrahymena thermophila SB210]
          Length = 607

 Score = 40.4 bits (93), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 103 GDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQ 162
           G+ ++A ++FLK  +D++ PL   Y        +L  T  Y+E  K L K ++P N    
Sbjct: 181 GENEDAIKLFLK--SDEIQPLQDIYL-NYSLGLLLFKTQKYQESIKYLLKQNDPQNF--- 234

Query: 163 FANEILGISALKFGKVQKAKTIFEE 187
           F N +LG S LK  K++++K  F +
Sbjct: 235 FTNYLLGQSYLKINKLEESKIYFHQ 259


>gi|75676212|ref|YP_318633.1| hypothetical protein Nwi_2022 [Nitrobacter winogradskyi Nb-255]
 gi|74421082|gb|ABA05281.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 217

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 69/143 (48%), Gaps = 1/143 (0%)

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           + NK  +A+++F K+       Y  LS +  A+      D   A +++  +A +      
Sbjct: 68  DQNKHAEAQAAFAKLAETAPLGYRNLSRLRAAAEAARH-DINAAVKLYDAIATEGGFSSV 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A ++AA++LVD+ +Y  + + L+  + P       A E+L +SA +      A+  
Sbjct: 127 ERDFARVRAAALLVDSETYNNMLQRLEPAAAPEATFRHSARELLALSAWRSDDATAARKW 186

Query: 185 FEELAKDNNSPFGISTRSQMILA 207
            + +++D+ +P  +  R++ + A
Sbjct: 187 LDMISEDSQTPSSLRGRAEALQA 209


>gi|294012483|ref|YP_003545943.1| hypothetical protein SJA_C1-24970 [Sphingobium japonicum UT26S]
 gi|292675813|dbj|BAI97331.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 232

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 83/192 (43%), Gaps = 3/192 (1%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           +WI   +I+ + + A W Y +    + +   V E   + +         +A+   +K+  
Sbjct: 33  RWIVAAVIIGLAAFAGWLY-WQHYTKTQSQAVSEEMDKVIATAVGGGTPEAKE-LDKLTQ 90

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
                +   + +  A     KGD+K A   +  +A+D       R  A ++  ++  +T 
Sbjct: 91  ASQPGFRASALLVKAGTAARKGDSKAAIAAYKAMADDASLDRPYRDLALIRQTTLEFETL 150

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             +++   L+ L+    P    A E++ I+ +K  K   A  +F  +AKD + P  I +R
Sbjct: 151 QPQQVVDRLKPLAVEGAPWFGSAGELVAIAYMKMRKPDLAGPLFAAMAKDKDVPQSIRSR 210

Query: 202 SQMILANIIASD 213
           ++  +A ++  D
Sbjct: 211 ARQ-MAGLLGVD 221


>gi|83594416|ref|YP_428168.1| hypothetical protein Rru_A3086 [Rhodospirillum rubrum ATCC 11170]
 gi|83577330|gb|ABC23881.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 253

 Score = 39.7 bits (91), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 6/103 (5%)

Query: 102 KGDTKNAAEIFLKVANDDLAPLAVRYAATLQA---ASILVDTSSYEEISKILQKLSEPSN 158
           +G T  A + +  + ND  A    R AA + A      L+D +   EI  +LQ L + + 
Sbjct: 115 EGKTDEAIQGYRGLINDSAADPVFRDAARVLAVLHGLTLLDPA---EIGGLLQPLRDGTG 171

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
           P    A E+  +S+L+ G  + A  I   +  D  +P G+  R
Sbjct: 172 PWRPLAEELAAVSSLRQGDSKAAIEILRGILGDPQAPRGVRQR 214


>gi|255710787|ref|XP_002551677.1| KLTH0A05060p [Lachancea thermotolerans]
 gi|238933054|emb|CAR21235.1| KLTH0A05060p [Lachancea thermotolerans]
          Length = 943

 Score = 39.3 bits (90), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 75/178 (42%), Gaps = 9/178 (5%)

Query: 41  LFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILV 100
           +F  + E +   +    A  L + N  + + A S  EK+L  +N L        IA    
Sbjct: 498 MFTYAQETQHGNITRGLAVGLAVINYGRKELADSLIEKMLLHENALLRYGGAYTIALAYA 557

Query: 101 AKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM 160
             GD K A +  L +A  D +   VR AA +    +L+    Y  + +I++ L+E  N  
Sbjct: 558 GTGDNK-AIKKLLHIAVSD-SDDDVRRAAVIALGFVLI--RDYTTVPRIVELLAESHNAH 613

Query: 161 HQFANEI-LGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
            +      LGIS +  G +Q A  +   L KD   P     ++ MI  ++I   Q  K
Sbjct: 614 VRCGTAFALGISCVGRG-LQAAVDVLMPLTKD---PVDFVRQAAMIALSLILMQQTEK 667


>gi|145534227|ref|XP_001452858.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124420557|emb|CAK85461.1| unnamed protein product [Paramecium tetraurelia]
          Length = 1113

 Score = 39.3 bits (90), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 49/104 (47%), Gaps = 4/104 (3%)

Query: 96  ASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSE 155
           A  L  +   K A + + K  N      AV  AA L+ A  L ++  YEE +K L KL E
Sbjct: 329 ADCLRMQSQYKEAIKSYQKAIN---CEQAVGNAAMLKKAITLFESQQYEECAKDLTKLLE 385

Query: 156 PSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
            ++P +  A    G+S LK     +A   FE+  K NNS   ++
Sbjct: 386 -TDPTNSEAYYFKGLSRLKIKNATEALLCFEQAIKHNNSKKAVT 428


>gi|281412533|ref|YP_003346612.1| Tetratricopeptide TPR_2 repeat protein [Thermotoga naphthophila
           RKU-10]
 gi|281373636|gb|ADA67198.1| Tetratricopeptide TPR_2 repeat protein [Thermotoga naphthophila
           RKU-10]
          Length = 357

 Score = 38.9 bits (89), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 126 RYAATLQA-ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +Y   L+  A +++    Y+E+ + L+K+ E S+P++  A  +L +  +K G++ KA+ I
Sbjct: 265 KYPTELEPWARVMLKHGRYKEVVEELEKIVE-SSPLNTLARLLLVVPYVKLGQIDKAREI 323

Query: 185 FEELAKDN 192
            E++ ++N
Sbjct: 324 LEDIGQNN 331


>gi|225457859|ref|XP_002279149.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 665

 Score = 38.9 bits (89), Expect = 0.48,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 68/136 (50%), Gaps = 10/136 (7%)

Query: 58  AQALELFNS-NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           + +++LF+  N+L+D+   FE+I   D+ L N + + Y        G  +NA ++F+   
Sbjct: 307 SASIDLFSKCNRLEDSVRVFEEIYQWDSVLCNAMISSY-----AWHGFGENALQLFVLTL 361

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
            ++L P     +  L A SIL+      +I  ++ K    S+ +   A+ ++ + A KFG
Sbjct: 362 RENLRPTEFTLSIVLSAVSILLPVDQGSQIHSLVVKSGLESDVI--VASSLVEMYA-KFG 418

Query: 177 KVQKAKTIFEEL-AKD 191
            +  A   F ++ A+D
Sbjct: 419 LIDSAMKTFAKIGARD 434


>gi|114762904|ref|ZP_01442336.1| hypothetical protein 1100011001359_R2601_26321 [Pelagibaca
           bermudensis HTCC2601]
 gi|114544514|gb|EAU47521.1| hypothetical protein R2601_26321 [Roseovarius sp. HTCC2601]
          Length = 218

 Score = 38.9 bits (89), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 13/192 (6%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WIA LL+++++  A W    +         +G+    ALE       D+A++    + 
Sbjct: 27  YGWIAVLLVILLVGGAAWREYSNAQSRSAAQALGDEILAALE------ADEAQARVAALS 80

Query: 81  SQDNKLYNPLSNMYIASIL---VAKGDTKNAAEIFLK-VANDDLAPLAVRYAATLQAASI 136
             D     P +   IA +     A+ +   AA + L+ VA +   P   R  A+ +A S 
Sbjct: 81  EIDAP--TPGAEALIAMLTASEAARAEDMEAAALSLESVAANGEVPEIYREIASYKAMSQ 138

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
                S +E    L+ L+ P  P+   A E L +  ++ G    A+     + +D+ +  
Sbjct: 139 AGSGLSIDERRAGLESLAVPGKPLRLLAEEQLALLDIEAGDRLAAEERLRRIVEDSEATA 198

Query: 197 GISTR-SQMILA 207
           G+  R SQMI+A
Sbjct: 199 GLRQRASQMIIA 210


>gi|126736008|ref|ZP_01751752.1| hypothetical protein RCCS2_02198 [Roseobacter sp. CCS2]
 gi|126714565|gb|EBA11432.1| hypothetical protein RCCS2_02198 [Roseobacter sp. CCS2]
          Length = 218

 Score = 38.9 bits (89), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 68/186 (36%), Gaps = 7/186 (3%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WI    +L+++  A W    +          G+    ALE  +      A +  E   
Sbjct: 27  YGWIGVAAVLLLVGGAAWNEYSNAQARSAAEATGDALMSALEENDPTVRAAAMAQVEG-- 84

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
              +     ++ +  A+     GD   AA+    V  +   P   R  A L+AA +  D 
Sbjct: 85  ---DGAAAAVTLLLRAATEQEAGDNAAAAQTLNDVTTNPDVPEMYRDVAALKAAMLPSDD 141

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
            +    +  L+ LS+P  P    A E +    L  G    A  +  E+ +D     G+  
Sbjct: 142 VAARRAN--LEALSQPGQPFRLLALEQIAYMTLGEGDADGAIAVMREIVEDAGVTRGLRE 199

Query: 201 RSQMIL 206
           R Q ++
Sbjct: 200 RVQTLM 205


>gi|229593976|ref|XP_001025860.2| TPR Domain containing protein [Tetrahymena thermophila]
 gi|225567179|gb|EAS05615.2| TPR Domain containing protein [Tetrahymena thermophila SB210]
          Length = 674

 Score = 38.9 bits (89), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 67/130 (51%), Gaps = 9/130 (6%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK-V 115
           F   ++ FN+N  +DA+  FEK +  + +L    + MY+ +I   KG  + + E+ LK +
Sbjct: 114 FKLGVDQFNTNMHEDAKKFFEKAIELNPQL--GEAYMYLGAISQQKGMIEESKELLLKAI 171

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
             DD       Y+A +  A+  + T+  ++  K  +K +    P++ +A  +LG+   + 
Sbjct: 172 QLDDKC-----YSAHMYIANYYLATNQVKKAIKSCEK-ALKIGPINHWAYHVLGMCYYRQ 225

Query: 176 GKVQKAKTIF 185
             ++KAKT +
Sbjct: 226 QDLEKAKTYY 235


>gi|77460482|ref|YP_349989.1| response regulator receiver domain-containing protein [Pseudomonas
           fluorescens Pf0-1]
 gi|77384485|gb|ABA75998.1| Response regulator receiver domain protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 534

 Score = 38.9 bits (89), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMY--IASILVAKGDTKNAAEIFLKVANDDL 120
           LF   ++  A+  +EK L    K++  +  +Y  +A +LVA+GDTK A ++  +     L
Sbjct: 208 LFKRGQVSQAKGVYEKAL----KVFPMMPALYDGMADVLVAEGDTKGAQQVLEEAIR--L 261

Query: 121 APLAVRYAATL 131
           +PLAVR  A L
Sbjct: 262 SPLAVRRQALL 272


>gi|302800064|ref|XP_002981790.1| hypothetical protein SELMODRAFT_444974 [Selaginella moellendorffii]
 gi|300150622|gb|EFJ17272.1| hypothetical protein SELMODRAFT_444974 [Selaginella moellendorffii]
          Length = 611

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 67/134 (50%), Gaps = 16/134 (11%)

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA--PLA 124
            +LDDAR++FE++  +++  +N +   Y        G  + A E+F ++     +  P  
Sbjct: 80  GRLDDARAAFEELQWKNSVTWNAMMTNYKLD-----GRDREALELFREMCERSRSARPDK 134

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL----KFGKVQK 180
             ++  ++A S L D     EI ++L++       +H+  + ++G + L    K G +++
Sbjct: 135 FSFSIAIEACSNLEDLEQGREIHEMLRR---EGKELHK--DVVVGTALLNMYSKCGDLEE 189

Query: 181 AKTIFEELAKDNNS 194
           A+ +F+ +  D +S
Sbjct: 190 ARKVFDSIRHDADS 203


>gi|170288929|ref|YP_001739167.1| TPR repeat-containing protein [Thermotoga sp. RQ2]
 gi|170176432|gb|ACB09484.1| Tetratricopeptide TPR_2 repeat protein [Thermotoga sp. RQ2]
          Length = 357

 Score = 38.5 bits (88), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 75/152 (49%), Gaps = 14/152 (9%)

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAK-GDTKNAAEIFLKVANDDLAPLAV 125
           N+ D A  + E++L  D    + +  +Y  S L  + G  + A E+  K+ N        
Sbjct: 213 NRKDLAVKALERLLEIDP---DNIPALYQLSQLYRELGSEEKAREMEEKIMN-----CKP 264

Query: 126 RYAATLQA-ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +Y   L+  A +++    Y+E+ + L+K+ E S+P++  A  +L +  +K G++ KA+ I
Sbjct: 265 KYPTELEPWARVMLKHGRYKEVVEELEKIVE-SSPLNTLARLLLVVPYVKLGQIDKAREI 323

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRN 216
            +++ + N   F      + IL  ++  +++ 
Sbjct: 324 LDDIGQSN---FWYYYGKKEILDELLTEEEKR 352


>gi|297740904|emb|CBI31086.3| unnamed protein product [Vitis vinifera]
          Length = 766

 Score = 38.5 bits (88), Expect = 0.60,   Method: Composition-based stats.
 Identities = 39/150 (26%), Positives = 67/150 (44%), Gaps = 15/150 (10%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           + DAR  F+++ S+D  L+N + N Y     V  GD  NA  +F+++   +  P +V +A
Sbjct: 198 IHDARYLFDRMPSKDGVLWNVMLNGY-----VKNGDWDNATGVFMEMRRTETNPNSVTFA 252

Query: 129 ATLQ--AASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             L   A+ I+++  S      +   L   S   + FA  ++ I   K   V+ A+ IF 
Sbjct: 253 CVLSVCASEIMINFGSQLHGLVVSSGLEMDSPVANTFA--LIDIY-FKCRDVEMARKIF- 308

Query: 187 ELAKDNNSPFGISTRSQMILANIIASDQRN 216
               D  +P  I   + MI   ++     N
Sbjct: 309 ----DQRTPVDIVVCTAMISGYVLNGMNNN 334


>gi|302798965|ref|XP_002981242.1| hypothetical protein SELMODRAFT_113974 [Selaginella moellendorffii]
 gi|300151296|gb|EFJ17943.1| hypothetical protein SELMODRAFT_113974 [Selaginella moellendorffii]
          Length = 734

 Score = 38.5 bits (88), Expect = 0.67,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 65/125 (52%), Gaps = 12/125 (9%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           +++AR  F+++ S+D   +  +   Y       +GD+K A E+F ++  + + P +V ++
Sbjct: 464 MEEARKIFDRMESRDVLTWTVMIKGY-----AQQGDSKAALELFHRMKPEGVEPDSVTFS 518

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF-ANEILGISALKFGKVQKAKTIFEE 187
           + LQA S L D    E  ++I   L+     M  F  N ++ + A + G ++ A+ IFE 
Sbjct: 519 SVLQACSNLED--GREVHARI---LAAQGGKMSDFLGNGLINMYA-RCGSMRDARQIFES 572

Query: 188 LAKDN 192
           + + +
Sbjct: 573 MDRSS 577


>gi|302801912|ref|XP_002982712.1| hypothetical protein SELMODRAFT_116683 [Selaginella moellendorffii]
 gi|300149811|gb|EFJ16465.1| hypothetical protein SELMODRAFT_116683 [Selaginella moellendorffii]
          Length = 734

 Score = 38.5 bits (88), Expect = 0.67,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 65/125 (52%), Gaps = 12/125 (9%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           +++AR  F+++ S+D   +  +   Y       +GD+K A E+F ++  + + P +V ++
Sbjct: 464 MEEARKIFDRMESRDVLTWTVMIKGY-----AQQGDSKAALELFHRMKPEGVEPDSVTFS 518

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF-ANEILGISALKFGKVQKAKTIFEE 187
           + LQA S L D    E  ++I   L+     M  F  N ++ + A + G ++ A+ IFE 
Sbjct: 519 SVLQACSNLED--GREVHARI---LAAQGGKMSDFLGNGLINMYA-RCGSMRDARQIFES 572

Query: 188 LAKDN 192
           + + +
Sbjct: 573 MDRSS 577


>gi|297830178|ref|XP_002882971.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata
           subsp. lyrata]
 gi|297328811|gb|EFH59230.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata
           subsp. lyrata]
          Length = 642

 Score = 38.5 bits (88), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 63/127 (49%), Gaps = 21/127 (16%)

Query: 89  PLSNMY--IASILVAKGDTKNAAEIFLKVAND-DLAPLAVRYAATLQAASILVDTSSYEE 145
           P S+ Y  +  +L+ +G  +   E++ ++ N+ D  P  + Y+A +         SSYE+
Sbjct: 195 PTSSTYNSVILMLMQEGQHEKVHEVYTEMCNEGDCFPDTITYSALI---------SSYEK 245

Query: 146 ISK------ILQKLSEPS-NPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
           + +      +  ++ +    P  +    +LGI   K GKV+KA  +FEE+ +   SP  +
Sbjct: 246 LGRNDSAIRLFDEMKDNCMQPTEKIYTTLLGI-YFKVGKVEKALDLFEEMKRAGCSP-TV 303

Query: 199 STRSQMI 205
            T +++I
Sbjct: 304 YTYTELI 310


>gi|313497134|gb|ADR58500.1| Response regulator/TPR domain-containing protein [Pseudomonas
           putida BIRD-1]
          Length = 577

 Score = 38.5 bits (88), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 71/144 (49%), Gaps = 17/144 (11%)

Query: 77  EKILSQDNKLYNPLSNMY--IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
           + +  Q  K +  +  +Y  +A +LVA+GDT+ A  +  +     L+PL+VR  +TL   
Sbjct: 260 QGVYEQALKAFPIMPGLYDGMAEVLVAQGDTRRAQNLLEEAVR--LSPLSVRRQSTL--G 315

Query: 135 SILVDTSSYEEISKILQK-LSEPSNPMHQFANEILG-ISAL-----KFGKVQKAK----T 183
            + ++   +E  SK  +  +++  +  ++ A   LG + AL      FG   + +    T
Sbjct: 316 KLALENEDFESASKAFRHAVNQGQSSRYKDAENNLGLVQALMSKNAGFGLDARTRVEINT 375

Query: 184 IFEELAKDNNSPFGISTRSQMILA 207
              E+AK+N    G+  R++M+ A
Sbjct: 376 TLSEVAKENPEDQGLQVRARMMKA 399


>gi|26987504|ref|NP_742929.1| response regulator/TPR domain-containing protein [Pseudomonas
           putida KT2440]
 gi|148546041|ref|YP_001266143.1| response regulator receiver protein [Pseudomonas putida F1]
 gi|24982171|gb|AAN66393.1|AE016267_2 response regulator/TPR domain protein [Pseudomonas putida KT2440]
 gi|148510099|gb|ABQ76959.1| response regulator receiver protein [Pseudomonas putida F1]
          Length = 535

 Score = 38.5 bits (88), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 71/144 (49%), Gaps = 17/144 (11%)

Query: 77  EKILSQDNKLYNPLSNMY--IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
           + +  Q  K +  +  +Y  +A +LVA+GDT+ A  +  +     L+PL+VR  +TL   
Sbjct: 218 QGVYEQALKAFPIMPGLYDGMAEVLVAQGDTRRAQNLLEEAVR--LSPLSVRRQSTL--G 273

Query: 135 SILVDTSSYEEISKILQK-LSEPSNPMHQFANEILG-ISAL-----KFGKVQKAK----T 183
            + ++   +E  SK  +  +++  +  ++ A   LG + AL      FG   + +    T
Sbjct: 274 KLALENEDFESASKAFRHAVNQGQSSRYKDAENNLGLVQALMSKNAGFGLDARTRVEINT 333

Query: 184 IFEELAKDNNSPFGISTRSQMILA 207
              E+AK+N    G+  R++M+ A
Sbjct: 334 TLSEVAKENPEDQGLQVRARMMKA 357


>gi|28393724|gb|AAO42273.1| unknown protein [Arabidopsis thaliana]
          Length = 642

 Score = 38.5 bits (88), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 63/127 (49%), Gaps = 21/127 (16%)

Query: 89  PLSNMY--IASILVAKGDTKNAAEIFLKVAND-DLAPLAVRYAATLQAASILVDTSSYEE 145
           P S+ Y  +  +L+ +G  +   E++ ++ N+ D  P  + Y+A +         SSYE+
Sbjct: 195 PTSSTYNSVILMLMQEGQHEKVHEVYTEMCNEGDCFPDTITYSALI---------SSYEK 245

Query: 146 ISK------ILQKLSEPS-NPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
           + +      +  ++ +    P  +    +LGI   K GKV+KA  +FEE+ +   SP  +
Sbjct: 246 LGRNDSAIRLFDEMKDNCMQPTEKIYTTLLGI-YFKVGKVEKALDLFEEMKRAGCSP-TV 303

Query: 199 STRSQMI 205
            T +++I
Sbjct: 304 YTYTELI 310


>gi|15233259|ref|NP_188222.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis
           thaliana]
 gi|75274469|sp|Q9LW84|PP236_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g16010
 gi|9294448|dbj|BAB02667.1| unnamed protein product [Arabidopsis thaliana]
 gi|332642241|gb|AEE75762.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
          Length = 642

 Score = 38.5 bits (88), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 63/127 (49%), Gaps = 21/127 (16%)

Query: 89  PLSNMY--IASILVAKGDTKNAAEIFLKVAND-DLAPLAVRYAATLQAASILVDTSSYEE 145
           P S+ Y  +  +L+ +G  +   E++ ++ N+ D  P  + Y+A +         SSYE+
Sbjct: 195 PTSSTYNSVILMLMQEGQHEKVHEVYTEMCNEGDCFPDTITYSALI---------SSYEK 245

Query: 146 ISK------ILQKLSEPS-NPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
           + +      +  ++ +    P  +    +LGI   K GKV+KA  +FEE+ +   SP  +
Sbjct: 246 LGRNDSAIRLFDEMKDNCMQPTEKIYTTLLGI-YFKVGKVEKALDLFEEMKRAGCSP-TV 303

Query: 199 STRSQMI 205
            T +++I
Sbjct: 304 YTYTELI 310


>gi|147833409|emb|CAN68525.1| hypothetical protein VITISV_018083 [Vitis vinifera]
          Length = 1796

 Score = 38.5 bits (88), Expect = 0.70,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 68/136 (50%), Gaps = 10/136 (7%)

Query: 58   AQALELFNS-NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
            + +++LF+  N+L+D+   FE+I   D+ L N + + Y        G  +NA ++F+   
Sbjct: 980  SASIDLFSKCNRLEDSVRVFEEIYQWDSVLCNAMISSY-----AWHGFGENALQLFVLTL 1034

Query: 117  NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
             ++L P     +  L A SIL+      +I  ++ K    S+ +   A+ ++ + A KFG
Sbjct: 1035 RENLRPTEFTLSIVLSAVSILLPVDQGSQIHSLVVKSGLESDVI--VASSLVEMYA-KFG 1091

Query: 177  KVQKAKTIFEEL-AKD 191
             +  A   F ++ A+D
Sbjct: 1092 LIDSAMKTFAKIGARD 1107


>gi|167031824|ref|YP_001667055.1| response regulator receiver protein [Pseudomonas putida GB-1]
 gi|166858312|gb|ABY96719.1| response regulator receiver protein [Pseudomonas putida GB-1]
          Length = 535

 Score = 38.5 bits (88), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 71/144 (49%), Gaps = 17/144 (11%)

Query: 77  EKILSQDNKLYNPLSNMY--IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
           + +  Q  K +  +  +Y  +A +LVA+GDT+ A  +  +     L+PL+VR  +TL   
Sbjct: 218 QGVYEQALKAFPIMPGLYDGMAEVLVAQGDTRRAQNLLEEAVR--LSPLSVRRQSTL--G 273

Query: 135 SILVDTSSYEEISKILQK-LSEPSNPMHQFANEILG-ISAL-----KFGKVQKAK----T 183
            + ++   +E  SK  +  +++  +  ++ A   LG + AL      FG   + +    T
Sbjct: 274 KLALENEDFESASKAFRHAVNQGQSSRYKDAENNLGLVQALMSKNAGFGLDARTRVEINT 333

Query: 184 IFEELAKDNNSPFGISTRSQMILA 207
              E+AK+N    G+  R++M+ A
Sbjct: 334 TLSEVAKENPEDQGLQVRARMMKA 357


>gi|294086066|ref|YP_003552826.1| hypothetical protein SAR116_2499 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665641|gb|ADE40742.1| hypothetical membrane associated protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 208

 Score = 38.5 bits (88), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 81/197 (41%), Gaps = 20/197 (10%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSN-KLD 70
           GK  +G C           +++ LA+      G H+       +   +A +L++++ K D
Sbjct: 25  GKYVIGAC-----------LVVVLAV------GGHQGYGIYSTKQIEKAADLYHTSLKAD 67

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND-DLAPLAVRYAA 129
           D  SS    + +    Y  L+   IA+     GD   A   +  +A D ++ PL  ++A 
Sbjct: 68  DVISSLNNNVDELTDGYQMLARFQIAAAEARAGDHAAAQASYSALAEDKNIDPLYQQFAQ 127

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L   +   D SS + +   L  L   +      A E      L+ GKV  AKT  E++ 
Sbjct: 128 LLSVMNAPAD-SSVQSLQDRLAPLISAAGTWQGLALEQSAGLDLQTGKVDAAKTKLEQIV 186

Query: 190 KDNNSPFGISTRSQMIL 206
           K    P  +  R+Q +L
Sbjct: 187 KLTEIPQSLRQRAQRML 203


>gi|302789998|ref|XP_002976767.1| hypothetical protein SELMODRAFT_105248 [Selaginella moellendorffii]
 gi|300155805|gb|EFJ22436.1| hypothetical protein SELMODRAFT_105248 [Selaginella moellendorffii]
          Length = 669

 Score = 38.1 bits (87), Expect = 0.76,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 62/131 (47%), Gaps = 14/131 (10%)

Query: 70  DDARSSFEKILSQ----DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           ++A   FE++ S+    D   YN + +MY        G    A E++ K+ + +     V
Sbjct: 195 EEALKWFERMKSEGIVPDEVTYNSVIDMYGRV-----GRVNEAVELYEKLKSVNWKLDTV 249

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEP-SNPMHQFANEILGISALKFGKVQKAKTI 184
            Y A    A++      Y+ I +++Q++ +  S+P     N ++G  + K GKV +AK +
Sbjct: 250 TYGAI---ANVYARAGDYQSIMQLVQEMRDSGSSPNAVIMNTLMGTLS-KAGKVNQAKKV 305

Query: 185 FEELAKDNNSP 195
           F E+     SP
Sbjct: 306 FNEMRTSGVSP 316


>gi|84503433|ref|ZP_01001493.1| hypothetical protein OB2597_03749 [Oceanicola batsensis HTCC2597]
 gi|84388220|gb|EAQ01172.1| hypothetical protein OB2597_03749 [Oceanicola batsensis HTCC2597]
          Length = 205

 Score = 38.1 bits (87), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 69/162 (42%), Gaps = 6/162 (3%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEK-KKNIVGENFAQALELFNSNKLDDARSSFEKI 79
           Y WIA L+IL+I+  A W Y +D S E  +    G+    ALE     +   A S+ E  
Sbjct: 8   YGWIAVLVILLIVGGAAW-YEYDRSRETAQARAFGDAILAALEQGEPLERATALSAIEAG 66

Query: 80  LSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
            + D +    + +M  A      GD + A  +   VA +    L  R  A  +A ++  D
Sbjct: 67  -TPDAR---AVRDMLEAGERSTAGDREGALTLLTGVAENPELQLIYRSLAKFRALALSTD 122

Query: 140 TSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
                E     + L+   +P+   A E + ++ ++ G   +A
Sbjct: 123 DMGPAERRAEYEDLAGAGSPLRLLAKEQIAVTHIEEGNRDEA 164


>gi|145512886|ref|XP_001442354.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124409707|emb|CAK74957.1| unnamed protein product [Paramecium tetraurelia]
          Length = 1111

 Score = 38.1 bits (87), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 49/104 (47%), Gaps = 4/104 (3%)

Query: 96  ASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSE 155
           A  L  +   K A + + K  N      AV  AA L+ A  L ++  YEE +K L KL E
Sbjct: 337 ADCLRMQCQYKEAIKYYQKAIN---CEQAVGNAAILKKAITLYESQQYEECAKDLSKLLE 393

Query: 156 PSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
            ++P +  A    G+S LK     +A   FE+  K NNS   ++
Sbjct: 394 -TDPTNSEAYYFKGLSRLKIKNNTEALLCFEQAIKHNNSKKAVT 436


>gi|307294127|ref|ZP_07573971.1| Protein of unknown function DUF2133 [Sphingobium chlorophenolicum
           L-1]
 gi|306880278|gb|EFN11495.1| Protein of unknown function DUF2133 [Sphingobium chlorophenolicum
           L-1]
          Length = 232

 Score = 38.1 bits (87), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 82/192 (42%), Gaps = 3/192 (1%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           +WI  L++  +L    + Y +    + +   V E   + +         DA+   +K+  
Sbjct: 33  RWIVALVVGGLLLFGAFLY-WQHYTKTQSQAVSEEMDKVISTAVGGGTPDAKE-LDKLTQ 90

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
                +   + +  A     KGD+K A   +  +A+D       R  A ++  ++  ++ 
Sbjct: 91  ASQPGFRASALLVKAGTAARKGDSKAAIAAYKAMADDASLDQPYRDLALIRQTTLEYESL 150

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             +++   L+ L+    P    A E++ I+ +K  K   A  +F  +AKD N P  I +R
Sbjct: 151 QPQQVVDRLKPLAVEGAPWFGSAGELVAIAYMKMRKPDLAGPLFAAMAKDKNVPQSIRSR 210

Query: 202 SQMILANIIASD 213
           ++  +A ++  D
Sbjct: 211 ARQ-MAGLLGVD 221


>gi|302817788|ref|XP_002990569.1| hypothetical protein SELMODRAFT_131810 [Selaginella moellendorffii]
 gi|300141737|gb|EFJ08446.1| hypothetical protein SELMODRAFT_131810 [Selaginella moellendorffii]
          Length = 564

 Score = 38.1 bits (87), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 59/124 (47%), Gaps = 12/124 (9%)

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
             L DA+  F++I  +D   +N L ++YI      +G  K A E+F ++    L P +V 
Sbjct: 202 GSLSDAKRVFDRIAFRDVISWNALMSVYI-----QQGHRKEAFELFKRMDKAGLQPNSVT 256

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
           Y + L A       SS E++ +I Q+L++      +     L  +  KF  ++ +  +FE
Sbjct: 257 YLSLLPAC------SSLEQLREIHQELADQGLEQDEQVGNTLITAYNKF-SLEDSVAVFE 309

Query: 187 ELAK 190
            + +
Sbjct: 310 RMKR 313


>gi|254489034|ref|ZP_05102239.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214045903|gb|EEB86541.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 243

 Score = 38.1 bits (87), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 60/150 (40%), Gaps = 4/150 (2%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WIA L I++I+  A W          K   +G+    AL L ++     A S+ E   
Sbjct: 33  YGWIAVLAIVLIVGAAAWNEYQKAQARSKAEALGDAAFAALTLQDTEGRAAALSAVET-- 90

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
             D+     +     A+  V  GD   A E    +A +   P   R  A L++ ++    
Sbjct: 91  --DSPRAAAVLGFLTAAEQVEAGDKSAAIETLNAIAVNGEVPAIYREIAQLKSVTLQGTE 148

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGI 170
           +   +    L+ L++P N +   A E L +
Sbjct: 149 TPVSDRRLALEALAQPGNTLRLLAEEQLAL 178


>gi|302782654|ref|XP_002973100.1| hypothetical protein SELMODRAFT_442013 [Selaginella moellendorffii]
 gi|300158853|gb|EFJ25474.1| hypothetical protein SELMODRAFT_442013 [Selaginella moellendorffii]
          Length = 674

 Score = 37.7 bits (86), Expect = 1.0,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 62/131 (47%), Gaps = 14/131 (10%)

Query: 70  DDARSSFEKILSQ----DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           ++A   FE++ S+    D   YN + +MY        G    A E++ K+ + +     V
Sbjct: 195 EEALKWFERMKSEGIVPDEVTYNSVIDMYGRV-----GRVNEAVELYEKLKSVNWKLDTV 249

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEP-SNPMHQFANEILGISALKFGKVQKAKTI 184
            Y A    A++      Y+ I +++Q++ +  S+P     N ++G  + K GKV +AK +
Sbjct: 250 TYGAI---ANVYARAGDYQSIIQLVQEMRDSGSSPNAVIMNTLMGTLS-KAGKVNQAKKV 305

Query: 185 FEELAKDNNSP 195
           F E+     SP
Sbjct: 306 FNEMRTSGVSP 316


>gi|70731837|ref|YP_261579.1| response regulator/TPR domain-containing protein [Pseudomonas
           fluorescens Pf-5]
 gi|68346136|gb|AAY93742.1| response regulator/TPR domain protein [Pseudomonas fluorescens
           Pf-5]
          Length = 534

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMY--IASILVAKGDTKNAAEIFLKVANDDL 120
           LF   ++ +A++ +EK L    K +  +  +Y  +A +LVA+GDT+ A  +  +     L
Sbjct: 208 LFKRGQVGEAKAVYEKAL----KAFPMMPGLYDGLAEVLVAEGDTQRAQNVLEEAVR--L 261

Query: 121 APLAVRYAATL 131
           +PLAVR  A L
Sbjct: 262 SPLAVRRQALL 272


>gi|222099856|ref|YP_002534424.1| Tetratricopeptide TPR_2 repeat protein [Thermotoga neapolitana DSM
           4359]
 gi|221572245|gb|ACM23057.1| Tetratricopeptide TPR_2 repeat protein [Thermotoga neapolitana DSM
           4359]
          Length = 367

 Score = 37.7 bits (86), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
           A +++    Y E+++ L+++ E S P++  A  +L +  +K GK+ KAK + E+L + N
Sbjct: 284 AKVMLKHGKYREVAEELERIVETS-PLNTLAKLLLVVPYVKMGKIDKAKELLEDLEQTN 341


>gi|291622145|emb|CBJ23782.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis
           thaliana]
          Length = 630

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 56/133 (42%), Gaps = 12/133 (9%)

Query: 67  NKLDDARSSFEKILSQDN----KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           ++LD+A+  F  ++S+D       YN L   +  +  V +G      E+F +++   L  
Sbjct: 375 DRLDEAQQIFTLMVSKDCLPDVVTYNTLIKGFCKAKRVEEG-----MELFREMSQRGLVG 429

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             V Y   +Q    L      +   KI +K+     P       IL     K+GK++KA 
Sbjct: 430 NTVTYNTLIQG---LFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKYGKLEKAL 486

Query: 183 TIFEELAKDNNSP 195
            +FE L K    P
Sbjct: 487 VVFEYLQKSKMEP 499


>gi|302793632|ref|XP_002978581.1| hypothetical protein SELMODRAFT_109016 [Selaginella moellendorffii]
 gi|300153930|gb|EFJ20567.1| hypothetical protein SELMODRAFT_109016 [Selaginella moellendorffii]
          Length = 785

 Score = 37.4 bits (85), Expect = 1.3,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           LD AR  FE    QD   +N + + Y          T++A E+F ++  + +AP  V + 
Sbjct: 618 LDCAREVFETSRRQDTICWNAIISGY-----AQHSQTRDAVELFHRMQQEGVAPDPVTFV 672

Query: 129 ATLQAASI--LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             L   S   L+D   Y   S +   L EP+   +    ++LG    + GK+Q+A+   +
Sbjct: 673 CILSVCSHGGLLDEGVYAYASMVELGL-EPTQDNYACVIDLLG----RAGKLQEAEEFIQ 727

Query: 187 ELA 189
            L 
Sbjct: 728 SLG 730


>gi|255563078|ref|XP_002522543.1| pentatricopeptide repeat-containing protein, putative [Ricinus
           communis]
 gi|223538234|gb|EEF39843.1| pentatricopeptide repeat-containing protein, putative [Ricinus
           communis]
          Length = 530

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 60/134 (44%), Gaps = 17/134 (12%)

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            N   ++DA   FE+ + +D  ++N +   Y  S+  A    + A E+++++      P 
Sbjct: 224 MNRGSVEDAEEIFERTVEKDVVVFNAMIEGYSKSVQTA----EKALEVYVEMQRYGFRPN 279

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL-----KFGKV 178
              +A+ + A S+L      +++   L K         +F   +   SAL     K G++
Sbjct: 280 LSTFASVIGACSVLAGFEIGQQVQGQLLK--------REFFTNVKTGSALIDMYSKCGRI 331

Query: 179 QKAKTIFEELAKDN 192
           + A+  FE++ + N
Sbjct: 332 EDARRAFEQMPEKN 345


>gi|224077710|ref|XP_002305373.1| predicted protein [Populus trichocarpa]
 gi|222848337|gb|EEE85884.1| predicted protein [Populus trichocarpa]
          Length = 676

 Score = 37.4 bits (85), Expect = 1.4,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 11/122 (9%)

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK-VANDDLAPLAVRYAA 129
           +AR  F+++  +   LYN +  MYI     AKGD   A ++FL+ + + D  P    Y  
Sbjct: 73  NARKLFDELRQRGTLLYNFMIKMYI-----AKGDYFEAMKVFLEMLGSKDCCPDNYTYPF 127

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSN-PMHQFANEILGISALKFGKVQKAKTIFEEL 188
            ++A S L+      E  ++L  L+  S    H F    L    +  G+V++A+ +F+ +
Sbjct: 128 VIKACSELL----LVEYGRVLHGLTLVSKFGSHLFVLNSLLAMYMNCGEVEEARKVFDAM 183

Query: 189 AK 190
            +
Sbjct: 184 KE 185


>gi|225468708|ref|XP_002270940.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 640

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 73/157 (46%), Gaps = 15/157 (9%)

Query: 49  KKNIVGENFAQA---LELF---NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAK 102
           K ++ G NF  A     LF   ++N L  ARS F++I S D  ++N +   Y+ S     
Sbjct: 28  KTSLDGNNFVLAKLLRRLFACSSTNDLPYARSVFDEIPSPDTFIWNTMIRAYLNS----- 82

Query: 103 GDTKNAAEIFLKVANDDLAPL-AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMH 161
            + + +  +F ++   +  P+ +   +  +QA   L D  + +++   + K+   S+   
Sbjct: 83  QNPQESMSLFFQMRLQECIPIDSYSLSLVIQACGRLKDLGNGQKLHTQVLKIGLGSD--- 139

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
            F    L     KFG ++ A+ I +E+A  +  P+ +
Sbjct: 140 LFVETALIEMYAKFGDIEIARKILDEMAHPDLVPYNV 176


>gi|302774170|ref|XP_002970502.1| hypothetical protein SELMODRAFT_93612 [Selaginella moellendorffii]
 gi|300162018|gb|EFJ28632.1| hypothetical protein SELMODRAFT_93612 [Selaginella moellendorffii]
          Length = 825

 Score = 37.0 bits (84), Expect = 1.9,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           LD AR  FE    QD   +N + + Y        G T++A E+F ++  + + P  V + 
Sbjct: 658 LDCAREVFETSRRQDIICWNAIISGY-----AQHGQTRDAVELFHRMQQEGVTPDPVTFV 712

Query: 129 ATLQAASI--LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             L   S   L+D   Y   S +   L EP+   +    ++LG    + GK+Q+A+   +
Sbjct: 713 CILSVCSHGGLLDEGVYAYASMVELGL-EPTQDNYACVIDLLG----RAGKLQEAEEFIQ 767

Query: 187 ELA 189
            L 
Sbjct: 768 SLG 770


>gi|330811248|ref|YP_004355710.1| response regulator, CheY family [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379356|gb|AEA70706.1| Putative response regulator, CheY family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 535

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMY--IASILVAKGDTKNAAEIFLKVANDDL 120
           +F   ++  A++ +EK L    K++  +  +Y  +A +LVA+GDTK A  +  +     L
Sbjct: 208 MFKRGQVGQAKAVYEKAL----KVFPMMPALYDGMADVLVAEGDTKQAQHVLEEAVR--L 261

Query: 121 APLAVRYAATL 131
           +PLAVR  + L
Sbjct: 262 SPLAVRRQSLL 272


>gi|116329905|ref|YP_799623.1| TPR repeat-containing protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116123594|gb|ABJ74865.1| TPR-repeat-containing protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 1197

 Score = 37.0 bits (84), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
           I  A+G  ++A E++ K+ +    P+  +Y  + + A IL +   +E+  + L+++    
Sbjct: 132 IYTAEGKNEDAIEVYGKLES---LPVKDKYNYSFKKAVILKNQGKFEQSYETLKRI---- 184

Query: 158 NPMHQFA-----NEILGISALKFGKVQKAKTIFEELAKDN 192
            P  +FA     N  LG +A++  K ++A+  FEE  K+N
Sbjct: 185 -PAEEFAFPAQLNMQLGDAAVQLKKYEEAEIYFEEARKNN 223


>gi|116329495|ref|YP_799215.1| TPR repeat-containing protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116122239|gb|ABJ80282.1| TPR-repeat-containing protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 1197

 Score = 37.0 bits (84), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
           I  A+G  ++A E++ K+ +    P+  +Y  + + A IL +   +E+  + L+++    
Sbjct: 132 IYTAEGKNEDAIEVYGKLES---LPVKDKYNYSFKKAVILKNQGKFEQSYETLKRI---- 184

Query: 158 NPMHQFA-----NEILGISALKFGKVQKAKTIFEELAKDN 192
            P  +FA     N  LG +A++  K ++A+  FEE  K+N
Sbjct: 185 -PAEEFAFPAQLNMQLGDAAVQLKKYEEAEIYFEEARKNN 223


>gi|169832335|ref|YP_001718317.1| TPR repeat-containing protein [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169639179|gb|ACA60685.1| Tetratricopeptide TPR_2 repeat protein [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 209

 Score = 37.0 bits (84), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 7/126 (5%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           +   N+LD+AR  FEK +   ++++    N+    I   +GD +  AE+  K    +L P
Sbjct: 36  MMQQNRLDEAREHFEKAIETGSRMFEAYVNL--GYIYFKEGDMEKVAEVNRKAV--ELEP 91

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  A L  A + +  +   E  + LQK  E +  + Q  N  L  + L+ G V KA 
Sbjct: 92  RYARGYANLGFAYLQMAKTG--EAIEALQKALELNPEIAQAWNN-LANAYLQRGDVDKAI 148

Query: 183 TIFEEL 188
            + E L
Sbjct: 149 EVGERL 154


>gi|154175148|ref|YP_001408029.1| serine protease [Campylobacter curvus 525.92]
 gi|153793188|gb|ABS50421.1| serine protease [Campylobacter curvus 525.92]
          Length = 134

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 1/98 (1%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           ENF +A EL+ S K ++A + F K   +  K    ++ + + +    K D   A +IF K
Sbjct: 22  ENFDKAQELYGSKKFEEAYTLFNKACGEGVKKGCTMNAIMLFNGDGVKKDRIQAEQIFTK 81

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQK 152
            A DD  P+A      +QA  I  +    EE ++ L K
Sbjct: 82  -ACDDNEPMACAKLGEMQAFGISQNKIKDEEKTRALFK 118


>gi|297739440|emb|CBI29622.3| unnamed protein product [Vitis vinifera]
          Length = 603

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 63/156 (40%), Gaps = 13/156 (8%)

Query: 33  LSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSN 92
           L L  W   F   ++ K +I G N A          ++DA+  F+++ ++D   YN L  
Sbjct: 252 LELGNWVVRFLTENQIKLSISGHN-AMIFMYSRCGSMEDAKRVFQEMATRDVVSYNTL-- 308

Query: 93  MYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQK 152
               S   A G    A  +   +    + P  V +   L A S        EE  K+ + 
Sbjct: 309 ---ISGFAAHGHGVEAINLMSTMKEGGIEPDRVTFIGVLTACS---HAGLLEEGRKVFES 362

Query: 153 LSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           + +P+   +    ++LG    + G+++ AK   E +
Sbjct: 363 IKDPAIDHYACMVDLLG----RVGELEDAKRTMERM 394


>gi|255037808|ref|YP_003088429.1| Tetratricopeptide TPR_2 repeat-containing protein [Dyadobacter
           fermentans DSM 18053]
 gi|254950564|gb|ACT95264.1| Tetratricopeptide TPR_2 repeat protein [Dyadobacter fermentans DSM
           18053]
          Length = 586

 Score = 36.6 bits (83), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 23/82 (28%)

Query: 52  IVGENFAQALELFN---------------------SNKLDDARSSFEKILSQDNKLYNPL 90
           I GE + +A +LF                      +++LD+A+ +F+K LS D+K Y  L
Sbjct: 34  IRGERYTEAGDLFKKLAEGSPSADNQYYLGYYYIKTDQLDEAQKAFDKGLSLDDKSY--L 91

Query: 91  SNMYIASILVAKGDTKNAAEIF 112
           + + + +I +AKGD   A E+F
Sbjct: 92  NKVGLGTIALAKGDRAKAKELF 113


>gi|225456890|ref|XP_002277458.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 698

 Score = 36.2 bits (82), Expect = 2.9,   Method: Composition-based stats.
 Identities = 37/154 (24%), Positives = 64/154 (41%), Gaps = 12/154 (7%)

Query: 53  VGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
           V EN  ++  +     +D A S F +I   D+  YN +   +       K     A  +F
Sbjct: 58  VAENLLESAAILLPTSMDYAVSIFRQIDEPDSPAYNIMIRGF-----TLKQSPHEAILLF 112

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA 172
            ++  + + P    +   L+  S L   S  E+I  ++ K    S   H F    L    
Sbjct: 113 KEMHENSVQPDEFTFPCILKVCSRLQALSEGEQIHALIMKCGFGS---HGFVKNTLIHMY 169

Query: 173 LKFGKVQKAKTIFEELAKDN----NSPFGISTRS 202
              G+V+ A+ +F+E+++ N    NS F   T+S
Sbjct: 170 ANCGEVEVARRVFDEMSERNVRTWNSMFAGYTKS 203


>gi|103487686|ref|YP_617247.1| hypothetical protein Sala_2205 [Sphingopyxis alaskensis RB2256]
 gi|98977763|gb|ABF53914.1| conserved hypothetical protein [Sphingopyxis alaskensis RB2256]
          Length = 253

 Score = 36.2 bits (82), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 89/195 (45%), Gaps = 5/195 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           +WI   ++ ++L+   + Y ++   +  +    E    AL+   +N+   A S  EKI +
Sbjct: 33  RWIIGGVLAILLAFGGYLY-WNHRQDVARGEQAEELIAALDKLEANQPRAATSELEKIAA 91

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
                Y   + M +A++    GD K AA +  KVA D     ++R  A ++  +   DT 
Sbjct: 92  AGTPAYRAAATMQLANVKAGAGDLKAAAALMAKVAADTQVDRSLRDLALIRQTAFEYDTL 151

Query: 142 SYEEISKILQKLSEPSNPMHQF---ANEILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
             E +   ++ + +  +P   +   A E+   +  + G+  +A  ++  +AK  + P  +
Sbjct: 152 KPEAVIARMKPIVDARDPASSWFASAAELSASAHYRLGQFDRAGALYGRIAKLPDLPKSL 211

Query: 199 STRSQMILANIIASD 213
            +RS + +A ++  D
Sbjct: 212 QSRS-VQMAGMLGVD 225


>gi|297733701|emb|CBI14948.3| unnamed protein product [Vitis vinifera]
          Length = 401

 Score = 36.2 bits (82), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 64/154 (41%), Gaps = 12/154 (7%)

Query: 53  VGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
           V EN  ++  +     +D A S F +I   D+  YN +   +       K     A  +F
Sbjct: 58  VAENLLESAAILLPTSMDYAVSIFRQIDEPDSPAYNIMIRGF-----TLKQSPHEAILLF 112

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA 172
            ++  + + P    +   L+  S L   S  E+I  ++ K    S   H F    L    
Sbjct: 113 KEMHENSVQPDEFTFPCILKVCSRLQALSEGEQIHALIMKCGFGS---HGFVKNTLIHMY 169

Query: 173 LKFGKVQKAKTIFEELAKDN----NSPFGISTRS 202
              G+V+ A+ +F+E+++ N    NS F   T+S
Sbjct: 170 ANCGEVEVARRVFDEMSERNVRTWNSMFAGYTKS 203


>gi|302828766|ref|XP_002945950.1| hypothetical protein VOLCADRAFT_78980 [Volvox carteri f.
           nagariensis]
 gi|300268765|gb|EFJ52945.1| hypothetical protein VOLCADRAFT_78980 [Volvox carteri f.
           nagariensis]
          Length = 1321

 Score = 36.2 bits (82), Expect = 3.2,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 55/106 (51%), Gaps = 16/106 (15%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           LF+ ++LD+A + FE+ + QD+     L  +  A IL  K     A ++        LA 
Sbjct: 164 LFDESELDEAYTQFEQAVEQDHSDLQAL--LGKAKILELKKQMAQAVDV--------LAE 213

Query: 123 LAVRYA----ATLQAASILVDTSSYEEISKILQKL--SEPSNPMHQ 162
           + VR+A    A ++ A +L+    +E++++ LQ++  S+  N M Q
Sbjct: 214 INVRFAWFVPALVEKARLLMVLGDWEQVTETLQRVLSSDAQNIMAQ 259


>gi|297833632|ref|XP_002884698.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata
           subsp. lyrata]
 gi|297330538|gb|EFH60957.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata
           subsp. lyrata]
          Length = 685

 Score = 36.2 bits (82), Expect = 3.2,   Method: Composition-based stats.
 Identities = 35/140 (25%), Positives = 62/140 (44%), Gaps = 13/140 (9%)

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           S +L+DA   FE+I  +    +  L + Y  +     G  + A ++F K+    + P + 
Sbjct: 159 SGRLNDAHKVFEEIPERSVVTWTALFSGYTTA-----GKHREAIDLFKKMVEMGVRPDSY 213

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                L A   + D  S E I K ++++    N    F    L     K GK++KA+++F
Sbjct: 214 FIVQVLSACVHVGDLDSGEWIVKHMEEMEMQKN---SFVRTTLVNLYAKCGKMEKARSVF 270

Query: 186 EELAKDNNSPFGISTRSQMI 205
           + + + +     I T S MI
Sbjct: 271 DSMGEKD-----IVTWSTMI 285


>gi|163746869|ref|ZP_02154226.1| hypothetical protein OIHEL45_15739 [Oceanibulbus indolifex HEL-45]
 gi|161379983|gb|EDQ04395.1| hypothetical protein OIHEL45_15739 [Oceanibulbus indolifex HEL-45]
          Length = 234

 Score = 36.2 bits (82), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 82/193 (42%), Gaps = 15/193 (7%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WIA + ++ I+  A W          +   +G+    ALE   SN    AR+     +
Sbjct: 27  YGWIAVVAVIAIVGGAAWNEYSKAQERAQAEALGDAMLAALEADASN----ARAEALAPI 82

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND-DLAP----LAVRYAATLQAAS 135
             +    N + N   A  L   G+   A E    +A D DLAP    LA   A TLQ  S
Sbjct: 83  EAEGPGANAVLNFMRADALAEAGEIDAAVEQLDAIALDGDLAPIYRQLAQFKAVTLQGQS 142

Query: 136 ILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSP 195
           + V      E  + L+ L++P   +   A E L +  ++ G+  KA   ++ +  D  + 
Sbjct: 143 VPV-----AERRQALEALAQPGAALRLLAEEQLALIDIQEGETGKAVARYQSILSDAETT 197

Query: 196 FGISTRS-QMILA 207
             +  R+ Q+I+A
Sbjct: 198 PDLQQRALQVIVA 210


>gi|290979860|ref|XP_002672651.1| predicted protein [Naegleria gruberi]
 gi|284086229|gb|EFC39907.1| predicted protein [Naegleria gruberi]
          Length = 536

 Score = 36.2 bits (82), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 3/88 (3%)

Query: 103 GDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQ 162
           GD   A  +F ++   +  P  V Y   LQA S  V T S   + K +Q     +N + Q
Sbjct: 146 GDANEAFTVFNEMLKQNFQPNIVTYLVLLQACSRFVSTDSGNRVIKHIQDNGLYNNEIIQ 205

Query: 163 FANEILGISALKFGKVQKAKTIFEELAK 190
            +   + +   K G+++ +K IF+EL K
Sbjct: 206 SS---IALYFSKIGELEASKQIFDELLK 230


>gi|225468288|ref|XP_002267847.1| PREDICTED: hypothetical protein, partial [Vitis vinifera]
          Length = 479

 Score = 36.2 bits (82), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 59/132 (44%), Gaps = 18/132 (13%)

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
            ++D A   F   + +DN L+N + + Y  ++L      + A ++F+++ N+ L+P    
Sbjct: 129 GRIDQAVLLFGTTIERDNILFNSMISGYSQNLL-----GEEALKLFVQMRNNGLSPTDHT 183

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL-----KFGKVQKA 181
             + L A   L       ++  ++ K+   SN        +  +SAL     K G + +A
Sbjct: 184 LTSILNACGSLTILQQGRQVHSLVAKMGSESN--------VFVVSALLDMYSKCGSIDEA 235

Query: 182 KTIFEELAKDNN 193
           + +F +  + N 
Sbjct: 236 RCVFYQAVEKNT 247


>gi|148652614|ref|YP_001279707.1| cytochrome c biogenesis factor-like protein [Psychrobacter sp.
           PRwf-1]
 gi|148571698|gb|ABQ93757.1| Cytochrome c biogenesis factor-like protein [Psychrobacter sp.
           PRwf-1]
          Length = 471

 Score = 36.2 bits (82), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (47%), Gaps = 18/120 (15%)

Query: 87  YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP----LAVRYAAT-LQAASILVDTS 141
           Y+P+  M +A IL+A      A E   +     L+P    +AV YA T    +  ++D+S
Sbjct: 197 YDPMRWMRLADILMAFEANDQALEAQSRAYR--LSPEDEEVAVAYAQTKFFTSGGMLDSS 254

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
           S E +  +L+K     NP HQ A  ++ +   + G  ++A+   E L +      GI+ R
Sbjct: 255 SREALQNVLRK-----NPEHQGAQMLMAMGEARSGNYEQAQAWVERLRQ------GIAAR 303


>gi|225467506|ref|XP_002268807.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 719

 Score = 36.2 bits (82), Expect = 3.5,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 58/124 (46%), Gaps = 6/124 (4%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           + D R  FE+I   D  L+N + + Y  +    +  +++A E F ++      P    + 
Sbjct: 292 MSDCRKVFEEITEPDLVLWNTMVSGYSQN----EEFSEDALECFRQMQGIGYRPNDCSFV 347

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
             + A S L   S  ++I  +  K   PSN +    N ++ + + K G +Q A+ +F+ +
Sbjct: 348 CVISACSNLSSPSQGKQIHSLALKSDIPSNRI-SVDNALIAMYS-KCGNLQDARRLFDRM 405

Query: 189 AKDN 192
           A+ N
Sbjct: 406 AEHN 409


>gi|15222409|ref|NP_176529.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis
           thaliana]
 gi|75205330|sp|Q9SH26|PP102_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g63400
 gi|6633845|gb|AAF19704.1|AC008047_11 F2K11.22 [Arabidopsis thaliana]
 gi|332195974|gb|AEE34095.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
          Length = 577

 Score = 35.8 bits (81), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 60/133 (45%), Gaps = 12/133 (9%)

Query: 67  NKLDDARSSFEKILSQDN----KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           ++LD+A+  FE ++S+D       YN L N +  +  + +G      E+F +++   L  
Sbjct: 379 DRLDEAKHMFELMISKDCFPNVVTYNTLINGFCKAKRIDEG-----VELFREMSQRGLVG 433

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             V Y   +       D  + + + K  Q +S+  +P     N +L     K GK++KA 
Sbjct: 434 NTVTYTTLIHGFFQARDCDNAQMVFK--QMVSDGVHPNIMTYNTLLD-GLCKNGKLEKAM 490

Query: 183 TIFEELAKDNNSP 195
            +FE L +    P
Sbjct: 491 VVFEYLQRSKMEP 503


>gi|148262188|ref|YP_001228894.1| TPR repeat-containing protein [Geobacter uraniireducens Rf4]
 gi|146395688|gb|ABQ24321.1| Tetratricopeptide TPR_2 repeat protein [Geobacter uraniireducens
           Rf4]
          Length = 230

 Score = 35.8 bits (81), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNA 108
           + +  ALEL    +L DAR +++K + QD++  + + N+    +L  +GD K A
Sbjct: 12  QQYNNALELQQEGRLRDAREAYQKAVEQDSRYCDAMDNL--GQMLRTEGDVKQA 63


>gi|15231970|ref|NP_187494.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis
           thaliana]
 gi|75207322|sp|Q9SR82|PP219_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein
           At3g08820
 gi|6403507|gb|AAF07847.1|AC010871_23 unknown protein [Arabidopsis thaliana]
 gi|12322725|gb|AAG51349.1|AC012562_10 unknown protein; 90102-88045 [Arabidopsis thaliana]
 gi|332641162|gb|AEE74683.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
          Length = 685

 Score = 35.8 bits (81), Expect = 3.8,   Method: Composition-based stats.
 Identities = 35/140 (25%), Positives = 62/140 (44%), Gaps = 13/140 (9%)

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           S +L+DA   F++I  +    +  L + Y  S     G  + A ++F K+    + P + 
Sbjct: 159 SGRLNDAHKLFDEIPDRSVVTWTALFSGYTTS-----GRHREAIDLFKKMVEMGVKPDSY 213

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                L A   + D  S E I K ++++    N    F    L     K GK++KA+++F
Sbjct: 214 FIVQVLSACVHVGDLDSGEWIVKYMEEMEMQKN---SFVRTTLVNLYAKCGKMEKARSVF 270

Query: 186 EELAKDNNSPFGISTRSQMI 205
           + + + +     I T S MI
Sbjct: 271 DSMVEKD-----IVTWSTMI 285


>gi|170054671|ref|XP_001863235.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167874922|gb|EDS38305.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 188

 Score = 35.8 bits (81), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 141 SSYEEISKILQKLSEPSNPMHQFAN--EILGISALKFGKVQKAKTIFE---ELAKDNNSP 195
           S  EE+ + LQ L+EP+NP  Q +   E+ GI   + G +Q A T F    E A D  +P
Sbjct: 34  SGEEELPEDLQDLAEPNNPRIQASKKLELEGIEWAEKGDLQSALTAFTKSIEAAPDRPAP 93

Query: 196 FGISTRSQMILAN 208
           +    ++   L N
Sbjct: 94  WNNRAQAHRYLGN 106


>gi|302807738|ref|XP_002985563.1| hypothetical protein SELMODRAFT_11063 [Selaginella moellendorffii]
 gi|300146769|gb|EFJ13437.1| hypothetical protein SELMODRAFT_11063 [Selaginella moellendorffii]
          Length = 299

 Score = 35.8 bits (81), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 67/129 (51%), Gaps = 5/129 (3%)

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
            +LD+AR +F+++ +++N + + +S   + +  V  G + +A  +  K+  + + P  + 
Sbjct: 121 GRLDEAREAFDRMPAKNNNV-DVVSWTNMIAAYVQHGQSSSALLLAKKMDLEGVKPDEIA 179

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
            +  L A +    TS   E+ +  ++L   SN +    N ++ +    +G+V  A  +F+
Sbjct: 180 MSTILGACTAHQATSLGRELHRRARELGYASNTI--VGNALVFMYG-SWGRVDDAARVFQ 236

Query: 187 ELAKDNNSP 195
           EL K+ NSP
Sbjct: 237 EL-KNANSP 244


>gi|119944925|ref|YP_942605.1| hypothetical protein Ping_1170 [Psychromonas ingrahamii 37]
 gi|119863529|gb|ABM03006.1| conserved hypothetical protein [Psychromonas ingrahamii 37]
          Length = 226

 Score = 35.8 bits (81), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 78/166 (46%), Gaps = 10/166 (6%)

Query: 27  LLILMILSLA-IWFYLF-DGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS--Q 82
           L+I  ++ LA +W + F + S    +    + ++  L  F S   +    S    ++  Q
Sbjct: 29  LMIAAVIGLAGLWGWRFYNASVITGQEEASQAYSDMLVKFESQGGEAGLDSIRAFIAGNQ 88

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV-ANDDLAPLAVRYAATLQAASILVDTS 141
           DN  Y  L+++ +A   V + D   A   F+++ + ++ APL       L+ A +     
Sbjct: 89  DNN-YGVLASLLLAKEAVQQKDFALAKAQFVQLQSQNEYAPL--NAVINLRLARVEAQLG 145

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
            YE+  K L  ++EPS      AN++ G   L  G ++KA+T F++
Sbjct: 146 EYEQALKTLTLITEPSFLAK--ANQVKGSIYLNMGDIEKARTAFQD 189


>gi|149376328|ref|ZP_01894091.1| TPR repeat protein [Marinobacter algicola DG893]
 gi|149359342|gb|EDM47803.1| TPR repeat protein [Marinobacter algicola DG893]
          Length = 187

 Score = 35.8 bits (81), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 75/157 (47%), Gaps = 15/157 (9%)

Query: 43  DGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAK 102
           +   + ++  + ++F++A+ L       +AR  FE+I   D +   PL+N+ I  I + +
Sbjct: 26  EAERQAREAELTQDFSEAVALLRGGDSGNARDLFEQIHQADPERTGPLANLGI--IALQE 83

Query: 103 GDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQ 162
           G+   A   F +V   D       ++A L    ++       E ++ L + +  ++P H 
Sbjct: 84  GNADEAEAYFRQVLERD-----PEHSAALTHLGVMAREQGEFEQAETLYRQALEADPGHL 138

Query: 163 FANEILGISAL---KFGKVQKAKTIFEE---LAKDNN 193
            A  +L ++ L     G++++A  ++E+   LA++ N
Sbjct: 139 PA--MLNLAILLDIYLGRLEEALPLYEQYQSLAEEPN 173


>gi|302805861|ref|XP_002984681.1| hypothetical protein SELMODRAFT_30598 [Selaginella moellendorffii]
 gi|300147663|gb|EFJ14326.1| hypothetical protein SELMODRAFT_30598 [Selaginella moellendorffii]
          Length = 651

 Score = 35.8 bits (81), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 33/175 (18%), Positives = 80/175 (45%), Gaps = 27/175 (15%)

Query: 63  LFNSNKLDDARSSFEKILSQD----NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
           L  + ++++AR    ++L+       ++Y  L+  Y  +     GD + A  +F ++  +
Sbjct: 440 LAKARQMENARLMLNEMLANGVVPSERIYTALTEGYART-----GDVEKAFGVFQRMKKE 494

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFAN-EILGISALKFGK 177
           +LA   V Y A L+A     ++ +    +++ Q++++     +Q     +L  +  + G+
Sbjct: 495 NLAIDIVAYGALLKAC---CNSGAMHGAAEVFQQITDAGLKHNQITYCTMLDGAYARAGR 551

Query: 178 VQKAKTIFEELAKDNNSP-----------FGISTRS---QMILANIIASDQRNKK 218
           V++A+ +   + +D   P           +G+S R    + +LA ++ S  +  K
Sbjct: 552 VEEAEELVSAMERDGTKPDTLIYNSLINAYGVSGRHEDMEALLAKMVKSSSKQTK 606


>gi|322696035|gb|EFY87833.1| NACHT and Ankyrin domain protein [Metarhizium acridum CQMa 102]
          Length = 824

 Score = 35.8 bits (81), Expect = 4.6,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 11/102 (10%)

Query: 128 AATLQAASILVDTSSYEEISKILQKL-------SEPSNPMHQFANEILGISALKFGKVQK 180
           AA    A  L     Y +  ++L++L       S   NP   FA + LG    + G+++ 
Sbjct: 594 AARQALADDLKRNGRYADAEELLKRLIEDIIRTSSDENPALSFAYDSLGWVLSRQGRLED 653

Query: 181 AKTIFEELAKDNNSPFGIST----RSQMILANIIASDQRNKK 218
           AKT      + +   FG S+    RS++ LA I+A   RN +
Sbjct: 654 AKTFLRNAVEASTQQFGSSSPHTLRSRLTLAEILAKLGRNDE 695


>gi|326403268|ref|YP_004283349.1| hypothetical protein ACMV_11200 [Acidiphilium multivorum AIU301]
 gi|325050129|dbj|BAJ80467.1| hypothetical protein ACMV_11200 [Acidiphilium multivorum AIU301]
          Length = 222

 Score = 35.4 bits (80), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 3/109 (2%)

Query: 103 GDTKNAAEIFLKVA--NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM 160
           GD K A +++  VA  N    P  V   A L  A   +      ++   L  L++P NP 
Sbjct: 113 GDLKTAGQLWAAVAAPNSGATP-PVHDLALLLLAQHEMGVKPDADVRARLATLNKPGNPW 171

Query: 161 HQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
              A   L +  +K GK + A  + EE++ D  SP  +   +Q ++A +
Sbjct: 172 QPLAQLDLALLDMKAGKTKSAHGLLEEVSADPASPPNLRNLAQGLIAKL 220


>gi|118381790|ref|XP_001024055.1| TPR Domain containing protein [Tetrahymena thermophila]
 gi|89305822|gb|EAS03810.1| TPR Domain containing protein [Tetrahymena thermophila SB210]
          Length = 376

 Score = 35.4 bits (80), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 65/134 (48%), Gaps = 13/134 (9%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA---NDDLAPLAV 125
           +++AR S+E++L  + KLY   +N+    ++  K +    A++  + +   ND       
Sbjct: 240 IEEARQSYEQVLQINPKLYQAQNNL---GLIYRKKEMLEEAKVCYEKSIQINDQY----- 291

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
            Y A    +SI  D  + +E  + L+K +   NP++  A+  LG+     G++++AK  F
Sbjct: 292 -YQAYYNLSSIYYDQGNIQEAKQCLEK-AIKINPLYDQAHYNLGLIYYNQGELEEAKRCF 349

Query: 186 EELAKDNNSPFGIS 199
            ++   N   F + 
Sbjct: 350 MKVVLINPQDFQVH 363


>gi|170043015|ref|XP_001849199.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167866458|gb|EDS29841.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 661

 Score = 35.4 bits (80), Expect = 5.4,   Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 44/90 (48%), Gaps = 5/90 (5%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMIL---SLAIWFYLFDGSHEKKKNIVGENFA 58
           ES  DA+S+  K +  KC Y  +  LLIL +    +L +W  L +GSHE        ++ 
Sbjct: 131 ESLFDADSWITK-EAFKCTYISLNHLLILNLAVYPNLWLWSSLENGSHEFYTQDYSNSYV 189

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYN 88
             LEL  +     A S+   IL  D KLY+
Sbjct: 190 NELELVTTWNSSSAHSALADILFHD-KLYD 218


>gi|260575152|ref|ZP_05843153.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259022774|gb|EEW26069.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 215

 Score = 35.4 bits (80), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 71/188 (37%), Gaps = 8/188 (4%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WI  LL+++++  A +      S        G+    ALE  +        +      
Sbjct: 27  YGWIGILLVVLVVGGAAFSEWNKASKRAAAQAFGDAVLAALEAPDPAAR--RAALAAVPA 84

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
           S D      + N+ +AS      D   A     KVA D   P+A R  A L+   +    
Sbjct: 85  SGDRA---AILNLMLASD--PATDRAGALAALDKVAADTTLPVAYRDLAVLRRVVLAGAD 139

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
            +  +    L  ++ P  P    A E L    ++ G    A T  + L  D  +P G+  
Sbjct: 140 MAVADRRAALDPIAAPGRPFRPLALEQLAYLQIEAGDTAAAITALQALTVDQEAPSGLRQ 199

Query: 201 RS-QMILA 207
           R+ Q+I+A
Sbjct: 200 RAVQVIVA 207


>gi|289191967|ref|YP_003457908.1| TPR repeat-containing protein [Methanocaldococcus sp. FS406-22]
 gi|288938417|gb|ADC69172.1| TPR repeat-containing protein [Methanocaldococcus sp. FS406-22]
          Length = 314

 Score = 35.4 bits (80), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 76/162 (46%), Gaps = 21/162 (12%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVA-KGDTKNAAEIFL 113
           +N  +A+E  +  + ++A    +++LS D K  N L  +Y+  I++   GD   + E F 
Sbjct: 9   KNVIKAIEFSDKGEFENAIKCLDEVLSLDPK--NTLV-LYVKGIILKIMGDMDKSMEQFE 65

Query: 114 KVAND-DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN-----PMHQFANEI 167
           K+ N+ + +PL+      L           YE+  K + KLS+ S+     P H+     
Sbjct: 66  KIDNNKEKSPLSWTNLICLNFVK-----GDYEKTLKYIDKLSKISSKCYLSPFHK----- 115

Query: 168 LGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
             +  ++ GK ++    F+EL K N+    I  +  ++L ++
Sbjct: 116 -ALIFIELGKYEEVLKYFDELLKVNDKLSSIWRQKAILLGDL 156


>gi|322374796|ref|ZP_08049310.1| putative helicase [Streptococcus sp. C300]
 gi|321280296|gb|EFX57335.1| putative helicase [Streptococcus sp. C300]
          Length = 881

 Score = 35.4 bits (80), Expect = 5.6,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 66/166 (39%), Gaps = 15/166 (9%)

Query: 23  WIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ 82
           W      L+ L+ A W YL   S  K+   +GE   +A  L +S  L D +S  +  + +
Sbjct: 706 WWLTTACLLFLAFASWRYLCYKSPYKRLQSLGEQIRKA--LLDSGHLTDDQSRVQ--VEE 761

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL-AVRYAATLQAASILVDTS 141
           D + Y     M  A +   KG +    E+F +   +  AP+   RY    Q A      S
Sbjct: 762 DKENY-----MVFAYL---KGGSMRDKELFAQTVGEFFAPVDNQRYLLVAQKAP--AGQS 811

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
            Y  +  + +K  E +     F    +G   L + + +  + I  E
Sbjct: 812 KYFVVPSLFEKRKEEAQKFLDFLRPTIGRYHLVYTRTEAGRKILLE 857


>gi|118395268|ref|XP_001029986.1| TPR Domain containing protein [Tetrahymena thermophila]
 gi|89284269|gb|EAR82323.1| TPR Domain containing protein [Tetrahymena thermophila SB210]
          Length = 461

 Score = 35.4 bits (80), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 44/97 (45%), Gaps = 2/97 (2%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV- 115
           F +A  L   NKLD+A+   EK L  D    +PL    I  I + KGD   A EIF K  
Sbjct: 281 FYEAKMLQVQNKLDEAQKLLEKCLEFDVANLSPLVYNQIGVIYLQKGDIAKAQEIFFKAL 340

Query: 116 -ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQ 151
             N++ A +    A +   +  +    +Y E   +LQ
Sbjct: 341 EINNEEAQIYFNIAVSYNLSKNIEQAINYYEKGLVLQ 377


>gi|302761610|ref|XP_002964227.1| hypothetical protein SELMODRAFT_81196 [Selaginella moellendorffii]
 gi|300167956|gb|EFJ34560.1| hypothetical protein SELMODRAFT_81196 [Selaginella moellendorffii]
          Length = 736

 Score = 35.4 bits (80), Expect = 5.7,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 5/72 (6%)

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           S+ L++AR  FE++ ++D   +N L   Y     V  G  K+A +IF ++  +++AP  +
Sbjct: 313 SSSLEEARQVFERLRTRDVITWNILIVAY-----VQYGQAKDALDIFKQMQLENVAPNEI 367

Query: 126 RYAATLQAASIL 137
             +  L A ++L
Sbjct: 368 TLSNVLSACAVL 379


>gi|148259764|ref|YP_001233891.1| hypothetical protein Acry_0752 [Acidiphilium cryptum JF-5]
 gi|146401445|gb|ABQ29972.1| Uncharacterized protein-like protein [Acidiphilium cryptum JF-5]
          Length = 247

 Score = 35.4 bits (80), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 3/109 (2%)

Query: 103 GDTKNAAEIFLKVA--NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM 160
           GD K A +++  VA  N    P  V   A L  A   +      ++   L  L++P NP 
Sbjct: 138 GDLKTAGQLWAAVAAPNSGATP-PVHDLALLLLAQHEMGVKPDADVRARLATLNKPGNPW 196

Query: 161 HQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
              A   L +  +K GK + A  + EE++ D  SP  +   +Q ++A +
Sbjct: 197 QPLAQLDLALLDMKAGKTKSAHGLLEEVSADPASPPNLRNLAQGLIAKL 245


>gi|77165454|ref|YP_343979.1| TPR repeat-containing protein [Nitrosococcus oceani ATCC 19707]
 gi|76883768|gb|ABA58449.1| TPR repeat protein [Nitrosococcus oceani ATCC 19707]
          Length = 934

 Score = 35.4 bits (80), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 66/145 (45%), Gaps = 15/145 (10%)

Query: 48  KKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKN 107
           + +N  G  +AQ L  F   +  DA +SF+K LS+ N  Y P +  Y       +G    
Sbjct: 267 RARNHPGVTYAQGLLHFQQQQYADALTSFQKTLSK-NPEYMP-AVFYAGIAYYQQGQLTQ 324

Query: 108 AAEI---FLK-VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF 163
           A ++   FLK   + D A      A TL  A I +   +Y     IL+ +    NP    
Sbjct: 325 AGQLLNQFLKRFPHSDTA------AKTL--AMIRLREGNYTSAQAILEPIIA-QNPNDTA 375

Query: 164 ANEILGISALKFGKVQKAKTIFEEL 188
           A ++LG + L  GK +K+   F+++
Sbjct: 376 ALDLLGSAILGQGKPEKSAAYFQKV 400


>gi|120436880|ref|YP_862566.1| hypothetical protein GFO_2543 [Gramella forsetii KT0803]
 gi|117579030|emb|CAL67499.1| conserved hypothetical protein, secreted [Gramella forsetii KT0803]
          Length = 1006

 Score = 35.4 bits (80), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 66/147 (44%), Gaps = 11/147 (7%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
           W+   D +   +K+     F      F SN+ ++A++ F ++  +D+K Y   +  Y+  
Sbjct: 125 WYDRVDENAMSRKDRERFYFNNGYAYFRSNQFEEAQTYFNRV--RDSKEYGSQAKYYLGY 182

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQ--AASILVDTSSYEE-ISKILQKLS 154
           I     D + A E F +V  +D      RY   L    A +     ++E+ I + L++L 
Sbjct: 183 IAYEGDDYEEANEYFEEVKGND------RYTEDLSYFQADMNFKLGNFEKAIEQGLEQLP 236

Query: 155 EPSNPMHQFANEILGISALKFGKVQKA 181
           + +       N+I+G S    GK ++A
Sbjct: 237 KSNRQEIPQLNKIIGESYFNLGKYEEA 263


>gi|302815813|ref|XP_002989587.1| hypothetical protein SELMODRAFT_130050 [Selaginella moellendorffii]
 gi|300142765|gb|EFJ09463.1| hypothetical protein SELMODRAFT_130050 [Selaginella moellendorffii]
          Length = 736

 Score = 35.0 bits (79), Expect = 6.4,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 5/72 (6%)

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           S+ L++AR  FE++ ++D   +N L   Y     V  G  K+A +IF ++  +++AP  +
Sbjct: 313 SSSLEEARQVFERMRTRDVITWNILIVAY-----VQYGQAKDALDIFKQMQLENVAPNEI 367

Query: 126 RYAATLQAASIL 137
             +  L A ++L
Sbjct: 368 TLSNVLSACAVL 379


>gi|254434614|ref|ZP_05048122.1| putative PEP-CTERM system TPR-repeat lipoprotein [Nitrosococcus
           oceani AFC27]
 gi|207090947|gb|EDZ68218.1| putative PEP-CTERM system TPR-repeat lipoprotein [Nitrosococcus
           oceani AFC27]
          Length = 926

 Score = 35.0 bits (79), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 66/145 (45%), Gaps = 15/145 (10%)

Query: 48  KKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKN 107
           + +N  G  +AQ L  F   +  DA +SF+K LS+ N  Y P +  Y       +G    
Sbjct: 259 RARNHPGVTYAQGLLHFQQQQYADALTSFQKTLSK-NPEYMP-AVFYAGIAYYQQGQLTQ 316

Query: 108 AAEI---FLK-VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF 163
           A ++   FLK   + D A      A TL  A I +   +Y     IL+ +    NP    
Sbjct: 317 AGQLLNQFLKRFPHSDTA------AKTL--AMIRLREGNYTSAQAILEPIIA-QNPNDTA 367

Query: 164 ANEILGISALKFGKVQKAKTIFEEL 188
           A ++LG + L  GK +K+   F+++
Sbjct: 368 ALDLLGSAILGQGKPEKSAAYFQKV 392


>gi|86132986|ref|ZP_01051576.1| conserved hypothetical protein [Dokdonia donghaensis MED134]
 gi|85816504|gb|EAQ37692.1| conserved hypothetical protein [Dokdonia donghaensis MED134]
          Length = 209

 Score = 35.0 bits (79), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 56/128 (43%), Gaps = 24/128 (18%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKG--DTKNAAEIF 112
           +   +A+EL++ +KLD+A + FE+I + +    N L + ++A I + K   D +N  E  
Sbjct: 24  QGMRKAMELWDQDKLDEASNLFERIATVEKD--NWLPSYHVAQIAIVKNWRDFENQNETT 81

Query: 113 LKVANDDLA-------------PLAVRYAATLQAASILVDTSSY-----EEISKILQKL- 153
           LKV  D                P A    A L    +  D   Y       I ++ QK+ 
Sbjct: 82  LKVNGDKAQEYINAMRTIEKDNPYADYLQAQLYTVWVAYDGMKYGMKYAGTIGELYQKMV 141

Query: 154 -SEPSNPM 160
             +P NP+
Sbjct: 142 KKDPDNPI 149


>gi|255551975|ref|XP_002517032.1| pentatricopeptide repeat-containing protein, putative [Ricinus
           communis]
 gi|223543667|gb|EEF45195.1| pentatricopeptide repeat-containing protein, putative [Ricinus
           communis]
          Length = 875

 Score = 35.0 bits (79), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 52/123 (42%), Gaps = 8/123 (6%)

Query: 80  LSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
           +S  +  YN + + Y  +     G  K A++IF ++    + P  V +   +    I  +
Sbjct: 326 VSLSSHTYNTMIDTYGKA-----GQIKEASDIFAEMLRKRILPTTVTFNTMIH---ICGN 377

Query: 140 TSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
               EE++ ++QK+ E   P       IL     K   +  A + F+ + KD   P  +S
Sbjct: 378 QGQLEEVALLMQKMEELRCPPDTRTYNILIFIHAKHNDINMAASYFKRMKKDQLQPDLVS 437

Query: 200 TRS 202
            R+
Sbjct: 438 YRT 440


>gi|147801369|emb|CAN74731.1| hypothetical protein VITISV_037837 [Vitis vinifera]
          Length = 719

 Score = 35.0 bits (79), Expect = 7.4,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           + D R  FE+I   D  L+N + + Y  +    +   ++A E F ++      P    + 
Sbjct: 292 MSDCRKVFEEITEPDLVLWNTMVSGYSQN----EEFLEDALECFRQMQGIGYRPNDCSFV 347

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
             + A S L   S  ++I  +  K   PSN +    N ++ + + K G +Q A+ +F+ +
Sbjct: 348 CVISACSNLSSPSQGKQIHSLALKSDIPSNRI-SVDNALIAMYS-KCGNLQDARRLFDRM 405

Query: 189 AKDN 192
           A+ N
Sbjct: 406 AEHN 409


>gi|302796918|ref|XP_002980220.1| hypothetical protein SELMODRAFT_112433 [Selaginella moellendorffii]
 gi|300151836|gb|EFJ18480.1| hypothetical protein SELMODRAFT_112433 [Selaginella moellendorffii]
          Length = 739

 Score = 35.0 bits (79), Expect = 7.8,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 69/150 (46%), Gaps = 14/150 (9%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           L +AR+SF++++ +D      +S   + + L   G+   A EIF ++ ++++AP  +   
Sbjct: 184 LREARASFQEMVVRD-----VVSWTTMITALSEHGEWNEAVEIFWEMVSENVAPNEISCL 238

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L A S L D S    I + +       +     AN ++     + G    A+ +F+ L
Sbjct: 239 AVLGACSNLGDRSQVRVIHEFIASGGLELDKKLVVANTLIHTYG-RCGSPSDARRVFDSL 297

Query: 189 AKDNNSPFGISTRSQMILANIIASDQRNKK 218
                     S R+ +  A++IA+   N++
Sbjct: 298 QH--------SARNAVSWASMIAAYTSNEQ 319


>gi|302759917|ref|XP_002963381.1| hypothetical protein SELMODRAFT_80412 [Selaginella moellendorffii]
 gi|300168649|gb|EFJ35252.1| hypothetical protein SELMODRAFT_80412 [Selaginella moellendorffii]
          Length = 860

 Score = 35.0 bits (79), Expect = 7.9,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 8/125 (6%)

Query: 68  KLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRY 127
           ++D AR  F+ I     K Y     M +A  L   G +  A E++ ++  +   P +  +
Sbjct: 484 RVDFARMVFDSI---PVKRYPSWRVMLVA--LTQNGHSHEALEMYSRIHLEGFRPGSPIF 538

Query: 128 AATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           +A L + + L D S    I  +++  S    P    +N ++ + A K G+++KA+ +F++
Sbjct: 539 SAALVSCTALEDVSRARAIHGVIK--SSDFYPDLVLSNVLMNVYA-KCGELEKARLVFDQ 595

Query: 188 LAKDN 192
           + + N
Sbjct: 596 MTEKN 600


>gi|147780613|emb|CAN69119.1| hypothetical protein VITISV_031846 [Vitis vinifera]
          Length = 654

 Score = 35.0 bits (79), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
            +L +A+  FE+I ++D   +N + N Y          + +  E+F ++  ++ AP A  
Sbjct: 54  QRLREAKFVFERIQNKDVVSWNCIINGYSQH---GPSGSSHVMELFQRMRAENTAPNAHT 110

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
           +A    AAS LVD +       +  K+    +    F    L     K G   +A+ +F+
Sbjct: 111 FAGVFTAASTLVDAAGGRLAHAVAIKMDSCRDV---FVGSSLMNMYCKAGLTPEARKVFD 167

Query: 187 ELAKDNN 193
            + + N+
Sbjct: 168 TMPERNS 174


>gi|255034845|ref|YP_003085466.1| TPR repeat-containing protein [Dyadobacter fermentans DSM 18053]
 gi|254947601|gb|ACT92301.1| TPR repeat-containing protein [Dyadobacter fermentans DSM 18053]
          Length = 1019

 Score = 35.0 bits (79), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 54/124 (43%), Gaps = 3/124 (2%)

Query: 63  LFNSNKLDDARSSFEKIL-SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           L+   K D+  +  E+IL SQ          +Y+A +   KGD  NA + + +     + 
Sbjct: 243 LYQLKKFDELLTYGERILGSQRGNTKLDDVALYVAEVYYEKGDYANAVKAYERYKR--MR 300

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P A+     L         +++E     L+ +    + + Q+A+ ILGIS LK   +  A
Sbjct: 301 PGAIPPTVALHYGHAQFRNNNFEGAITSLKPIGNGKDSVSQYASYILGISNLKTNSLTNA 360

Query: 182 KTIF 185
            T F
Sbjct: 361 LTSF 364


>gi|255321986|ref|ZP_05363136.1| TPR repeat-containing protein [Campylobacter showae RM3277]
 gi|255301090|gb|EET80357.1| TPR repeat-containing protein [Campylobacter showae RM3277]
          Length = 298

 Score = 34.7 bits (78), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 36/56 (64%), Gaps = 6/56 (10%)

Query: 43  DGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           D + +K +++  E    A +LF++ KLDDA++ +E +LS+D+K    ++N Y+  I
Sbjct: 178 DFTKQKNQDVASE----AKKLFDTGKLDDAKARYEYLLSKDHKP--AMANFYLGEI 227


>gi|302802241|ref|XP_002982876.1| hypothetical protein SELMODRAFT_117311 [Selaginella moellendorffii]
 gi|300149466|gb|EFJ16121.1| hypothetical protein SELMODRAFT_117311 [Selaginella moellendorffii]
          Length = 923

 Score = 34.7 bits (78), Expect = 8.8,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 55/120 (45%), Gaps = 8/120 (6%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           LD A   F+ IL +D  ++N +      S+LVA      A E+F ++    + P      
Sbjct: 190 LDSAWGVFDGILVRDAAVWNAM-----ISLLVAHEQGDEALELFRQMRLGGVTPNKGTCV 244

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L A     D S    I    ++L+  ++ + Q A  ++ +   KFGKV  A+ IFE +
Sbjct: 245 AALNACCHSRDFSEALRIHAFARELAGDADTVVQTA--LVNMYG-KFGKVDDAEEIFERI 301


>gi|262196389|ref|YP_003267598.1| multi-sensor hybrid histidine kinase [Haliangium ochraceum DSM
           14365]
 gi|262079736|gb|ACY15705.1| multi-sensor hybrid histidine kinase [Haliangium ochraceum DSM
           14365]
          Length = 765

 Score = 34.7 bits (78), Expect = 9.2,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 104 DTKNAAEIFLKVANDDLAPLAVRYAATLQA----ASILVDTSSYEEISKILQKLSEPSNP 159
           + K AAE+  +V +D LA ++      L      AS+L+DT   +E  +  + +    N 
Sbjct: 376 EAKEAAEVASRVKSDFLATMSHEIRTPLNGVIGMASLLLDTELSDEQREYAETIDVSGNL 435

Query: 160 MHQFANEILGISALKFGKVQKAKTIFE 186
           +    N+IL  S ++ G+++  +  FE
Sbjct: 436 LLALINDILDFSKIEAGRMELEEVAFE 462


>gi|169859304|ref|XP_001836292.1| hypothetical protein CC1G_06377 [Coprinopsis cinerea okayama7#130]
 gi|116502581|gb|EAU85476.1| hypothetical protein CC1G_06377 [Coprinopsis cinerea okayama7#130]
          Length = 382

 Score = 34.7 bits (78), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 2/88 (2%)

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+ A  L+    YE   K  +++ E  +  +  A E+LG+S L+ G++ +A+ +FE L
Sbjct: 34  ALLKKAQELIVQCDYELALKFAKRILE-QDATNVEAKEMLGVSLLETGEIDEARKVFESL 92

Query: 189 AKDN-NSPFGISTRSQMILANIIASDQR 215
              N  +P      + + LA +   D R
Sbjct: 93  IPPNPGAPAVPPPSAHLYLAQLSEEDPR 120


>gi|115460348|ref|NP_001053774.1| Os04g0602600 [Oryza sativa Japonica Group]
 gi|38344148|emb|CAE01824.2| OSJNBa0041A02.15 [Oryza sativa Japonica Group]
 gi|113565345|dbj|BAF15688.1| Os04g0602600 [Oryza sativa Japonica Group]
 gi|125549608|gb|EAY95430.1| hypothetical protein OsI_17272 [Oryza sativa Indica Group]
          Length = 804

 Score = 34.7 bits (78), Expect = 9.6,   Method: Composition-based stats.
 Identities = 30/134 (22%), Positives = 60/134 (44%), Gaps = 17/134 (12%)

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
           +   ++D  R  F+ +  ++   +N L   Y+ +     G  + A E+F+++  D   P 
Sbjct: 158 YREARVDVVRRLFDAMPKRNVVSWNTLFGWYVKT-----GRPQEALELFVRMLEDGFRPT 212

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL-----KFGKV 178
            V +     AA +  D S   ++  +L K         ++ N++  +S+      +FG V
Sbjct: 213 PVSFVNIFPAA-VADDPSWPFQLYGLLVKYGV------EYINDLFVVSSAIDMFSEFGDV 265

Query: 179 QKAKTIFEELAKDN 192
           Q A+ +F+  AK N
Sbjct: 266 QSARRVFDRAAKKN 279


>gi|5454208|gb|AAD43623.1|AC005698_22 T3P18.22 [Arabidopsis thaliana]
          Length = 425

 Score = 34.7 bits (78), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 57/133 (42%), Gaps = 12/133 (9%)

Query: 67  NKLDDARSSFEKILSQ----DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           ++LD+A+  FE ++S+    D   YN L   +     V +G      E+F +++   L  
Sbjct: 170 DRLDEAKQMFEFMVSKHCFPDVVTYNTLIKGFCKYKRVEEG-----MEVFREMSQRGLVG 224

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             V Y   +Q      D    +EI K +     P N M    N +L     K GK++KA 
Sbjct: 225 NTVTYNILIQGLFQAGDCDMAQEIFKEMVSDGVPPNIMTY--NTLLD-GLCKNGKLEKAM 281

Query: 183 TIFEELAKDNNSP 195
            +FE L +    P
Sbjct: 282 VVFEYLQRSKMEP 294


>gi|332292869|ref|YP_004431478.1| hypothetical protein Krodi_2229 [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170955|gb|AEE20210.1| hypothetical protein Krodi_2229 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 209

 Score = 34.7 bits (78), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 69/163 (42%), Gaps = 35/163 (21%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKG--DTKNAAEIF 112
           +   +A+EL+  NKLD+A + FE+I + +    N L   Y+A I + +   D +N  E  
Sbjct: 24  QGMTKAMELWEENKLDEASNLFERIATVEKD--NWLPTYYVAQIAIIRNWRDFENREEAT 81

Query: 113 LKVANDDLA-------------PLAVRYAATLQAASILVDTSSY-----EEISKILQKL- 153
           +K   D                P A    A L    +  D   Y       I ++ QK+ 
Sbjct: 82  MKATLDKAQEFINTMRTIAPDNPYADHLQAQLYTVWVAHDGMKYGMKYAGTIGELNQKMV 141

Query: 154 -SEPSNPMH--QFANEILGISALKFG--------KVQKAKTIF 185
             EP NP+   + A   +G SA  FG        ++Q+A T+F
Sbjct: 142 NKEPDNPIFIAEKAQWDMG-SARYFGSSIAPYCAELQRAITLF 183


>gi|168044807|ref|XP_001774871.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162673765|gb|EDQ60283.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 902

 Score = 34.7 bits (78), Expect = 10.0,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 54/124 (43%), Gaps = 8/124 (6%)

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           + DAR  F++++ +D   YN +   Y A  L      K A ++F ++  + L P  V Y 
Sbjct: 480 VKDARQVFDRMIQRDIVAYNAMIGGYAAHNL-----GKEALKLFDRLQEEGLKPDKVTYI 534

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
             L A +         EI  +++K    S+      N ++   A K G    A  +FE++
Sbjct: 535 NMLNACANSGSLEWAREIHTLVRKGGFFSDT--SVGNALVSTYA-KCGSFSDASIVFEKM 591

Query: 189 AKDN 192
            K N
Sbjct: 592 TKRN 595


>gi|145539410|ref|XP_001455395.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124423203|emb|CAK87998.1| unnamed protein product [Paramecium tetraurelia]
          Length = 1109

 Score = 34.7 bits (78), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 4/104 (3%)

Query: 96  ASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSE 155
           A  L  +   K A   + K  N      AV  AA L+ A  L ++  Y+E +K L KL E
Sbjct: 328 ADCLRIQNQYKEAISYYQKAIN---CEQAVGNAALLKKAITLYESQQYDECAKDLSKLIE 384

Query: 156 PSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
            ++P++  A    G+  LK     +A   FE+  K NNS   ++
Sbjct: 385 -TDPINSEAYYFKGLCKLKTKNPTEALLCFEQAIKHNNSKKAVT 427


Searching..................................................done


Results from round 2




>gi|254780421|ref|YP_003064834.1| hypothetical protein CLIBASIA_01530 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040098|gb|ACT56894.1| hypothetical protein CLIBASIA_01530 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 218

 Score =  258 bits (659), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 218/218 (100%), Positives = 218/218 (100%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA
Sbjct: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL
Sbjct: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK
Sbjct: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK
Sbjct: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218


>gi|315122135|ref|YP_004062624.1| hypothetical protein CKC_01925 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495537|gb|ADR52136.1| hypothetical protein CKC_01925 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 220

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 143/218 (65%), Positives = 173/218 (79%), Gaps = 1/218 (0%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+SN D +S K  CK+ K  YK I PLLIL++LSLA W YL  GS+ K KN  GE+F+QA
Sbjct: 1   MKSNKDTSSCKEGCKIKKYGYKLIVPLLILIVLSLASWLYLH-GSYNKPKNPAGEDFSQA 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           + L N+NKLDDAR +FEKILS DN+ Y+ ++NMYIASILV KGD K+A+E FLKV NDDL
Sbjct: 60  ISLLNNNKLDDARIAFEKILSYDNRSYDSIANMYIASILVTKGDVKSASEKFLKVGNDDL 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   VRY A L AA ILVDT SY++ISKILQKL +PSNPMH  ANEILGISA+K GK++K
Sbjct: 120 ALPVVRYTAILHAAWILVDTVSYDDISKILQKLIDPSNPMHPAANEILGISAMKCGKIEK 179

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           A++IFEE+ KD NSP GISTRSQ++LANIIAS++  KK
Sbjct: 180 ARSIFEEIVKDPNSPPGISTRSQIMLANIIASNKETKK 217


>gi|319899215|ref|YP_004159308.1| hypothetical protein BARCL_1057 [Bartonella clarridgeiae 73]
 gi|319403179|emb|CBI76738.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 223

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 51/217 (23%), Positives = 115/217 (52%), Gaps = 2/217 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    K      +  +  I  +++ +++    ++ ++      K + VG+ F ++L
Sbjct: 9   EVNEELRQEKFYAFWKRYGFLIIGAIIVFVLMI--AFYQIYHHQQMNKASNVGDKFIKSL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L +++  D+A    E +   D   Y  L+ +  AS+ + +GD   + ++F  +  ++ A
Sbjct: 67  DLADAHHFDEAIKQLESVKKSDFGGYPFLAGLREASLWMERGDAVKSVKMFDVIVANERA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A ++AA ILVD  +++++ + ++ ++   +PM   A E LG++A K  K++ A
Sbjct: 127 PQILRKVAKIRAAYILVDIGTFDDVIQRVKDMANDIDPMRMSAREALGLAAYKANKMENA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              F+++ ++    F I+ R++++L  I AS + NK+
Sbjct: 187 VYYFQKIVEEGAIGFKITDRAKIMLELIQASGKVNKE 223


>gi|319406080|emb|CBI79710.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 223

 Score =  226 bits (577), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 57/217 (26%), Positives = 118/217 (54%), Gaps = 2/217 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    K      +     I  ++I +++ +   + ++      K N VG+ F   L
Sbjct: 9   EVNEELRQEKFYTFWKRYGSFVIGAVIIFVLMIII--YQIYQQQQINKANNVGDTFITGL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L +++  D+A   F+ +   D   Y  L+++  AS+   +GDT  + ++F  +A D+ A
Sbjct: 67  DLADAHHFDEAIKKFKSVKKSDFGGYPFLADLREASLWTERGDTAKSVKMFDMIAADEKA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A ++AA ILVD  +++++ + +++++   +PM   A E+LG++A K  K++ A
Sbjct: 127 PQILRKIAKIRAAYILVDIGTFDDVMQRVKEMANDIDPMRMSAREVLGLAAYKADKMENA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              F+++ ++N   F I+ R++++L  I AS + NK+
Sbjct: 187 VYYFQKIVEENALGFKITDRAKIMLELIQASGKVNKE 223


>gi|319408189|emb|CBI81842.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 223

 Score =  225 bits (573), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 116/216 (53%), Gaps = 2/216 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    K +   G+  +  I    I+ +L++A++  ++      K + +G+ F  +L
Sbjct: 9   EVNEELRQEKVRAFWGRYSFL-IIVSAIIFVLAIAVY-QIYHYGQMNKASKIGDTFITSL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L +S + D+A +  E + + D   Y  L+ +  AS+L+ +G+   + E+F  VA D  A
Sbjct: 67  NLADSLQFDEAMNQLESVKTSDFGGYPFLARLREASLLMQQGNAVKSVEVFDAVAADKNA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  ++  A ++A+ ILVD  +++++ K +  ++   +PM   A E+LG++A K  K+  A
Sbjct: 127 PQILQRVAKIRASYILVDIGTFDDVKKRVNDMANDIDPMRMSAREVLGLAAYKANKIDDA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
              F++++++N     I  R++++L  I +  + NK
Sbjct: 187 IYYFQKISEENVLGLKIIDRAKIMLELIQSERKVNK 222


>gi|319404572|emb|CBI78178.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 223

 Score =  224 bits (571), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 56/217 (25%), Positives = 116/217 (53%), Gaps = 2/217 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    K      +  +  I  ++I ++  +   + ++      K N VG+ F  +L
Sbjct: 9   EVNEELRQEKFYNFWKRYGFLVIGAVIIFVLTIIV--YQIYQQQQINKANNVGDIFITSL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L +++  D+A    E +   +   Y  L+ +  AS+   +GD   + +IF  +A D+ A
Sbjct: 67  DLADAHHFDEAIKKLESVKQSNFGGYPFLAGLLEASLWTQRGDNAKSVKIFDMIAADEKA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A ++AA IL+D  +++++ + +++++   +PM   A E LG++A K  K++KA
Sbjct: 127 PQILREVAKIRAAYILIDIGTFDDVMQRVKEMANDIDPMRMSAREALGLAAYKANKMEKA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              F+++ ++N   F I+ R++++L  I AS + NK+
Sbjct: 187 VYYFKKIVEENALGFKITDRAKIMLELIQASGKVNKE 223


>gi|163867848|ref|YP_001609052.1| hypothetical protein Btr_0618 [Bartonella tribocorum CIP 105476]
 gi|161017499|emb|CAK01057.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 223

 Score =  224 bits (570), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 62/217 (28%), Positives = 116/217 (53%), Gaps = 2/217 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    K      +  +  I  +L L IL + I+  ++  +  KK + VG+ F ++L
Sbjct: 9   EVNAEFRQEKALAFWRRYGFSMIGAVL-LFILMITIY-QIYHHTQIKKASYVGDAFVKSL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           EL ++   D A    E +       Y  L+ +  AS+L+ +GD   + EIF  VA D+ A
Sbjct: 67  ELADTRHFDKAIKQLENVRDSHFGGYPFLARLREASLLMEQGDFIKSVEIFDSVAADEKA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A ++AA +LVD+ + +++ K ++ ++   +PM   A E LG++A K GKV +A
Sbjct: 127 PQILRKVAKIRAAYLLVDSGTLDDVKKRVKDMTSDIDPMRMSAREALGLAAYKAGKVDEA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              F++++++      I+ R++++L  + A  + NK+
Sbjct: 187 VDYFQKISEEGVLRSNITDRARIMLELMQAEGKVNKE 223


>gi|319407563|emb|CBI81213.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 223

 Score =  223 bits (568), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 55/217 (25%), Positives = 117/217 (53%), Gaps = 2/217 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    K      +  +  I  ++I ++  +   + ++      K N VG+ F  +L
Sbjct: 9   EVNEELRQEKFYNFWKRYGFLVIGAVIIFVLTIII--YQIYQQQQINKANNVGDIFMTSL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L +++  D+A    E +   +   Y  L+ +  AS+ + +GD   + ++F  +A D+ A
Sbjct: 67  DLADAHHFDEAIKKLESVKQSNFGGYPFLAGLREASLWMERGDNAKSVKMFDMIAADEKA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A ++AA ILVD  +++++ + +++++   +PM   A E LG++A K  K++KA
Sbjct: 127 PQILREVAKIRAAYILVDIGTFDDVMQRVKEIANDIDPMRMSAREALGLAAYKENKMEKA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              F+++ ++N   F I+ R++++L  I A+ + NK+
Sbjct: 187 VYYFKKIVEENALGFKITDRAKIMLELIQANGKVNKE 223


>gi|240850056|ref|YP_002971449.1| hypothetical protein Bgr_04400 [Bartonella grahamii as4aup]
 gi|240267179|gb|ACS50767.1| hypothetical protein Bgr_04400 [Bartonella grahamii as4aup]
          Length = 223

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 57/217 (26%), Positives = 113/217 (52%), Gaps = 2/217 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    K      +  +  I   ++ +++ +A  + ++     KK   +G+ F ++L
Sbjct: 9   EVNAEFRQEKALAFWRRYGFSIIGAAILFILMIVA--YQIYHHQQIKKAGYIGDAFVKSL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +  ++   D A    E + +     Y  L+ +  AS+L+ KGD   + EIF  VA D+ A
Sbjct: 67  DFADTRHFDKAIKQLETVKTSHFGGYPFLARLREASLLMEKGDIIKSVEIFDSVAADEKA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  ++  A ++AA ILVDT +  ++ K ++ ++  ++PMH  A E LG++A K  K+ +A
Sbjct: 127 PEILQKVAKIRAAYILVDTGTLADVEKRIKDMTSDTDPMHMSAREALGLAAYKADKMDEA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              F+++++       I+ R++++L  I A  + NK+
Sbjct: 187 VYYFKKISEKGALGSKITDRARIMLELIQAEGKANKE 223


>gi|86358710|ref|YP_470602.1| hypothetical protein RHE_CH03109 [Rhizobium etli CFN 42]
 gi|86282812|gb|ABC91875.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 227

 Score =  214 bits (544), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 117/214 (54%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +  S + K    +   ++I  + IL++L  A    L++   + + +  G+ F  A+
Sbjct: 11  EVNEELRSDQMKGVWRRFG-RYIIVVAILIVLGTAG-KVLYEYWDDTRSSGAGDQFLAAM 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L + NK D+A ++ EK+  + +  Y  L+ M  A++   KGD   A   F ++  D+  
Sbjct: 69  KLADENKNDEALAALEKLEKEGHGAYPVLARMRAATVQAQKGDAGAAIAAFNEIGKDNSV 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P AVR  A ++A  +L++  SYE++S ++++++ PSN     A E LG++A K G + +A
Sbjct: 129 PAAVRDVAKMRAGWLLIENGSYEQVSAVIEEMAVPSNAFRHSAREALGLAAYKAGNMAQA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           +  F+ +  D  SP  ++ R+QM+L  I AS + 
Sbjct: 189 RQWFQSIVDDAGSPRPVANRAQMMLDLITASGKA 222


>gi|239831250|ref|ZP_04679579.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239823517|gb|EEQ95085.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 268

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 57/208 (27%), Positives = 106/208 (50%), Gaps = 3/208 (1%)

Query: 9   SYKGKCKMGKCCYKWIAPLLI---LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           + + + +  K  ++   PL+I   + I+     +  +    + K +  G+ F  AL+L +
Sbjct: 52  NEEIRSERAKQVWRNFGPLVIGAAVAIVLGTAGWVGYQHWTDSKASASGDKFLAALDLAS 111

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
             K D+A ++   +       Y  L+ +  AS++  KGD   A + F  VA D+  P  +
Sbjct: 112 EGKNDEALAALADLEKTGYGSYPVLARLRAASVIADKGDAAGAVKAFDDVAADNAVPAPL 171

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           R  A L+A  +LVD+ SY++++K ++ LS   NPM   A E LG++A K  +   A  +F
Sbjct: 172 RDVARLRAGYLLVDSGSYDDVAKRVETLSADGNPMRSSAREALGLAAWKAERFDDAVKLF 231

Query: 186 EELAKDNNSPFGISTRSQMILANIIASD 213
           +++A D+ +P  I  RS  +L  + ++ 
Sbjct: 232 QQIANDSLAPANIRQRSNTMLDLMRSAG 259


>gi|121602031|ref|YP_988692.1| hypothetical protein BARBAKC583_0373 [Bartonella bacilliformis
           KC583]
 gi|120614208|gb|ABM44809.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 223

 Score =  213 bits (543), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 58/217 (26%), Positives = 113/217 (52%), Gaps = 2/217 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    K    + +  +  +    I+ IL++  +  ++      +   +G+ F ++L
Sbjct: 9   EVNEEFRQEKVYAFLKRHGFL-VIVAAIIFILAIVGY-QVYSHKKMNEARNIGDIFIKSL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L +S+  D A +  E + + +   Y  L+ +  AS+L  +GD   A E+F  VA D+ A
Sbjct: 67  SLADSHDFDQAMNQLELVKASNFAGYPFLARLREASLLSEQGDAVRAVEMFDTVAFDEKA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  ++  A +QAA ILVD  + +++ K +Q ++   +PM   A E LG++A K  K+ +A
Sbjct: 127 PQILQKVAKIQAAYILVDIGTLDDVKKRVQDIANDIDPMRISAREALGLAAYKADKMDEA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              F++++++ N    I  R++++L  I A  + NK+
Sbjct: 187 VYYFQKISEEGNLGIKIVERAKIMLELIQAEGKVNKE 223


>gi|150376650|ref|YP_001313246.1| hypothetical protein Smed_4513 [Sinorhizobium medicae WSM419]
 gi|150031197|gb|ABR63313.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
          Length = 222

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 112/214 (52%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N++  S + K    +     I  + +L++L   +    +D   E   +  G+ F  AL
Sbjct: 11  EVNDELRSDQMKAVWTRFG-SIIIGIAVLIVLGT-VGKVGYDYWQESSSSQSGDTFLVAL 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L   NK D+A ++   +  +    Y  L+ + +A++   KG+T  A + F  +  D   
Sbjct: 69  NLARENKSDEALAALTGLEKEGYGSYPVLAQLRLATLQAQKGETDAAVKAFSGIGRDTRI 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P A+R AA L+AA +L+D  +YE++S  +++L+ P N M   A E LG+SA K G   KA
Sbjct: 129 PTALRDAARLRAAYLLIDAGTYEQVSSEVEQLAVPQNAMRHSAREALGLSAYKAGDYAKA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           K+ F+++  D  SP G+  R+QM+L  I +S + 
Sbjct: 189 KSWFQQIVDDTESPRGVMNRAQMLLDVIASSGKA 222


>gi|49475206|ref|YP_033247.1| hypothetical protein BH04070 [Bartonella henselae str. Houston-1]
 gi|49238011|emb|CAF27216.1| hypothetical protein BH04070 [Bartonella henselae str. Houston-1]
          Length = 223

 Score =  211 bits (538), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 55/217 (25%), Positives = 110/217 (50%), Gaps = 2/217 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    K      +    W+    I+ +L + I+  ++     KK   +G+ F + L
Sbjct: 9   EVNAEFRQEKALAFWRRYG-LWVVFAAIIFVLMIVIY-QIYHHVQMKKAGHIGDAFIEVL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +  ++   D+A    E + + +   Y  L+ +  AS+L+ +GD   + E+F  +A D+ A
Sbjct: 67  DFADTRHFDEAMKRLEDVKASNFGGYPFLARLREASLLMEQGDAVKSVEVFDSIAADEKA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A ++AA ILVDT S +++ K ++ ++     M   A E LG++A K  K+ +A
Sbjct: 127 PPILRAVAKIRAAYILVDTGSLDDVKKRVKDMANDLGSMRMSAREALGLAAYKADKMDEA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              F +++K+      I+ R++++L  + A  + N++
Sbjct: 187 VDYFRKISKEGALGSKITERARIMLELMQAEGKANRE 223


>gi|16264870|ref|NP_437662.1| hypothetical protein SM_b20996 [Sinorhizobium meliloti 1021]
 gi|15141009|emb|CAC49522.1| HYPOTHETICAL PROTEIN SM_b20996 [Sinorhizobium meliloti 1021]
          Length = 222

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 113/214 (52%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N++  S + K    +     I  + +L++L   +    +D   E   +  G+ F  AL
Sbjct: 11  EVNDELRSDQMKAVWTRFG-GIIIGIAVLIVLGT-VGKVGYDYWQESSSSQSGDTFLAAL 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L   NK D+A ++  ++       Y  L+ + +A++   KG+T +A   F ++  D   
Sbjct: 69  NLARENKSDEALAALTELEKDGYGSYPVLAQLRVATLQAQKGETDSAVAAFSEIGRDTRI 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P A+R AA L+AA +L+D  +YE++S  +++L+ P N M   A E LG+SA K G   KA
Sbjct: 129 PAALRDAARLRAAYLLIDAGTYEQVSSEVEQLAVPQNAMRHSAREALGLSAYKAGDYAKA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           K+ F+++  D  SP GI  R+QM+L  I ++ + 
Sbjct: 189 KSWFQQIVDDAQSPRGIMNRAQMLLDVIASTGKA 222


>gi|49473956|ref|YP_031998.1| hypothetical protein BQ03100 [Bartonella quintana str. Toulouse]
 gi|49239459|emb|CAF25810.1| hypothetical protein BQ03100 [Bartonella quintana str. Toulouse]
          Length = 223

 Score =  208 bits (529), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 55/217 (25%), Positives = 110/217 (50%), Gaps = 2/217 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    K      +  +  +    I+ +L +AI   ++     KK   +G+ F + L
Sbjct: 9   EVNAEFRQEKALAFWRRYGFS-VIVAAIIFVLIIAI-HQIYHYEQMKKAGHIGDAFMKVL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +  ++   D+A    + + + +   Y  L+ M+ AS+L+ +GD   + E F  VA D+ A
Sbjct: 67  DFADTRHFDEAMKQLKNVKASNFGGYPFLARMHEASLLMEQGDAVKSVEAFDSVAADEKA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A ++AA ILVDT + +++ K ++ +    +PM   A E LG++A K  K+ +A
Sbjct: 127 PPILRKVAKIRAAYILVDTGTLDDVKKRVKDMENDIDPMRMSAREALGLAAYKADKMDEA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              F +++K+       + R++++L  + A  + +K+
Sbjct: 187 VDYFRKISKEGVLGSKATERARIMLELMQAEGKADKE 223


>gi|190892853|ref|YP_001979395.1| hypothetical protein RHECIAT_CH0003269 [Rhizobium etli CIAT 652]
 gi|190698132|gb|ACE92217.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
 gi|327189206|gb|EGE56386.1| hypothetical protein RHECNPAF_700018 [Rhizobium etli CNPAF512]
          Length = 227

 Score =  207 bits (528), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 62/214 (28%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +  S + K    +   ++I    IL+++  A    L+D   + + +  G+ F  A+
Sbjct: 11  EVNEELRSDQMKGAWRRFG-RYIIVAAILIVVGTAG-KVLYDYWDDSRSSGAGDQFLAAM 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L + NK D+A ++ +K+  + +  Y  L+ M  A++   KGD   A   F ++  D+  
Sbjct: 69  KLADENKNDEALAALDKLEKEGHGAYPVLARMRAATVQAQKGDAAAAIAAFNEIGKDNGV 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P AVR AA ++A  +L++  SYE++S  +++++ P N     A E LG++A K G + +A
Sbjct: 129 PAAVRDAARMRAGWLLIENGSYEQVSAAIEEMAVPGNAFRHSAREALGLAAYKAGNMAQA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           +  F+ +  D  SP  ++ R+QM+L  I AS + 
Sbjct: 189 RQWFQSIIDDAESPRPVANRAQMMLDLITASGKA 222


>gi|159185150|ref|NP_355258.2| hypothetical protein Atu2301 [Agrobacterium tumefaciens str. C58]
 gi|159140421|gb|AAK88043.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 223

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 60/215 (27%), Positives = 106/215 (49%), Gaps = 2/215 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N    S +     G+     +   +++++ +      +++  +  + +  G+ F  AL
Sbjct: 11  EVNEQIRSEQLSRFWGRYGIVVVGAAILVVVGAAGAG--IYEYWNTSRASNSGDQFLAAL 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L + NK DDA  +F  + +  +  Y  L+    A++L  KGD   A   F  + ND  A
Sbjct: 69  KLASENKTDDALKAFADLETTGHGNYPVLAKFRSATLLSQKGDAAGAIAAFTAIGNDTSA 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A ++AA +LVD  +Y+++  + + LS     M   A E LG++A K G   KA
Sbjct: 129 PQVFRDTARVRAAWLLVDNGTYDQVVALAEPLSTDGQTMRASAREALGLAAYKAGDFAKA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           K  FE++  D  +P  ++ R+Q++L NI AS +  
Sbjct: 189 KQWFEQIMSDTQAPRNVTNRAQIMLDNITASGKAA 223


>gi|307307990|ref|ZP_07587708.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti BL225C]
 gi|306901394|gb|EFN31998.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti BL225C]
          Length = 222

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 112/214 (52%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N++  S + K    +     I  + +L++L   +    +D   E   +  G+ F  AL
Sbjct: 11  EVNDELRSDQMKAVWTRFG-GIIIGIAVLIVLGT-VGKVGYDYWQEASSSQSGDTFLAAL 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L   NK D+A ++  ++       Y  L+ + +A++   KG+T +A   F  +  D   
Sbjct: 69  NLARENKSDEALAALTELEKDGYGSYPVLAQLRVATLQAQKGETDSAVAAFSGIGRDTRI 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P A+R AA L+AA +L+D  +YE++S  +++L+ P N M   A E LG+SA K G   KA
Sbjct: 129 PAALRDAARLRAAYLLIDAGTYEQVSSEVEQLAVPQNAMRHSAREALGLSAYKAGDYAKA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           K+ F+++  D  SP GI  R+QM+L  I ++ + 
Sbjct: 189 KSWFQQIVDDAQSPRGIMNRAQMLLDVIASTGKA 222


>gi|222149420|ref|YP_002550377.1| hypothetical protein Avi_3303 [Agrobacterium vitis S4]
 gi|221736403|gb|ACM37366.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 223

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 56/215 (26%), Positives = 115/215 (53%), Gaps = 2/215 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N++  S + +    +    +I  + +L+++  A +  L+D   + + +  G+ F  A 
Sbjct: 11  EVNDELRSEQMRRFWRRLGPVFIG-IAVLIVVGTAGY-RLYDYYTDDRASKSGDRFLAAT 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L    K D A S  + +       Y  L+ +  AS++  KGD K A + F  +  D+  
Sbjct: 69  KLATDGKNDQALSDLQALEKDGFGAYPVLAKLRAASLMAEKGDAKAAIDAFTAIGKDNSV 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A ++AA +L+D  +YE++S  ++ L+ P   +   A E LG++A K G+ ++A
Sbjct: 129 PQVIRDVAHIRAAWLLIDNGTYEQVSTEVEALAVPGQGLRHSAREALGLAAYKAGQTERA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           +  F+++ +D+ +P  ++ R+Q++L NI A+ + +
Sbjct: 189 REWFQQITEDSEAPRNVANRAQIMLDNIAAAGKAS 223


>gi|218516155|ref|ZP_03512995.1| hypothetical protein Retl8_22038 [Rhizobium etli 8C-3]
          Length = 227

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 61/214 (28%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +  S + K    +   ++I    IL+++  A    L++   + + +  G+ F  A+
Sbjct: 11  EVNEELRSDQMKGAWRRFG-RYIIVAAILIVVGTAG-KVLYEYWDDSRSSGAGDQFLAAM 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L + NK D+A ++ +K+  + +  Y  L+ M  A++   KGD   A   F ++  D+  
Sbjct: 69  KLADENKNDEALAALDKLEKEGHGAYPVLARMRAATVQAQKGDAAAAIAAFNEIGKDNGV 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P AVR AA ++A  +L++  SYE++S  +++++ P N     A E LG++A K G + +A
Sbjct: 129 PAAVRDAARMRAGWLLIENGSYEQVSAAIEEMAVPGNAFRHSAREALGLAAYKAGNMAQA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           +  F+ +  D  SP  ++ R+QM+L  I AS + 
Sbjct: 189 RQWFQSIIDDAESPRPVANRAQMMLDLITASGEA 222


>gi|153007832|ref|YP_001369047.1| hypothetical protein Oant_0487 [Ochrobactrum anthropi ATCC 49188]
 gi|151559720|gb|ABS13218.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 227

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 57/208 (27%), Positives = 108/208 (51%), Gaps = 3/208 (1%)

Query: 9   SYKGKCKMGKCCYKWIAPLLI---LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           + + + +  K  ++   PLLI   + I+     +  +    + K +  G+ F  AL+L +
Sbjct: 11  NEEIRSERAKQIWRNFGPLLIGGAVAIVLGTAGWVGYQHWVDSKASASGDKFLAALDLAS 70

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
             K D+A ++ + +       Y  L+ +  AS++  KGD   A + F +VA D+  P  +
Sbjct: 71  EGKNDEALTALDDLEKTGYGSYPVLARLRAASVIADKGDAAGAVKAFDEVAADNAVPAPL 130

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           R  A L+A  +LVD+ SY++++K ++ LS   NPM   A E LG++A K  +   A  +F
Sbjct: 131 RDVARLRAGYLLVDSGSYDDVAKHVETLSADGNPMRSSAREALGLAAWKAERFDDAVKLF 190

Query: 186 EELAKDNNSPFGISTRSQMILANIIASD 213
           +++A D+ +P  I  R+  +L  + ++ 
Sbjct: 191 QQIANDSLAPANIRQRANTMLDLMRSAG 218


>gi|307319942|ref|ZP_07599365.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti AK83]
 gi|306894482|gb|EFN25245.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti AK83]
          Length = 222

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 111/214 (51%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N++  S + K    +     I  + +L++L   +    +D   E   +  G+ F  AL
Sbjct: 11  EVNDELRSDQMKAVWTRFG-GIIIGIAVLIVLGT-VGKVGYDYWQEASSSQSGDTFLAAL 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L   NK D+A ++  ++       Y  L+ + +A++   KG+T  A   F  +  D   
Sbjct: 69  NLARENKSDEALAALTELEKDGYGSYPVLAQLRVATLQAQKGETDAAVAAFSGIGRDTRI 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P A+R AA L+AA +L+D  +YE++S  +++L+ P N M   A E LG+SA K G   KA
Sbjct: 129 PAALRDAARLRAAYLLIDAGTYEQVSSEVEQLAVPQNAMRHSAREALGLSAYKAGDYAKA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           K+ F+++  D  SP GI  R+QM+L  I ++ + 
Sbjct: 189 KSWFQQIVDDAQSPRGIMNRAQMLLDVIASTGKA 222


>gi|116253296|ref|YP_769134.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257944|emb|CAK09042.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 227

 Score =  202 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 60/214 (28%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +  S + K    +  +     ++ ++I+       L+D   + + +  G+ F  A+
Sbjct: 11  EVNEELRSDQMKGVWRR--FGRYIVVVAILIVVGTAGKVLYDYWDDNRSSGTGDQFLAAM 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L + NK D+A ++ +K+  + +  Y  L+ M  A++ V KGDT  A   F ++  D+  
Sbjct: 69  KLADENKNDEALAALDKLEKEGHGAYPVLARMRAATVQVQKGDTVAAIAAFNEIGKDNAV 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P AVR AA ++A  +L++  +YEE+S  +++++ P N     A E LG++A K G + +A
Sbjct: 129 PAAVRDAAKMRAGWLLIENGTYEEVSAAIEEMAVPGNAFRHSAREALGLAAYKAGNMAQA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           +  F+ +  D +SP  ++ R+ M+L  I AS + 
Sbjct: 189 RQWFQSIVDDTDSPRNVANRAHMMLDLITASGKA 222


>gi|241205815|ref|YP_002976911.1| hypothetical protein Rleg_3116 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859705|gb|ACS57372.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 227

 Score =  202 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 59/214 (27%), Positives = 114/214 (53%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +  S + K    +  +     ++ ++I+       L+D   + + +  G+ F  A+
Sbjct: 11  EVNEELRSDQMKGVWRR--FGRYIIVVAILIVVGTAGKVLYDYWDDNRSSGTGDQFLAAM 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L + NK D+A ++  K+  + +  Y  L+ M  A++ V KGDT  A   F ++  D+  
Sbjct: 69  KLADENKNDEALAALNKLEKEGHGAYPVLARMRAATVQVQKGDTAAAITAFNEIGKDNAV 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P AVR AA ++A  +L++  +YE++S  +++++ P N     A E LG++A K G + +A
Sbjct: 129 PAAVRDAAKMRAGWLLIENGTYEQVSAAIEEMAVPGNAFRHSAREALGLAAYKAGNMAQA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           +  F+ +  D +SP  ++ R+ M+L  I AS + 
Sbjct: 189 RQWFQSIVDDTDSPRNVANRAHMMLDLITASGKA 222


>gi|209550426|ref|YP_002282343.1| hypothetical protein Rleg2_2847 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536182|gb|ACI56117.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 227

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 56/214 (26%), Positives = 113/214 (52%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +  S + K    +  +     ++ ++I+       L++   + + +  G+ F  A+
Sbjct: 11  EVNEELRSDQMKGVWRR--FGRYIIVVAILIVVGTAGKVLYEYWDDTRSSGAGDQFLAAM 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L + NK D+A ++ +K+  + +  Y  L+ M  A++   KGD   A   F ++  D+  
Sbjct: 69  KLADENKNDEALAALDKLEKEGHGAYPVLARMRAATVQAQKGDAAAAIAAFNEIGKDNGV 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P AVR AA ++A  +L++  SYE++S  +++++ P N     A E LG+++ K G + +A
Sbjct: 129 PAAVRDAAKMRAGWLLIENGSYEQVSAAIEEMAVPGNAFRHSAREALGLASYKAGNMAQA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           +  F+ +  D +SP  ++ R+ M+L  I AS + 
Sbjct: 189 RQWFQSIVDDTDSPRNVTNRAHMMLDLITASGKA 222


>gi|222086679|ref|YP_002545213.1| hypothetical protein Arad_3292 [Agrobacterium radiobacter K84]
 gi|221724127|gb|ACM27283.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 227

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 60/214 (28%), Positives = 107/214 (50%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +  S + +    +   + I    +L+++  A +   +     ++    G+ F  AL
Sbjct: 11  EVNEELRSDQLRFVWRRFG-RVIIGAAVLIVVGTAAYS-GYRYWSGQQAGNSGDQFISAL 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L + NK D+A ++   I    +  Y  L+ +  A++   KGDT  A   F  +  +   
Sbjct: 69  TLADQNKTDEALAALAAIEKDGSGSYPLLARLRAATLQAQKGDTAGAVAAFSAIGKETGL 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R AA L+AA +LVDT +Y++++   Q+L+ P+N     A ++LG++A K G   KA
Sbjct: 129 PTVIRDAARLRAAYLLVDTGTYDQVAAEAQELAVPANTFRHSARDVLGLAAYKAGDFAKA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           +  F+ +  D  SP  +  R+QM+L  I AS + 
Sbjct: 189 RQWFQAIVDDPQSPRNVGNRAQMLLDLITASGKA 222


>gi|227822914|ref|YP_002826886.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
 gi|227341915|gb|ACP26133.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
          Length = 222

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 113/214 (52%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +  S + K    +     I    ++++    +    +D   E   +  G+ F  AL
Sbjct: 11  EVNEELRSDQMKAIWTRFGGVIIGVAALIVL--GTVGKVGYDYWQESSSSQSGDAFLVAL 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L   N+ ++A  +  K+  +    Y  L+ +  A++   KG+T+ A   F ++  D+  
Sbjct: 69  DLAKENRSEEALGALTKLEQEGYGSYPVLARLRAATLKAQKGETEAAFAAFSEIGKDNRI 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P A+R AA L+AA +L+DT +Y+++S  +++L+ P N M   A E LG++A K G   KA
Sbjct: 129 PAALRDAARLRAAYLLIDTGTYDQVSAEVEQLAVPQNAMRHSAREALGLAAFKAGDYAKA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           K  F+++A D  SP G++ R+QM+L  I AS + 
Sbjct: 189 KGWFQQIADDTESPRGVANRAQMLLDVIAASGKA 222


>gi|319784771|ref|YP_004144247.1| hypothetical protein Mesci_5097 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170659|gb|ADV14197.1| Protein of unknown function DUF2133 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 221

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 61/215 (28%), Positives = 110/215 (51%), Gaps = 2/215 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N++    + +    +     +  + IL++L  A +   +    E + N  G+ F+QAL
Sbjct: 9   EVNDEIRREQAQALWDRFG-PALIVVAILVVLGTAAFV-GYRYWDETRANRSGDAFSQAL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L N  K D+A ++ +++       Y  L+ M  A++   KGD   A + F +VA D   
Sbjct: 67  KLANDGKNDEALTALDQLEKDGYGAYPLLARMRGATVKANKGDVPAAVKDFDEVAADTAI 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P ++R  A L+AA +LVD  S+ ++S  ++ L+  +N +   A E LG+SA K GK Q A
Sbjct: 127 PQSIRDMARLRAALLLVDHGSFADVSSRVEALTSDTNTLRHTAREALGLSAWKEGKTQDA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
             +F+++A D+ +P     R+ ++   I  S   +
Sbjct: 187 LKLFDQIAADDGAPRNTRERATLMSELIRGSGSAS 221


>gi|325293657|ref|YP_004279521.1| hypothetical protein AGROH133_07947 [Agrobacterium sp. H13-3]
 gi|325061510|gb|ADY65201.1| hypothetical protein AGROH133_07947 [Agrobacterium sp. H13-3]
          Length = 223

 Score =  197 bits (502), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 61/214 (28%), Positives = 106/214 (49%), Gaps = 2/214 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N    S +     G+  Y  +     ++++  A    +++  +  + +  G+ F  AL
Sbjct: 11  EVNEQIRSEQLSRFWGR--YGIVVVGAAVLVVVGAAGAGIYEYWNTSRASNSGDQFIAAL 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L + NK D+A  +F  + +  +  Y  L+    A++L  KGD   A   F  + ND  A
Sbjct: 69  KLASDNKTDEALKAFADLETSGHGNYPVLAKFRSATLLSQKGDAAGAIAAFTAIGNDTSA 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A ++AA +LVD  +Y+++  + + LS     M   A E LG++A K G   KA
Sbjct: 129 PQVFRDTAKVRAAWLLVDNGTYDQVVALAEPLSGEGQTMRASAREALGLAAYKAGDFTKA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           K  FE++  D  +P  ++ R+Q++L NI AS + 
Sbjct: 189 KQWFEQIVSDAQAPRNVTNRAQIMLDNITASGKA 222


>gi|260460375|ref|ZP_05808627.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259034020|gb|EEW35279.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 221

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 60/215 (27%), Positives = 109/215 (50%), Gaps = 2/215 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N++    + +    +     +    IL++L  A +   +    E + N  G+ F+QAL
Sbjct: 9   EVNDEMRRDQAQKLWDRFG-PALLVAAILVVLGTAAFV-GYRYWDETRANRSGDAFSQAL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L N  K D+A ++ +++       Y  L+ M  A++  +KGD   A + F +VA D   
Sbjct: 67  KLANDGKNDEALAALDQLEKDGYGAYPLLARMRAATVKASKGDVDAAVKDFDEVAADTAI 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A L+AA +LVD  S+ ++S  ++ L+  +N +   A E LG++A K GK Q A
Sbjct: 127 PQGIRDMARLRAALLLVDHGSFADVSSRVEALTSDTNTLRHTAREALGLAAWKEGKTQDA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
             +F+++A D+ +P     R+ ++   I  S   +
Sbjct: 187 LKLFDQIASDDGAPRNTRERATLMSELIRGSGNAS 221


>gi|23501278|ref|NP_697405.1| hypothetical protein BR0374 [Brucella suis 1330]
 gi|23347165|gb|AAN29320.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 223

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 58/216 (26%), Positives = 107/216 (49%), Gaps = 2/216 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +  S + K          I  + + ++L  A W   +    + K +  G+ F  AL
Sbjct: 9   EVNEELRSERAKQVWRNFGPALIG-VAVAVVLGTAGWV-GYQHWTDSKASASGDKFLAAL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L  + K D+A ++F  +       Y  L+ + +AS+L  KGD   A + F +++ D+  
Sbjct: 67  DLAAAGKTDEALAAFTDLEKTGYGSYPVLARLRVASVLADKGDAAAAVKAFDEISADNSV 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A
Sbjct: 127 PEPLRNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
             +F+ +A+D  +P     R+ ++L  + ++    +
Sbjct: 187 AKLFKLVAEDGLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|13476157|ref|NP_107727.1| hypothetical protein mlr7403 [Mesorhizobium loti MAFF303099]
 gi|14026917|dbj|BAB53513.1| mlr7403 [Mesorhizobium loti MAFF303099]
          Length = 221

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 62/215 (28%), Positives = 110/215 (51%), Gaps = 2/215 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N++    + +    +     +  + IL++L  A +   +    E + N  G+ F+QAL
Sbjct: 9   EVNDEMRREQAQKLWDRFGPALLG-IAILVVLGTAAFV-GYRYWDETRANRSGDAFSQAL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L N  K DDA ++ +++       Y  L+ M  A++  +KGDT  A + F  VA D   
Sbjct: 67  KLANDGKNDDALAALDQLEKDGYGAYPLLARMRAATVKASKGDTAAAVKDFDDVAADTAI 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A L+AA +LVD  S+ ++S  ++ L+  +N +   A E LG++A K GK Q A
Sbjct: 127 PQGIRDMARLRAALLLVDHGSFADVSSRVEALTSDTNTLRHTAREALGLAAWKEGKTQDA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
             +F+++A D+ +P     R+ ++   I  S   +
Sbjct: 187 LKLFDQIAADDGAPRNTRERATLMSELIRGSGNAS 221


>gi|306842333|ref|ZP_07474992.1| Hypothetical protein BIBO2_2108 [Brucella sp. BO2]
 gi|306845010|ref|ZP_07477591.1| Hypothetical protein BIBO1_1695 [Brucella sp. BO1]
 gi|306274642|gb|EFM56431.1| Hypothetical protein BIBO1_1695 [Brucella sp. BO1]
 gi|306287549|gb|EFM59008.1| Hypothetical protein BIBO2_2108 [Brucella sp. BO2]
          Length = 223

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 54/212 (25%), Positives = 107/212 (50%), Gaps = 3/212 (1%)

Query: 9   SYKGKCKMGKCCYKWIAPLLI---LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           + + + +  K  ++   P LI   + ++     +  +    + K +  G+ F  AL+L  
Sbjct: 11  NEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLAA 70

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  +
Sbjct: 71  AGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPL 130

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +F
Sbjct: 131 RNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAVKLF 190

Query: 186 EELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           + +A+D+ +P     R+ ++L  + ++    +
Sbjct: 191 KLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|161618353|ref|YP_001592240.1| hypothetical protein BCAN_A0382 [Brucella canis ATCC 23365]
 gi|254703734|ref|ZP_05165562.1| hypothetical protein Bsuib36_07392 [Brucella suis bv. 3 str. 686]
 gi|260567012|ref|ZP_05837482.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261754379|ref|ZP_05998088.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|161335164|gb|ABX61469.1| Hypothetical protein BCAN_A0382 [Brucella canis ATCC 23365]
 gi|260156530|gb|EEW91610.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261744132|gb|EEY32058.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 223

 Score =  190 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 54/212 (25%), Positives = 108/212 (50%), Gaps = 3/212 (1%)

Query: 9   SYKGKCKMGKCCYKWIAPLLI---LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           + + + +  K  ++   P LI   + ++     +  +    + K +  G+ F  AL+L  
Sbjct: 11  NEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLAA 70

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + K D+A ++F  +       Y  L+ + +AS+L  KGD   A + F +++ D+  P  +
Sbjct: 71  AGKTDEALAAFTDLEKTGYGSYPVLARLRVASVLADKGDAAAAVKAFDEISADNSVPEPL 130

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +F
Sbjct: 131 RNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKLF 190

Query: 186 EELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           + +A+D+ +P     R+ ++L  + ++    +
Sbjct: 191 KLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|163842661|ref|YP_001627065.1| hypothetical protein BSUIS_A0405 [Brucella suis ATCC 23445]
 gi|163673384|gb|ABY37495.1| Hypothetical protein BSUIS_A0405 [Brucella suis ATCC 23445]
          Length = 223

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 54/212 (25%), Positives = 107/212 (50%), Gaps = 3/212 (1%)

Query: 9   SYKGKCKMGKCCYKWIAPLLI---LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           + + + +  K  ++   P LI   + ++     +  +    + K +  G+ F  AL+L  
Sbjct: 11  NEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLAA 70

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  +
Sbjct: 71  AGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPL 130

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +F
Sbjct: 131 RNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKGERFDDAAKLF 190

Query: 186 EELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           + +A+D+ +P     R+ ++L  + ++    +
Sbjct: 191 KLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|225626892|ref|ZP_03784931.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|254701189|ref|ZP_05163017.1| hypothetical protein Bsuib55_10067 [Brucella suis bv. 5 str. 513]
 gi|254709530|ref|ZP_05171341.1| hypothetical protein BpinB_04507 [Brucella pinnipedialis B2/94]
 gi|254713053|ref|ZP_05174864.1| hypothetical protein BcetM6_06734 [Brucella ceti M644/93/1]
 gi|254716594|ref|ZP_05178405.1| hypothetical protein BcetM_09268 [Brucella ceti M13/05/1]
 gi|254718561|ref|ZP_05180372.1| hypothetical protein Bru83_03299 [Brucella sp. 83/13]
 gi|256031024|ref|ZP_05444638.1| hypothetical protein BpinM2_10279 [Brucella pinnipedialis
           M292/94/1]
 gi|256060516|ref|ZP_05450685.1| hypothetical protein Bneo5_09218 [Brucella neotomae 5K33]
 gi|256368831|ref|YP_003106337.1| hypothetical protein BMI_I379 [Brucella microti CCM 4915]
 gi|260168156|ref|ZP_05754967.1| hypothetical protein BruF5_07294 [Brucella sp. F5/99]
 gi|261218393|ref|ZP_05932674.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261317056|ref|ZP_05956253.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261320758|ref|ZP_05959955.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261324510|ref|ZP_05963707.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261751726|ref|ZP_05995435.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261757614|ref|ZP_06001323.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265983536|ref|ZP_06096271.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265988094|ref|ZP_06100651.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|294851759|ref|ZP_06792432.1| hypothetical protein BAZG_00674 [Brucella sp. NVSL 07-0026]
 gi|306837297|ref|ZP_07470180.1| Hypothetical protein BROD_0083 [Brucella sp. NF 2653]
 gi|225618549|gb|EEH15592.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|255998989|gb|ACU47388.1| hypothetical protein BMI_I379 [Brucella microti CCM 4915]
 gi|260923482|gb|EEX90050.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293448|gb|EEX96944.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296279|gb|EEX99775.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261300490|gb|EEY03987.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261737598|gb|EEY25594.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261741479|gb|EEY29405.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|264660291|gb|EEZ30552.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264662128|gb|EEZ32389.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294820348|gb|EFG37347.1| hypothetical protein BAZG_00674 [Brucella sp. NVSL 07-0026]
 gi|306407610|gb|EFM63806.1| Hypothetical protein BROD_0083 [Brucella sp. NF 2653]
          Length = 223

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 54/212 (25%), Positives = 107/212 (50%), Gaps = 3/212 (1%)

Query: 9   SYKGKCKMGKCCYKWIAPLLI---LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           + + + +  K  ++   P LI   + ++     +  +    + K +  G+ F  AL+L  
Sbjct: 11  NEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLAA 70

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  +
Sbjct: 71  AGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPL 130

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +F
Sbjct: 131 RNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKLF 190

Query: 186 EELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           + +A+D+ +P     R+ ++L  + ++    +
Sbjct: 191 KLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|62289365|ref|YP_221158.1| hypothetical protein BruAb1_0400 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699290|ref|YP_413864.1| hypothetical protein BAB1_0404 [Brucella melitensis biovar Abortus
           2308]
 gi|189023619|ref|YP_001934387.1| hypothetical protein BAbS19_I03740 [Brucella abortus S19]
 gi|237814854|ref|ZP_04593852.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254688682|ref|ZP_05151936.1| hypothetical protein Babob68_00559 [Brucella abortus bv. 6 str.
           870]
 gi|254693166|ref|ZP_05154994.1| hypothetical protein Babob3T_00550 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696809|ref|ZP_05158637.1| hypothetical protein Babob28_03613 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254707886|ref|ZP_05169714.1| hypothetical protein BpinM_13191 [Brucella pinnipedialis
           M163/99/10]
 gi|254729716|ref|ZP_05188294.1| hypothetical protein Babob42_00560 [Brucella abortus bv. 4 str.
           292]
 gi|256256929|ref|ZP_05462465.1| hypothetical protein Babob9C_06139 [Brucella abortus bv. 9 str.
           C68]
 gi|260545881|ref|ZP_05821622.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260754158|ref|ZP_05866506.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260757378|ref|ZP_05869726.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761202|ref|ZP_05873545.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883183|ref|ZP_05894797.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261213404|ref|ZP_05927685.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261315377|ref|ZP_05954574.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|297247780|ref|ZP_06931498.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
 gi|62195497|gb|AAX73797.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615391|emb|CAJ10360.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|189019191|gb|ACD71913.1| hypothetical protein BAbS19_I03740 [Brucella abortus S19]
 gi|237789691|gb|EEP63901.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260097288|gb|EEW81163.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260667696|gb|EEX54636.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671634|gb|EEX58455.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674266|gb|EEX61087.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260872711|gb|EEX79780.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915011|gb|EEX81872.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261304403|gb|EEY07900.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|297174949|gb|EFH34296.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
          Length = 223

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 53/212 (25%), Positives = 107/212 (50%), Gaps = 3/212 (1%)

Query: 9   SYKGKCKMGKCCYKWIAPLLI---LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           + + + +  K  ++   P LI   + ++     +  +    + K +  G+ F  AL+L  
Sbjct: 11  NEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLAA 70

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  +
Sbjct: 71  AGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPL 130

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           R  A L+A  +LVD  SY+++++ ++ LS   NPM   A E LG++A K  +   A  +F
Sbjct: 131 RNIARLRAGYLLVDNGSYDDVAERVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKLF 190

Query: 186 EELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           + +A+D+ +P     R+ ++L  + ++    +
Sbjct: 191 KLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|148559135|ref|YP_001258405.1| hypothetical protein BOV_0389 [Brucella ovis ATCC 25840]
 gi|148370392|gb|ABQ60371.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 223

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 57/216 (26%), Positives = 107/216 (49%), Gaps = 2/216 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +  S + K    +     +    + ++L  A W   +    + K +  G+ F  AL
Sbjct: 9   EVNEELRSERAKQVW-RNSGPALIGAAVAVVLGTAGWV-GYQHWTDSKASASGDKFLAAL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L  + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  
Sbjct: 67  DLAAAGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSV 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A
Sbjct: 127 PEPLRNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
             +F+ +A+D+ +P     R+ ++L  + ++    +
Sbjct: 187 AKLFKLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|256159078|ref|ZP_05456907.1| hypothetical protein BcetM4_09251 [Brucella ceti M490/95/1]
 gi|256254427|ref|ZP_05459963.1| hypothetical protein BcetB_09088 [Brucella ceti B1/94]
 gi|261221595|ref|ZP_05935876.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265997558|ref|ZP_06110115.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260920179|gb|EEX86832.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262552026|gb|EEZ08016.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 223

 Score =  187 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 54/212 (25%), Positives = 107/212 (50%), Gaps = 3/212 (1%)

Query: 9   SYKGKCKMGKCCYKWIAPLLI---LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           + + + +  K  ++   P LI   + ++     +  +    + K +  G+ F  AL+L  
Sbjct: 11  NEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWAGYQHWTDSKASASGDKFLAALDLAA 70

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  +
Sbjct: 71  AGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPL 130

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +F
Sbjct: 131 RNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKLF 190

Query: 186 EELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           + +A+D+ +P     R+ ++L  + ++    +
Sbjct: 191 KLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|218661714|ref|ZP_03517644.1| hypothetical protein RetlI_20621 [Rhizobium etli IE4771]
          Length = 213

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 51/196 (26%), Positives = 99/196 (50%), Gaps = 2/196 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +  S + K    +   ++I    +L+++  A    LF+   + + +  G+ F  A+
Sbjct: 11  EVNEELRSDQMKGVWRRFG-RYIIVAAVLIVVGTAG-KVLFEYWDDTRSSGAGDQFLAAM 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L + NK D+A ++  K+  + +  Y  L+ M  A++   KGD   A   F ++  D+  
Sbjct: 69  KLADENKNDEALAALGKLEKEGHGAYPVLARMRAATVQAQKGDANAAITAFNEIGKDNSV 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P AVR AA ++A  +L++  SYE++S  +++++ P N     A E LG+++ K G + +A
Sbjct: 129 PAAVRDAARMRAGWLLIENGSYEQVSAAVEEMAVPGNAFRHSAREALGLASYKAGNMAQA 188

Query: 182 KTIFEELAKDNNSPFG 197
           +  F    +    P  
Sbjct: 189 RQWFPVDCRRRRKPAS 204


>gi|17987834|ref|NP_540468.1| hypothetical protein BMEI1551 [Brucella melitensis bv. 1 str. 16M]
 gi|225851917|ref|YP_002732150.1| hypothetical protein BMEA_A0411 [Brucella melitensis ATCC 23457]
 gi|256044099|ref|ZP_05447010.1| hypothetical protein Bmelb1R_06372 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112897|ref|ZP_05453813.1| hypothetical protein Bmelb3E_09470 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256264571|ref|ZP_05467103.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260563457|ref|ZP_05833943.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265990511|ref|ZP_06103068.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994339|ref|ZP_06106896.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17983562|gb|AAL52732.1| hypothetical membrane associated protein [Brucella melitensis bv. 1
           str. 16M]
 gi|225640282|gb|ACO00196.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|260153473|gb|EEW88565.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|262765452|gb|EEZ11241.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001295|gb|EEZ13870.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094936|gb|EEZ18644.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408415|gb|ADZ65480.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538129|gb|ADZ86344.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 223

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 53/212 (25%), Positives = 106/212 (50%), Gaps = 3/212 (1%)

Query: 9   SYKGKCKMGKCCYKWIAPLLI---LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           + + + +  K  ++   P LI   + ++     +  +    + K +  G+ F  AL+L  
Sbjct: 11  NEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLAA 70

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P   
Sbjct: 71  AGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEPS 130

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           R  A L+A  +LVD  SY+++++ ++ LS   NPM   A E LG++A K  +   A  +F
Sbjct: 131 RNIARLRAGYLLVDNGSYDDVAERVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKLF 190

Query: 186 EELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           + +A+D+ +P     R+ ++L  + ++    +
Sbjct: 191 KLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|118588126|ref|ZP_01545536.1| hypothetical protein SIAM614_11133 [Stappia aggregata IAM 12614]
 gi|118439748|gb|EAV46379.1| hypothetical protein SIAM614_11133 [Stappia aggregata IAM 12614]
          Length = 227

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 50/215 (23%), Positives = 100/215 (46%), Gaps = 3/215 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    K +    +    W+  + +L+++    +        E++    G+ F +A+
Sbjct: 7   EVDEDIRQEKYRRLWDRFG-PWVLGVAVLIVVGTGGYRGWL-YWQEQQSQSAGDTFFEAV 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L  +   ++A + + ++       Y  L+ +  A+ L   G T+ A   F  ++ D   
Sbjct: 65  KLSEAQNYEEAAALYGEL-DNALGGYPALAKLRQATDLSNSGKTEEALAEFDALSRDSSI 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A+R  A L+AA + VDT SY +I+  ++KL+  + P    A E+L +SA K G ++ A
Sbjct: 124 MEALRDVAALRAAYLAVDTQSYGDIADRIEKLTGDTGPFRAAARELLALSAWKAGDIETA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           K     + +D  +P  +S R  ++   I +S+   
Sbjct: 184 KQWISAIEEDTETPADVSRRVSILGDVIRSSNGEA 218


>gi|110633048|ref|YP_673256.1| hypothetical protein Meso_0691 [Mesorhizobium sp. BNC1]
 gi|110284032|gb|ABG62091.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 223

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 63/211 (29%), Positives = 103/211 (48%), Gaps = 2/211 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    + +    +     I  L  L++L +A W   +D     + N  G+ FAQAL
Sbjct: 9   EVNEELRQDQMRVLWRRYGPIAIG-LAALLVLGMAAWV-AYDHWWTSRANESGDRFAQAL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           EL       +A    E++ +     Y  L+ +  A+ L    D   A   F +VAND   
Sbjct: 67  ELAEEGNSQEALQLLEELENSGAGAYPVLARLRAATTLADSDDIDGAITKFDEVANDAAV 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P A+R  A L+AA +LVD  SY +++  ++ LS  +NPM   A E + ++A K G  + A
Sbjct: 127 PAAIRDVARLRAALLLVDHGSYADVAARVETLSADTNPMRHIARETMALAAWKEGNRENA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
            ++F E+A D  +P G   R++M++  I  +
Sbjct: 187 LSLFGEIADDEQAPAGARQRAEMMMDLISGT 217


>gi|90418691|ref|ZP_01226602.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336771|gb|EAS50476.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 360

 Score =  177 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 52/211 (24%), Positives = 105/211 (49%), Gaps = 2/211 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    + K    +     +A ++++++++ A+    +D     + N  G+ +  AL
Sbjct: 9   EVSEELRQDRVKAIWTRFGTYILAAVILVVVITAAV--VGWDRYQTAQANASGDAYLAAL 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L    K D+A ++ + + +     Y  L+ M I  +  A+G    A   F KVA D  A
Sbjct: 67  QLARDGKPDEAITALDALAADSYGAYPDLARMSIGGVYQAQGKFDEAVAAFDKVAADAGA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P A+R  A ++AA +LVD  +  ++   +++L+  S  +   A E + ++A K    + A
Sbjct: 127 PDALRDMAAVRAAYVLVDHGALSDVRSRVERLTGDSEALRFPAREAVALAAWKAEDTETA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
             +F++L  D  +P GI +R++++L  I A 
Sbjct: 187 TMLFQQLVDDPGAPNGIISRARLMLDLIAAG 217


>gi|328544036|ref|YP_004304145.1| hypothetical protein SL003B_2418 [polymorphum gilvum SL003B-26A1]
 gi|326413780|gb|ADZ70843.1| hypothetical protein SL003B_2418 [Polymorphum gilvum SL003B-26A1]
          Length = 229

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 45/208 (21%), Positives = 88/208 (42%), Gaps = 3/208 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    K +    +    WI  L ++++     +   +    + K    G+ F +A+
Sbjct: 7   EVDEDIRQEKYRRLWDRFG-LWIIVLAVVIVAGTGGY-RGWSYWQQTKAREAGDMFLRAV 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L  S +  +A+  F ++       Y  L+ +  A+ L   G+ + A   F  +A D   
Sbjct: 65  ALAESGQHLEAQELFGRLE-TATGGYPVLARLRGATDLAVAGNPEEAIARFDAIAADRSV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +R  A+L+A  + +D+  +  +   L+ ++  +NP    A EIL  SA K G    A
Sbjct: 124 DSLMRDLASLRAGYLALDSLDHAAVQDRLEGVAGDANPWRFAAREILAFSAWKAGDTAAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANI 209
           +   + +  D  +P  +S R  ++   I
Sbjct: 184 RDWIDRIVDDAAAPADVSGRVGILNELI 211


>gi|163761003|ref|ZP_02168081.1| hypothetical protein HPDFL43_03169 [Hoeflea phototrophica DFL-43]
 gi|162281784|gb|EDQ32077.1| hypothetical protein HPDFL43_03169 [Hoeflea phototrophica DFL-43]
          Length = 223

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 62/212 (29%), Positives = 107/212 (50%), Gaps = 2/212 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N+D  S   K    +  ++++     + I+++      ++   E      G+ F  AL
Sbjct: 11  EVNDDLRSDYFKALWAR--FRFVIIGAAIAIVAVTAGLRGWEYWQESTAAKSGDAFLAAL 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           EL      D A + F+++ +  +  Y  L+ M  A++L  +GD+  A   F  +  D   
Sbjct: 69  ELARDGNTDAALAGFQELEATGHGSYPVLARMRAATVLADQGDSAAAISAFSSIGKDASQ 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P A+R AA ++AA +LVD  SY+++S  ++ L+ P N     A E LG++A K G + KA
Sbjct: 129 PTAIRDAARMRAAYLLVDHGSYDDVSAEVEVLAVPGNAARHAAREALGLAAFKAGDLAKA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASD 213
              F E+  DN +P G++ R+++IL  I A  
Sbjct: 189 SEWFNEVINDNQTPRGVANRARVILDLIAARG 220


>gi|304391251|ref|ZP_07373195.1| putative tetratricopeptide repeat protein [Ahrensia sp. R2A130]
 gi|303296607|gb|EFL90963.1| putative tetratricopeptide repeat protein [Ahrensia sp. R2A130]
          Length = 228

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 60/217 (27%), Positives = 107/217 (49%), Gaps = 2/217 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N++  S +      +     I  L + ++L++++W Y+ + S  K+    G+ F  A+
Sbjct: 9   EVNDELRSERASEFWKRFG-TIIIALAVAIVLAVSVWRYM-EYSAAKEAAASGDAFMSAV 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L    K ++A ++ EK+ ++    Y  ++ +  AS L  +G  K A   +  V  D++A
Sbjct: 67  ALAEDGKTEEAIAALEKLEAEHGGAYGAMAQLRAASELAKQGQKKEAIAAYDVVVADNMA 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +R  A L+A  ++VD  + E++S  +  LS P  P    A E LG++  K G + KA
Sbjct: 127 DEDLRSIARLRAGYLMVDEGTVEDVSSRVTSLSAPGAPYRSSALEALGLAYFKAGDLDKA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              F+E+AKD N+P  I  R  ++L  I A     + 
Sbjct: 187 FAQFDEIAKDANAPASIGQRVTIMLDVIAARGGPTRD 223


>gi|90423780|ref|YP_532150.1| hypothetical protein RPC_2277 [Rhodopseudomonas palustris BisB18]
 gi|90105794|gb|ABD87831.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 217

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 47/213 (22%), Positives = 97/213 (45%), Gaps = 3/213 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    + K    +     I   +  +I++    +  +     KK    G  F QA 
Sbjct: 7   EVDEELRREQLKRLWDRYSLLIIVGAI--LIIAGVGGWRGYQYFEAKKAAEAGAAFNQAS 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           EL   NK  +A + F K+ +     Y  L+ +  A+ +  + D + AA+ + ++A D   
Sbjct: 65  ELSEQNKHAEAEAVFAKLATTAPAGYRTLARLRNAAEIATR-DPQAAAKAYDEIAADRAV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A ++AA +L++T+SY ++ + L+  +         A E+L +SA + G    A
Sbjct: 124 PAVDRDLAKVRAAGLLLETASYSDLLQRLEPATTADGTYRHTARELLALSAWRGGDATAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           +   E ++ D  +P  + +R+ ++ A +  + +
Sbjct: 184 RKWLELISTDAETPSSLRSRADVLQALLPPAAK 216


>gi|85716389|ref|ZP_01047361.1| hypothetical protein NB311A_02311 [Nitrobacter sp. Nb-311A]
 gi|85696746|gb|EAQ34632.1| hypothetical protein NB311A_02311 [Nitrobacter sp. Nb-311A]
          Length = 217

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 48/213 (22%), Positives = 92/213 (43%), Gaps = 3/213 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E +++    + +    +  +  I   +IL+I ++  W   +     +K       F  A 
Sbjct: 7   EIDDELRREQVQKFWSRY-WALIVAAVILVIAAVGGW-RGYQYLQTQKAAEASSTFEAAA 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L   NK  +A ++F K+       Y  LS    A+   A+ DT  A +++  +A+D   
Sbjct: 65  ALAAQNKHAEAEAAFTKLAETAPSGYRTLSR-LRAAAEAARHDTNAAVKLYDAIASDSGL 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A R  A + AA +LVDT +Y  +   L+  + P       A E+L +SA   G    A
Sbjct: 124 SSAERDLARVSAARLLVDTETYNNMLPRLEPATAPEATYRHTARELLALSAWSNGDTTAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           +   + +++D  +P  +  R++ + A +    +
Sbjct: 184 RKWLDMISEDGQTPSSLRRRAEALQALLPPVAK 216


>gi|209885508|ref|YP_002289365.1| hypothetical protein OCAR_6387 [Oligotropha carboxidovorans OM5]
 gi|209873704|gb|ACI93500.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 214

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 54/213 (25%), Positives = 105/213 (49%), Gaps = 6/213 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E +++    + K    +     I  + +++I++ A  + L+     +K    G+ F  AL
Sbjct: 7   EIDDELRREQLKKIWDRYSIHII--IAVVLIVAAAGGWRLYQHFETQKAEEAGKAFQSAL 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L +      A ++FEKI +   + Y+ L+ + +A   V + D K A   +  +AND   
Sbjct: 65  ALTD---PAQAEAAFEKIAASKARGYSMLARLQVAGEAVKQ-DPKKAIAAYDVIANDGSL 120

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              VR  A ++AA++++DT+SY+EI K LQ  +  +N     A E+L +SA +   V+ A
Sbjct: 121 DAPVREIARIRAANLMLDTASYDEIEKRLQGDATGTNTFRHSAREVLALSAWRANNVEAA 180

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           +   + +  D  SP  +  R++ + A +  + +
Sbjct: 181 RRWIDMIGNDPQSPATLRRRAEALGALLPTAAK 213


>gi|316933669|ref|YP_004108651.1| hypothetical protein Rpdx1_2327 [Rhodopseudomonas palustris DX-1]
 gi|315601383|gb|ADU43918.1| Protein of unknown function DUF2133 [Rhodopseudomonas palustris
           DX-1]
          Length = 218

 Score =  165 bits (418), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 44/209 (21%), Positives = 98/209 (46%), Gaps = 3/209 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    + +    K    +I    IL+++ +  W   ++    K+       FA A 
Sbjct: 7   EVDEELRRERLRKLWEKYS-IYIVGAAILIVVGVGAW-RGYEYYEAKQAAEASTAFAAAA 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           EL   NK  +A ++F+KI +     Y  L+ +  A+ +  + D   A + + ++A D   
Sbjct: 65  ELAEQNKHAEAEAAFDKIAASAPSGYRMLARLRAAAEVATR-DPALAVKRYDEIAADRRL 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A ++AA +++DT++Y ++ + L+ ++   +     A E+L +SA +   V   
Sbjct: 124 PAPYRDLAGIRAAGLVMDTANYNDLVQRLEPIATADSAFRHTARELLALSAWRANNVAAT 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANII 210
           +   +++  D  +P  + +R+ ++ A + 
Sbjct: 184 RQWIDKITTDAETPGSLRSRADVLQALLP 212


>gi|92117232|ref|YP_576961.1| hypothetical protein Nham_1684 [Nitrobacter hamburgensis X14]
 gi|91800126|gb|ABE62501.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 217

 Score =  164 bits (416), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 46/213 (21%), Positives = 95/213 (44%), Gaps = 3/213 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E +++    + K    +     +A  +  +I++    +  +     +K    G  F  A 
Sbjct: 7   EIDDELRREQVKRVWSRYSGLIVAAAI--LIVAAVGGWRGYLYLQTQKSAEAGSAFEAAA 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L + NK  +A ++F K+ +     Y  LS +  A+  V K D K A +++  +A D   
Sbjct: 65  TLADQNKYAEAEAAFTKLAATAPPGYRNLSRLRAAAEAV-KRDPKEAVKLYDAIAADSGF 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A R  A ++AA +L+DT +Y  + + L+  + P       A E+L +SA +      A
Sbjct: 124 GSAERDLARVRAAGLLLDTETYNNMLQRLEPATAPQAAFRHTARELLALSAWRANDTTAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           +   + + +D  +P  + +R++ + A +    +
Sbjct: 184 RKWLDMIGEDGQTPSSLRSRAEALQALLPPVAK 216


>gi|298291069|ref|YP_003693008.1| hypothetical protein Snov_1069 [Starkeya novella DSM 506]
 gi|296927580|gb|ADH88389.1| Protein of unknown function DUF2133 [Starkeya novella DSM 506]
          Length = 235

 Score =  162 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 90/204 (44%), Gaps = 3/204 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    +      +    ++  L +L++L++A W   ++    ++    G  F  AL
Sbjct: 7   EIDEDLRRERFNRLWTRYG-AYVIGLAVLIVLAVAGW-RGYEWWKLQRDQAAGAKFEAAL 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L    K  +A ++F+ +       Y  LS    A+ L  K D   A   +  +A D   
Sbjct: 65  QLAADGKAAEAEAAFQALEKDGTSGYRVLSRFRAATELA-KTDAAKAVAEYDSLAKDPSI 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              ++  A ++AA +LVDT+   ++   ++ L  P       A EI+G++  K G  + A
Sbjct: 124 SPLMQNVAQVRAALLLVDTAPLADVEGRMKPLDTPEGAFRHSAREIIGLAQYKAGDFKAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMI 205
              F  +  D  +P G+  R++++
Sbjct: 184 TDTFSAILNDGQTPPGLRRRAELM 207


>gi|114704715|ref|ZP_01437623.1| hypothetical protein FP2506_07261 [Fulvimarina pelagi HTCC2506]
 gi|114539500|gb|EAU42620.1| hypothetical protein FP2506_07261 [Fulvimarina pelagi HTCC2506]
          Length = 390

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 101/208 (48%), Gaps = 2/208 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    + K    +     ++ +LI+++ + A  +  +      + N  G+ +  A 
Sbjct: 9   EVSEELRQDRLKSIWTRFGTAIVSVVLIVILATGA--YVGWQRYSIAQANATGDRYLAAQ 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L     +D A  +F  I    +  Y  L+ M IA+     G  ++A   +  VAND   
Sbjct: 67  DLVREGDIDGAIEAFRAIAEDGSGAYPELAQMSIANAEAEAGRNEDAIASYEAVANDSSV 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P ++R  A L+AA +LVD  S +++    ++L+   NP+   A + +G++A K G  + A
Sbjct: 127 PESLREMADLRAAYLLVDHGSLDDVRARAERLTGDDNPLRYAARDAIGLAAWKAGDTETA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANI 209
           + +++ + +  ++P GIS R+ +I   +
Sbjct: 187 RDLYQSILEAGDAPNGISQRAGLITGLL 214


>gi|91977475|ref|YP_570134.1| hypothetical protein RPD_3007 [Rhodopseudomonas palustris BisB5]
 gi|91683931|gb|ABE40233.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 217

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 47/213 (22%), Positives = 98/213 (46%), Gaps = 3/213 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    + K    K  Y        ++I++    +  ++    KK    G  F  A 
Sbjct: 7   EVDEEVRREQLKRLWEK--YSIFIVAGAILIIAGVGAWRGYEYYEAKKAAEAGAAFTAAA 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L   NK  +A ++F KI +  +  Y  L+ +  A+ +  + D K A +++  +A D   
Sbjct: 65  DLAEQNKHAEAEAAFNKIAATTSTGYRTLARLRAAAEVAQR-DPKEAVKLYDAIAADRSV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  AT++AA +L+D++ Y ++ + L+ +S  +      A E+L +SA +   V   
Sbjct: 124 PAQDRDLATIRAAQLLMDSAGYTDLQQRLEPISGANGAYRHTAREMLALSAWRANNVAAT 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           +   E +  D  +P  +  R++++ A +  + +
Sbjct: 184 RQWIEMINTDAETPASLRNRAEVLQALLPPAAK 216


>gi|39936160|ref|NP_948436.1| hypothetical protein RPA3097 [Rhodopseudomonas palustris CGA009]
 gi|39650015|emb|CAE28538.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 229

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 43/209 (20%), Positives = 100/209 (47%), Gaps = 3/209 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    + K    K     +    +L+++ +  W   ++    KK    G  FA A 
Sbjct: 18  EVDEELRRERLKRLWDKYSLVIVGG-ALLIVVGVGAW-RGYEYYEAKKAAEAGAAFAAAA 75

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L   NK  +A ++F+KI +     Y  L+ +  A+ +  + D + A + + ++A D   
Sbjct: 76  DLAEQNKHAEAEAAFDKIAASAPAGYRTLARLRAAAEIGTR-DAQAAVKRYDEIAADRSL 134

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  A+++AA+++++T+SY ++ + L+ ++  +      A E+L +SA +   V   
Sbjct: 135 AAPFRELASIRAANLVLETASYNDLVQRLEPVASGNGAFRHTARELLALSAWRANNVAAT 194

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANII 210
           +   +++  D  +P  + +R+ ++ A + 
Sbjct: 195 RQWIDKITTDAETPGSLRSRADVLQALLP 223


>gi|158425954|ref|YP_001527246.1| hypothetical protein AZC_4330 [Azorhizobium caulinodans ORS 571]
 gi|158332843|dbj|BAF90328.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 238

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 43/204 (21%), Positives = 94/204 (46%), Gaps = 3/204 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    +      +  +     L ++ +++    +  +    +++       F  A+
Sbjct: 7   EIDEDLRRERLSRLWNR--FGIYVILFVVAVIAGTAAYSGWRWWQQREAQATSVRFEAAV 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L +  K  +A ++F  +       Y  L+    A+ L  + D   A   F  +A D   
Sbjct: 65  KLADEGKHQEAEAAFNALAKDAPAGYRALARFRAATELATR-DKAAAVAAFDTLAADTGL 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A R  A ++AA ILVDT +  ++ + +Q L++ ++P+   A E++ +S  K G ++ A
Sbjct: 124 TAAERDLARIRAAMILVDTGAVADVKQRVQALADGTSPLRHSARELIALSQYKAGDLKGA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMI 205
            T    + +D  +P+G+ +R+++I
Sbjct: 184 NTTASLILEDQETPYGVRSRAELI 207


>gi|299133683|ref|ZP_07026877.1| Protein of unknown function DUF2133 [Afipia sp. 1NLS2]
 gi|298591519|gb|EFI51720.1| Protein of unknown function DUF2133 [Afipia sp. 1NLS2]
          Length = 214

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 91/195 (46%), Gaps = 6/195 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    + K    +    +I  +LI++I+     +  +     +K    G+ F  A+
Sbjct: 7   EIDEDLRREQLKKLWDRYSLHFI--VLIVLIVGGVGGWRAYQYFENQKAEAAGKAFEAAV 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L +      A+++F+KI S + + Y+ L+ ++ A+    + D++     F  VAND   
Sbjct: 65  ALTD---PAQAQAAFDKIASSNAQGYSTLARLHAAAEAAKQ-DSQKGIAAFDAVANDGKV 120

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +R  A L+AAS+L+DT+ Y +I K L   +  ++     A E+L +SA +      A
Sbjct: 121 EAPIREIARLRAASLLLDTAPYADIEKRLSDDASGTHTFRHSARELLALSAWRAKNNDAA 180

Query: 182 KTIFEELAKDNNSPF 196
           +   + +  D  SP 
Sbjct: 181 RKWLDMIGDDPQSPA 195


>gi|192291878|ref|YP_001992483.1| hypothetical protein Rpal_3507 [Rhodopseudomonas palustris TIE-1]
 gi|192285627|gb|ACF02008.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 218

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 43/209 (20%), Positives = 100/209 (47%), Gaps = 3/209 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    + K    K     +    +L+++ +  W   ++    KK    G  FA A 
Sbjct: 7   EVDEELRRERLKRLWDKYSLVIVGG-ALLIVVGVGAW-RGYEYYEAKKAAEAGAAFAAAA 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L   NK  +A ++F+KI +     Y  L+ +  A+ +  + D + A + + ++A D   
Sbjct: 65  DLAEQNKHAEAEAAFDKIAASAPAGYRTLARLRAAAEIGTR-DAQAAVKRYDEIAADRSL 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  A+++AA+++++T+SY ++ + L+ ++  +      A E+L +SA +   V   
Sbjct: 124 AAPFRELASIRAANLVLETASYNDLVQRLEPVASGNGAFRHTARELLALSAWRANNVAAT 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANII 210
           +   +++  D  +P  + +R+ ++ A + 
Sbjct: 184 RQWIDKITTDAETPGSLRSRADVLQALLP 212


>gi|296284227|ref|ZP_06862225.1| hypothetical protein CbatJ_11411 [Citromicrobium bathyomarinum
           JL354]
          Length = 267

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 101/214 (47%), Gaps = 3/214 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E ++   + + +    +    +I  +++L +L+ A   + F G  E  +    E    AL
Sbjct: 30  EVDDAVRTDQYRHVWTRYG-IYIIGVVLLGLLAFAAVLF-FSGQSEGNRESESETLVTAL 87

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +   +  LD A  +   +           + M  A I + +G  K AAE+F +VA D+  
Sbjct: 88  DQVEAGNLDQADEALAPLAEDGRGGGKTQAQMLRAGIALEQGRAKEAAELFGQVAADEDV 147

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P ++R  A L+A     D+    E+ + L  L++P  P +  A EIL ++ L+ G  ++A
Sbjct: 148 PQSIRDLAELRAVVAGYDSMKPAEVIRRLTPLAQPDQPYYGSAGEILAMAYLEGGDKERA 207

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
             +F E+A D++ P  I  R++ + A+++  D  
Sbjct: 208 GKLFGEIAMDDDVPDTIRGRARQM-ASVLGVDAV 240


>gi|27379161|ref|NP_770690.1| hypothetical protein blr4050 [Bradyrhizobium japonicum USDA 110]
 gi|27352311|dbj|BAC49315.1| blr4050 [Bradyrhizobium japonicum USDA 110]
          Length = 217

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 47/213 (22%), Positives = 104/213 (48%), Gaps = 3/213 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    + K    K    +   L++L++ ++  W   +     KK    G  F +A+
Sbjct: 7   EVDEEVRREQLKKLWEKYS-IYFIALMVLIVAAVGGW-RGYQYLEAKKAAEAGAAFEKAV 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           EL   +K  +A ++F ++ ++    Y  L+ +  A+   ++ D K AA+++  +A D   
Sbjct: 65  ELSEQDKHAEAETAFTELAAKAPSGYRTLARLRAAAEAASR-DPKAAAKMYDDIAADRGV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               +  A ++AA +LVD++SY ++ + L+  + P +     A E+L +SA +      A
Sbjct: 124 GGEWQDLAKIRAAGLLVDSASYADMQQRLEASATPKSTFRHSARELLALSAWRNNDTTAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           +   + +A+D  +P G+ +R++ + A +    +
Sbjct: 184 RKWLDAIAEDGETPPGLRSRAEALQALLPPVAK 216


>gi|146340693|ref|YP_001205741.1| hypothetical protein BRADO3744 [Bradyrhizobium sp. ORS278]
 gi|146193499|emb|CAL77515.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 217

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/213 (23%), Positives = 94/213 (44%), Gaps = 3/213 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    + K    +    +I  + +L+I  +  W   +     +K    G  F +AL
Sbjct: 7   EVDEEVRREQLKKLWDRYS-IFIIAVAVLIIAGVGGW-RGYQYLEAQKAAEAGAAFNKAL 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           EL   NK  +A  +F  + +     Y  L+  + A+    + D   A +++  +A D   
Sbjct: 65  ELSEQNKHAEAEKAFADVAATAPSGYRMLARFHQAAEAAVR-DKAAAVKLYDDLAADRGI 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               +  A L+AA +LVDT+ Y ++   L+  +    P    A E+L +SA K      A
Sbjct: 124 GAEQQSMARLRAAGLLVDTAPYADLKPRLEGETAAGAPFRHAARELLALSAWKANDAAAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           +   + +A D  +P G+ +R++ + A + A  +
Sbjct: 184 RQWLDMIALDGETPPGLRSRAEALQALLPAVAK 216


>gi|86749566|ref|YP_486062.1| hypothetical protein RPB_2446 [Rhodopseudomonas palustris HaA2]
 gi|86572594|gb|ABD07151.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 217

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/213 (22%), Positives = 97/213 (45%), Gaps = 3/213 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    + K    K  Y        ++I++    +  +     KK    G  F  A 
Sbjct: 7   EVDEEVRRERLKQLWDK--YSLFIIAGAILIIAGVGGWRGYQYYEGKKAAETGAAFTAAA 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L   NK  +A ++F  I +  +  Y  L+ +  A+ +  + D K A +++  +A D   
Sbjct: 65  DLAEQNKHAEAEAAFNNIAATASGGYRTLARLRAAAEVAQR-DPKEAVKVYDAIAADRSV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A+L+AA  L+D+  Y ++S+ L+ ++         A E+L +SA + G V  A
Sbjct: 124 PAQDRDLASLRAAQFLMDSVGYADLSQRLEPIAGADAAYRHTAREMLALSAWRAGNVAAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           +   E++  D  +P  +  R++++ A +  + +
Sbjct: 184 RQWIEQINTDAGTPASLRNRAEVLQALLPPAAK 216


>gi|254503672|ref|ZP_05115823.1| hypothetical protein SADFL11_3711 [Labrenzia alexandrii DFL-11]
 gi|222439743|gb|EEE46422.1| hypothetical protein SADFL11_3711 [Labrenzia alexandrii DFL-11]
          Length = 225

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 88/210 (41%), Gaps = 3/210 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    K +    +    W+  + +L+++    +        + +    G+ F +A+
Sbjct: 7   EVDEDIRHEKYRRLWDRFG-SWVIAVAVLIVVGTGGYRGWL-YWQDTQSQSAGDTFLEAV 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L  + +  +A   + ++ S     Y  L+ M  A+     GD   A   F  ++ D   
Sbjct: 65  SLSEAGQYSEASQLYTELGSSI-GGYPALAQMRQATDKANAGDATAALAEFDALSRDSNL 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A++  A L+AA I VD+  Y+ I+  ++ L+  ++     A E+L +SA K G  + A
Sbjct: 124 APALQNVAALRAAYIAVDSEPYDAIADRIESLTGDTDAFRAAARELLALSAWKNGDAETA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIA 211
            T    L  D  +P  I  R  ++   I  
Sbjct: 184 LTWITALEDDAETPQDIRQRVTLLGGLIRG 213


>gi|85708007|ref|ZP_01039073.1| hypothetical protein NAP1_02190 [Erythrobacter sp. NAP1]
 gi|85689541|gb|EAQ29544.1| hypothetical protein NAP1_02190 [Erythrobacter sp. NAP1]
          Length = 256

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 46/212 (21%), Positives = 87/212 (41%), Gaps = 3/212 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E +        K    K        L I ++L+    FY +DG +E       E    AL
Sbjct: 26  EIDEAVRQDDTKEFFQKYGVP--LGLAISLLLAGMFGFYFWDGRNEAALERQSEQIISAL 83

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +  + N  + A    + ++ + +      +    A+  + +G+   A E++  +A D   
Sbjct: 84  DSVDVNDFEGASEKVDGLVDEGSIGARTSAKFLQAAAALEEGNPAKAVELYASIAADPET 143

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A ++  S   D     ++   L  L+ P NP    A E+  I+ L+ G   +A
Sbjct: 144 PGPLRNLAVIREVSTNFDERDPADVIAKLSDLAVPGNPYFGSAGELTAIAHLEAGNRDEA 203

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASD 213
             +F E+A D   P  + +R++ + A ++  D
Sbjct: 204 GALFAEMANDEALPETLRSRARQM-AGLLGVD 234


>gi|75676212|ref|YP_318633.1| hypothetical protein Nwi_2022 [Nitrobacter winogradskyi Nb-255]
 gi|74421082|gb|ABA05281.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 217

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 42/213 (19%), Positives = 94/213 (44%), Gaps = 3/213 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E +++    + K   G+  Y  +    ++++L     +  +     +K       F  A 
Sbjct: 7   EIDDELRRERLKKIWGQ--YSALIIAAVILVLVAVGGWRGYQYLQTQKAAEASSAFEAAA 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L + NK  +A+++F K+       Y  LS    A+   A+ D   A +++  +A +   
Sbjct: 65  ALADQNKHAEAQAAFAKLAETAPLGYRNLSR-LRAAAEAARHDINAAVKLYDAIATEGGF 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  A ++AA++LVD+ +Y  + + L+  + P       A E+L +SA +      A
Sbjct: 124 SSVERDFARVRAAALLVDSETYNNMLQRLEPAAAPEATFRHSARELLALSAWRSDDATAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           +   + +++D+ +P  +  R++ + A +    +
Sbjct: 184 RKWLDMISEDSQTPSSLRGRAEALQALLPPVAK 216


>gi|83310441|ref|YP_420705.1| hypothetical protein amb1342 [Magnetospirillum magneticum AMB-1]
 gi|82945282|dbj|BAE50146.1| Uncharacterized protein [Magnetospirillum magneticum AMB-1]
          Length = 227

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 51/216 (23%), Positives = 101/216 (46%), Gaps = 5/216 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    +      K  +  +     L ++     +  + G   K++      +++  
Sbjct: 16  EVDEDLRQEELNRLWKK--HGGLFAAAALALVLAVAGWQGWQGWEAKQRQAASARYSETA 73

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L    K D+A     K+ ++  K Y  L+++  A +    GD   AA ++ K+A D   
Sbjct: 74  ALIEQGKKDEAVEVLNKLSAEGPKGYRLLADLRKADMAQQAGDFTGAAALYGKIAADTSV 133

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  +T++AA +++D+     I K ++ L+  ++     A EIL ++ALK G+  +A
Sbjct: 134 DKVYRDMSTIRAAYLVLDSGDVAAIEKSVEPLAAEASSWRHSAREILALAALKRGETPRA 193

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
             +F ++A+D  +P G+ TR+  +LA   A+ QR +
Sbjct: 194 AELFAKIAEDAAAPQGLRTRAAEMLA---ATGQRAR 226


>gi|312114897|ref|YP_004012493.1| hypothetical protein Rvan_2169 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220026|gb|ADP71394.1| hypothetical protein Rvan_2169 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 239

 Score =  148 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 55/208 (26%), Positives = 94/208 (45%), Gaps = 2/208 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    +      K  Y     +  L+I +    +              G+    A+
Sbjct: 10  EVNEEHRRRQTAVFFKK--YGIYIGIAALVIAAGVGGYKWDQARRAADAARGGDALVTAI 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L    K  +A  +   +       Y  L+ ++ AS  +A+     AAE +  VA+D+ A
Sbjct: 68  TLHEDGKEAEAEKALADLAGSGPGAYRVLARLHAASESLAQKKYDQAAEDYRGVASDENA 127

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +R  A +Q A++ VD  SYE +S+ L      ++     A ++LGI+A K GK  +A
Sbjct: 128 PATLRDFARVQIAALSVDKESYESLSQTLAPYRSGTSEWRFAAKDVLGIAAFKEGKRDEA 187

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANI 209
           + IF E+A D  +P G+  R+Q++LA +
Sbjct: 188 ERIFGEIASDGAAPAGMRQRAQIMLALL 215


>gi|115525348|ref|YP_782259.1| hypothetical protein RPE_3347 [Rhodopseudomonas palustris BisA53]
 gi|115519295|gb|ABJ07279.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 217

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 50/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    + K    +     IA    ++I++    +  +     KK    G  F  A 
Sbjct: 7   EVDEDLRREQLKKLWDRYSLLIIACA--VLIIASVGGWRGYQYFEAKKAAEAGAAFNAAA 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L   NK  +A ++F K+++     Y  L+ + +A+ + A+ DT   A+ F ++A D   
Sbjct: 65  DLAEQNKHAEAEAAFAKLMATAPSGYRTLARLRLAAEIAAR-DTTAGAKAFDEIAADSAV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A L+AA++L++T+SY ++ + L+  +  +      A E+L +SA + G    A
Sbjct: 124 PAVDREVAKLRAATLLLETASYPDMVQRLEPSAAATGTFRHSARELLALSAWRTGDAAAA 183

Query: 182 KTIFEELAKDNNSPFGISTR 201
           +   E +A D  +P  +  R
Sbjct: 184 RKWLELIATDAETPSSLRQR 203


>gi|283856260|ref|YP_162184.2| hypothetical protein ZMO0449 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775255|gb|AAV89073.2| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 254

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/190 (26%), Positives = 89/190 (46%), Gaps = 5/190 (2%)

Query: 18  KCCYKWIAP-LLILMILSLAIWFYLFDGSHEKKK-NIVGENFAQALELFNSNKLDDARSS 75
           +C    IA  LL++ +  +  W Y     H+++  N  G+  A A+            ++
Sbjct: 40  RCITAAIAVILLVVGVGGIGCWSY---HRHKQEAINSRGDALAAAIAPVIQGGQVKDVAT 96

Query: 76  FEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAAS 135
            +K+++ ++ +Y  L     A IL  KGD K+A  ++  V ND  A   +   ATL  ++
Sbjct: 97  LDKLIASNDPVYANLGRFLKAGILSDKGDVKSATALYQTVLNDPAAGDILHAVATLHLSA 156

Query: 136 ILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSP 195
           I +DT   E + K LQ L  P +     A E+   + LK  K ++A  I++ +  D + P
Sbjct: 157 IELDTVPPENVIKRLQPLVAPGSRWLGSAGEMQAAAYLKENKPEQAVKIYQRIYSDTSVP 216

Query: 196 FGISTRSQMI 205
             I  R++ +
Sbjct: 217 EDIRERAKSL 226



 Score = 36.9 bits (84), Expect = 1.8,   Method: Composition-based stats.
 Identities = 12/88 (13%), Positives = 32/88 (36%), Gaps = 7/88 (7%)

Query: 52  IVGENFAQALEL------FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDT 105
             G+       L       ++   ++     + +++  ++       M  A+ L  +   
Sbjct: 141 AAGDILHAVATLHLSAIELDTVPPENVIKRLQPLVAPGSRWLGSAGEMQAAAYL-KENKP 199

Query: 106 KNAAEIFLKVANDDLAPLAVRYAATLQA 133
           + A +I+ ++ +D   P  +R  A   A
Sbjct: 200 EQAVKIYQRIYSDTSVPEDIRERAKSLA 227


>gi|241760998|ref|ZP_04759087.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241374617|gb|EER64078.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 254

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 92/201 (45%), Gaps = 4/201 (1%)

Query: 18  KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFE 77
           +C    IA +L+++ +     +       E   N  G+  A A+            ++ +
Sbjct: 40  RCITAAIAVILLVVGVGGIGCWSYHRHKQE-AINSRGDALAAAIAPVIQGGQVKDVATLD 98

Query: 78  KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
           K+++ ++ +Y  L     A +L  KGD K+A  ++  V ND  A   +   ATL  ++I 
Sbjct: 99  KLIASNDPVYANLGRFLKAGVLSDKGDVKSATALYQTVLNDPAAGDILHAVATLHLSAIE 158

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
           +DT   E + K LQ L  P +     A E+   + LK  K ++A  I++ +  D + P  
Sbjct: 159 LDTVPPENVIKRLQPLVAPGSRWLGSAGEMQAAAYLKENKPEQAVKIYQRIYSDTSVPED 218

Query: 198 ISTRSQMIL---ANIIASDQR 215
           I  R++ +    A+I+ +++ 
Sbjct: 219 IRERAKSLANSYADIVGNNKE 239


>gi|260753036|ref|YP_003225929.1| hypothetical protein Za10_0798 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258552399|gb|ACV75345.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 254

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 92/201 (45%), Gaps = 4/201 (1%)

Query: 18  KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFE 77
           +C    IA +L+++ +     +       E   N  G+  A A+            ++ +
Sbjct: 40  RCITAAIAVILLVVGVGSIGCWSYHRHKQE-AINSRGDALAAAIAPVIQGGQVKDVATLD 98

Query: 78  KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
           K+++ ++ +Y  L     A +L  KGD K+A  ++  V ND  A   +   ATL  ++I 
Sbjct: 99  KLIASNDPVYANLGRFLKAGVLSDKGDVKSATALYQTVLNDPAAGDILHAVATLHLSAIE 158

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
           +DT   E + K LQ L  P +     A E+   + LK  K ++A  I++ +  D + P  
Sbjct: 159 LDTVPPENVIKRLQPLVAPGSRWLGSAGEMQAAAYLKENKPEQAVKIYQRIYSDTSVPED 218

Query: 198 ISTRSQMIL---ANIIASDQR 215
           I  R++ +    A+I+ +++ 
Sbjct: 219 IRERAKSLANSYADIVGNNKE 239


>gi|46201386|ref|ZP_00055151.2| COG2976: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 227

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 51/216 (23%), Positives = 98/216 (45%), Gaps = 5/216 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    +      K         +   ++     +  + G   K++      + +  
Sbjct: 16  EVDEDLRQEELNRLWKKHGGLLSLAAV--ALVLAVAGWQAWQGWDAKQRQAASARYLETS 73

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L    K D+A     K+ ++  K Y  L+++  A + +  GD   AA ++ KVA D   
Sbjct: 74  SLIEQGKKDEAAEVLGKLSAEGPKGYRLLADLRRADMALQAGDAAGAAALYGKVAADTSV 133

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  A ++AA + +D   +  + K ++ L+  ++P    A EIL ++ALK G+  +A
Sbjct: 134 DKVYRDMAVIRAAYLTLDGGDFATMEKSVEPLAAEASPWRHSAREILALAALKRGETPRA 193

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
             +F ++A+D  +P G+ TR+  +LA   A+ QR +
Sbjct: 194 AELFAKIAEDAAAPQGLRTRAAEMLA---ATGQRAR 226


>gi|148255172|ref|YP_001239757.1| hypothetical protein BBta_3774 [Bradyrhizobium sp. BTAi1]
 gi|146407345|gb|ABQ35851.1| hypothetical protein BBta_3774 [Bradyrhizobium sp. BTAi1]
          Length = 217

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/213 (22%), Positives = 97/213 (45%), Gaps = 3/213 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    + K    +     IA  +  +I++    +  +  +  KK    G  F +A+
Sbjct: 7   EVDEEVRREQLKRLWDRYSIFIIAIAV--LIIAGVGGWRGYQYAEGKKAAEAGSAFNKAI 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           EL   NK ++A  +F ++ +     Y  L+  + A+    + D   A  ++ ++A D   
Sbjct: 65  ELSEQNKREEAEKAFAEVAATAPAGYRMLARFHQAAEAAGR-DKAAAVRLYDELAADRSI 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               +  A L+AA +LVDT+ Y ++ + L+  +    P    A E+L +SA K      A
Sbjct: 124 GAEQQSMARLRAAGLLVDTAPYPDLKQRLEGEAASGAPFRHAARELLALSAWKANDAAAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           +   + +A D  +P G+ +R++ + A + A  +
Sbjct: 184 RQWLDMIALDGETPPGLRSRAEALQALLPAVAK 216


>gi|87198965|ref|YP_496222.1| hypothetical protein Saro_0943 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134646|gb|ABD25388.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 253

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 54/214 (25%), Positives = 97/214 (45%), Gaps = 3/214 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E ++     +    + K   K +   +I  +L LA W   ++  +       GE   +AL
Sbjct: 29  EVDDALREDQVFTAVQKYG-KPVGAAIIAGLLGLAGWL-WYENHNNAVAGEQGEVLTKAL 86

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +   +  L  A      +    N+ Y   S M  A IL  +G T  AA+ F  +A D  A
Sbjct: 87  DQLETRNLKAAADELGPLAKDGNEGYRATSRMLEAGILAEQGKTAEAAKAFAAIAADGGA 146

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P A R  AT++  ++  D  + +++ + L+ L+ P N     A E++G++ LK GK   A
Sbjct: 147 PQAYRDLATIREVALDFDKLAPDKVVERLKPLAVPGNAWFGNAGELVGVAYLKQGKNDLA 206

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
             +F ++AK+   P  +  R++ + A ++  D  
Sbjct: 207 GALFAQIAKEKTVPDSLRRRARQM-AGMLGVDAV 239


>gi|170740823|ref|YP_001769478.1| hypothetical protein M446_2605 [Methylobacterium sp. 4-46]
 gi|168195097|gb|ACA17044.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 236

 Score =  140 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 44/211 (20%), Positives = 86/211 (40%), Gaps = 5/211 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N D    +      +        + +L+++ +  W   +    + +       F +A+
Sbjct: 9   EVNEDYRRDRAAEIWKRYS-GVFIGIAVLVVIGVGGW-RFWQHEQQVQAEAASRRFDEAV 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                 K  +A  +FE + +     Y  L+    A+    K D    A  +  +A D   
Sbjct: 67  RASKD-KGGEAAKAFETLAADSPHGYRILAQFRAAAE-AGKADPAAGARAYAAIAADTGV 124

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +R AA L+ A + +D+   E +   LQ L+   N     A E+LG++A++ G  + A
Sbjct: 125 GPGLRDAARLRGALLRLDSDDPEAL-NTLQGLAASGNAFRHTAREMLGLTAMRKGDFEGA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
              F+++A D  +P G+  R ++ +A     
Sbjct: 184 GRWFDQIAADRETPPGLRQRLEVYVALAAGG 214


>gi|220924492|ref|YP_002499794.1| hypothetical protein Mnod_4624 [Methylobacterium nodulans ORS 2060]
 gi|219949099|gb|ACL59491.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 236

 Score =  137 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 46/211 (21%), Positives = 89/211 (42%), Gaps = 5/211 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    +      +        + +L++L +  W   +    + +       F +A+
Sbjct: 9   EVNEEYRRDRAAEIWKRYS-GVFIGIAVLVVLGIGGW-RFWQHEQQVQAEAASRRFDEAV 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                 K  DA  +FE + +     Y  L+    A+    K +    A+ +  +A+D+  
Sbjct: 67  RTAKD-KGADAAKTFEAVAADAPGGYRVLAR-LRAAAEAGKVEPAAGAKAYAAIADDNAV 124

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +R  A L+ A + +D    E +   LQ L+ P+N     A E+LG+SAL+ G    A
Sbjct: 125 GQGLRDVARLRGALLRLDADDPEAL-NTLQGLATPTNAFRHTAREMLGLSALRKGDFDGA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
              F+++A D  +P G+  R ++ +A +   
Sbjct: 184 GRWFDQIAADRETPQGLRQRLEVYIALVAGG 214


>gi|332185317|ref|ZP_08387066.1| hypothetical protein SUS17_235 [Sphingomonas sp. S17]
 gi|332015041|gb|EGI57097.1| hypothetical protein SUS17_235 [Sphingomonas sp. S17]
          Length = 222

 Score =  137 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 89/216 (41%), Gaps = 3/216 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E +++    +      +  +  +   ++L+ L+    +  +     ++    GE    A 
Sbjct: 3   EVDDELRRERLTSFWTR--WGLVIGAVLLIGLAAFGGYLYWQHRQHEQAGADGEQLQAAY 60

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +    + +  A++    +   +   Y  L++   A IL+ + D K AA  F  +AND   
Sbjct: 61  DALGQSDVKTAQAKLAPLAQSNVDAYRALASFTQADILLQRNDLKGAAARFAAIANDASL 120

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  A ++      DT   E +   L  ++ P N     A E++ ++ L+  K  +A
Sbjct: 121 AQPFRDLALVRQTMAEYDTLKPEAVISRLGSMAVPGNAWFGSAGEMVAVAYLRQNKRAQA 180

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
             +F ++A D + P  +  R+ + +A ++  D   +
Sbjct: 181 GRLFGQIASDKDVPDTLRQRA-VQMAGVLGVDAVGQ 215


>gi|218507875|ref|ZP_03505753.1| hypothetical protein RetlB5_09820 [Rhizobium etli Brasil 5]
          Length = 160

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/152 (26%), Positives = 81/152 (53%), Gaps = 2/152 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +  S + K    +   ++I    IL+++  A    L+D   + + +  G+ F  A+
Sbjct: 11  EVNEELRSDQMKGAWRRFG-RYIIVAAILIVVGTAG-KVLYDYWDDTRSSGAGDQFLAAM 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L + NK D+A ++ +K+  + +  Y  L+ M  A++   KGD   A   F ++  D+  
Sbjct: 69  KLADENKNDEALAALDKLEKEGHGAYPVLARMRAATVQAQKGDANAAIAAFNEIGKDNGV 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKL 153
           P AVR AA ++A  +L++  SYE++S  ++++
Sbjct: 129 PAAVRDAARMRAGWLLIENGSYEQVSAAIEEM 160


>gi|114569752|ref|YP_756432.1| hypothetical protein Mmar10_1201 [Maricaulis maris MCS10]
 gi|114340214|gb|ABI65494.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 261

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/208 (20%), Positives = 92/208 (44%), Gaps = 3/208 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    K +  + +  +   A    L +++ ++ +  FD      +    + F  A+
Sbjct: 7   EVDEELRRDKYQDLLRQ--WGPWALGAALAVIAGSVAWQSFDAWQTGGRQTASDAFIAAM 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
               S +L  A +  E +       Y  L+ +   ++ + +GD   A   F + A     
Sbjct: 65  THSESGELALAAAGLETLAENGTPGYVSLALIQRGNVAIEQGDNAAATGFFEQAAAQASD 124

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           PL +R  A ++A     D+ S+ +I   L +L    +P    A E +  +AL+   +++A
Sbjct: 125 PL-LRDMAEIRAVWSSWDSLSFSDIDLRLSRLVNADSPYRHIARETIAAAALRADNIERA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANI 209
           +T ++ L+  +++P G+  R+Q  +A I
Sbjct: 184 RTQYQFLSFSSDAPAGVQRRAQEAMALI 211


>gi|254420734|ref|ZP_05034458.1| hypothetical protein BBAL3_3044 [Brevundimonas sp. BAL3]
 gi|196186911|gb|EDX81887.1| hypothetical protein BBAL3_3044 [Brevundimonas sp. BAL3]
          Length = 248

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 48/211 (22%), Positives = 97/211 (45%), Gaps = 3/211 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           +   +  S   + K     +  +  +++++ L  A+ ++ +D  +  K     E + + +
Sbjct: 7   QVEEELRSD--RYKRLARTWLPVVGVILVVALVAALGWWGWDSLNSSKAAKGAEAYDRGM 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E   + K  +AR +FE+ + + N  Y  L+    A + V      +A  +F + A     
Sbjct: 65  EALRAEKPAEARLAFEETVKEGNDAYKVLALQQQAGLAVTADKIPDAVRLFDQAAKTSSD 124

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +   A  +AA +++DT+   +I   L  L+E   P+H FA E L ++ L+ GK ++A
Sbjct: 125 P-ILSDPAAFKAALLIMDTAPLADIEARLTPLAEDKRPLHAFAQEALALARLQHGKTKEA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           +  F  L    + P  +  R+ + +A I A 
Sbjct: 184 REAFVLLQLGQDVPDDVRQRANIAVATIDAG 214


>gi|114328957|ref|YP_746114.1| hypothetical protein GbCGDNIH1_2293 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317131|gb|ABI63191.1| hypothetical membrane associated protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 227

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 52/216 (24%), Positives = 92/216 (42%), Gaps = 14/216 (6%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG------- 54
           E   D  + + K  + +        L++L+IL  A W       H +             
Sbjct: 12  EVEEDLRAERAKKLLVRYG-GPAVGLVLLVILGAAGWQGWLWYKHRQDATAAERFLALTR 70

Query: 55  ---ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEI 111
              +  A  + +    K + A ++F K      + Y  L+ +  A++L A G+ K A  I
Sbjct: 71  NPVDPLAPPVHIVPDAKTEQALTAFAK---DSPENYATLARLRAAALLTAGGNKKGAEAI 127

Query: 112 FLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGIS 171
           +  V+ND+ A  A+R  ATLQ+    +D      +   L  L    NP   FA E   + 
Sbjct: 128 YGTVSNDNAALPALRDLATLQSVWNRIDDGDPATLRGQLAPLLADGNPWQPFAREGTALL 187

Query: 172 ALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
            ++ G++  A+   + L++D N+P G+  R+  +LA
Sbjct: 188 DIRQGRMDDARRGLQTLSQDENAPPGVRNRATGLLA 223


>gi|149186033|ref|ZP_01864348.1| hypothetical protein ED21_24906 [Erythrobacter sp. SD-21]
 gi|148830594|gb|EDL49030.1| hypothetical protein ED21_24906 [Erythrobacter sp. SD-21]
          Length = 259

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 44/190 (23%), Positives = 91/190 (47%), Gaps = 5/190 (2%)

Query: 28  LILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLY 87
           ++ + L+    +  +D   E      GE     L+   +  +D A    +    + +   
Sbjct: 53  VVALGLAAFGGYLYWDQQQESTMERSGEELVTILDQLEAGNIDTATGQLDGFDGEGSPAI 112

Query: 88  NPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEIS 147
           +  + +  A I   +G+T+ AA +F +VA+D+ AP A+R  A ++  +++ D    +E+ 
Sbjct: 113 S--AKLLRAGIAADEGETQKAATLFGEVADDENAPEALRNLALVRRTALMFDEMGPDEVI 170

Query: 148 KILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI-L 206
             ++ L+ P  P    A E++  + L   K  +A  +F E+A+D N+P     R++M+ +
Sbjct: 171 AAMKPLAVPGEPFFTSAGELVAHAYLAQDKRAEAGALFAEIARDENTPE--VARARMLNM 228

Query: 207 ANIIASDQRN 216
           A I+  D  +
Sbjct: 229 AGILGVDAVD 238


>gi|94495670|ref|ZP_01302250.1| hypothetical protein SKA58_06460 [Sphingomonas sp. SKA58]
 gi|94425058|gb|EAT10079.1| hypothetical protein SKA58_06460 [Sphingomonas sp. SKA58]
          Length = 232

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/214 (19%), Positives = 83/214 (38%), Gaps = 4/214 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E ++     +      +   + +  +L++ + +   W Y      + +   V E     L
Sbjct: 14  EVDDAVRQDQLTTFWQRYG-RILIVVLVVGLAAFGGWLYWQHH-QKTQSEAVSEQMDTLL 71

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +        D       +       Y   + +  A +   KGD K A   +  +A DD  
Sbjct: 72  DTAVGGGTPD-PKQLAALTKASQPGYRASALLVQAGVAARKGDAKAAIAAYRAIAADDSL 130

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  A ++  S+  D+   E++   L+ L+    P    A E++ ++ +K GK   A
Sbjct: 131 DQPYRDLALIRQTSLEFDSLKPEQVVDRLKPLAVEGAPWFGSAGELVAVAYMKMGKNDLA 190

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
             +F  +AKD+  P  I +R++ + A ++  D  
Sbjct: 191 GPMFAAMAKDDKVPQSIRSRARQM-AGVMGIDAV 223


>gi|326386675|ref|ZP_08208297.1| hypothetical protein Y88_2569 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208990|gb|EGD59785.1| hypothetical protein Y88_2569 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 262

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 47/181 (25%), Positives = 87/181 (48%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
           A + I+++L+    +  +           GE  A AL+   + + D AR+S  +I +   
Sbjct: 63  AGMAIVLVLAGVGGWLAWTNHVATLTGQRGEQMAIALDQVEAGRYDAARTSLAQIAATGG 122

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             +   S +    I + +  + +AA+ F  VA D  AP   R  AT++  +   DT   +
Sbjct: 123 AGFRAASQLVTGGIALDQHKSADAAKAFGAVAADGSAPQVYRDLATVREVAAQFDTMQPQ 182

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
           ++   L+ L+ P NP    A E+LG++ +K GK  +A ++F  +AKD + P  +  R + 
Sbjct: 183 QVVDRLKPLAVPGNPWFGSAGEMLGVAYMKMGKNDQAASLFAAIAKDKSVPDSLRGRIRQ 242

Query: 205 I 205
           +
Sbjct: 243 L 243


>gi|144898967|emb|CAM75831.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 227

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 47/213 (22%), Positives = 92/213 (43%), Gaps = 2/213 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E ++D      +    K    +I    + ++L++A         H +        F +A 
Sbjct: 16  EVDDDLRQENLEKAWKKYGGLFIGG-AVAIVLAVAGAQAWQTWRHGQNLQ-ASLRFTEAS 73

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           ++ +         + + +++     Y  LS + +A + +A GD   AA ++ ++A D   
Sbjct: 74  QMLDKGDKAKGTEALQALVASGPSGYKLLSELKLAQVKLADGDAAAAAALYDRIAADGGV 133

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  A L++A I ++T     + K +  L+  S      A EIL + ALK G   KA
Sbjct: 134 DDIYRDMAVLKSAYIKLETGDIALVEKSVAPLAVESGAWRHSAREILALLALKAGDNAKA 193

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
             +  ++A D  +P GI  R+  +LA + ++ +
Sbjct: 194 MDLLRKVADDVAAPAGIRGRAAELLAALESAAK 226


>gi|16125898|ref|NP_420462.1| hypothetical protein CC_1652 [Caulobacter crescentus CB15]
 gi|221234661|ref|YP_002517097.1| hypothetical protein CCNA_01724 [Caulobacter crescentus NA1000]
 gi|13423058|gb|AAK23630.1| hypothetical protein CC_1652 [Caulobacter crescentus CB15]
 gi|220963833|gb|ACL95189.1| hypothetical membrane associated protein [Caulobacter crescentus
           NA1000]
          Length = 250

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/213 (21%), Positives = 93/213 (43%), Gaps = 5/213 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E      + + +  + K    W+A +    ++ +  ++           +   + +  AL
Sbjct: 7   EVEEQLRAERYRT-LAKKSLPWVAAVTAAAVIGVGGYWGWTSY-QTGLTDKASQAYQAAL 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +   +     A + F+ +   + K Y  L+ M + +I + +  T+ A   F + A    +
Sbjct: 65  QTAQTQGPAKAFAGFKAVADTNAKGYKSLALMQMGAIRLEEKKTQEAVGYFDEAAKVAPS 124

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P+ +   A L++A  L+DT+SY++I   L  L+   +P   +A E L  + L+ G +  A
Sbjct: 125 PM-IGDLARLKSAFALMDTASYKDIETRLTPLAGEKSPYRVYAKEALAFAKLQAGDLAGA 183

Query: 182 KTIFEELAK--DNNSPFGISTRSQMILANIIAS 212
           ++ F  LA   D N+   I  R+Q  +  I + 
Sbjct: 184 RSEFVILANSLDANTSEAIRQRAQAAMQLIDSG 216


>gi|83945264|ref|ZP_00957613.1| hypothetical protein OA2633_00815 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851434|gb|EAP89290.1| hypothetical protein OA2633_00815 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 253

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 97/206 (47%), Gaps = 3/206 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    + K    W+      ++L +  + ++ + S +++ +   E +  A 
Sbjct: 7   EVEEELRQERYNALLRKWG-PWVGGAAAAIVLGVGAYQFM-EWSSKQRADAASEQYQAAA 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           EL+ +  L  A S F+ ++    + Y  L+ M  A I +++GD + AA +F +       
Sbjct: 65  ELYEAGNLLQADSQFQALVESGPRGYETLALMRRAEIALSQGDAEEAARLFNRAGEISPE 124

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           PL +R  A  QAA    D  SY++++  L+ L+E + P+   A E++  +AL+  +  +A
Sbjct: 125 PL-IRDLARYQAALAQFDQLSYDDLANRLEPLTEGAAPVGLLARELMAAAALRDQRWDEA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILA 207
           +  ++ L+   + P  +S R     +
Sbjct: 184 RQRYQLLSVALDLPQAMSQRVMQAQS 209


>gi|170750286|ref|YP_001756546.1| hypothetical protein Mrad2831_3889 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656808|gb|ACB25863.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 236

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 50/211 (23%), Positives = 88/211 (41%), Gaps = 4/211 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    +      +     I  L +L++  +A W Y +         +    F  A 
Sbjct: 10  EVDEDYRRDRILQIWKRYS-GVIIALAVLVVAGVAGWRY-WQAQQRAAAEVASVRFDDAN 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L    K+ +A  +FE + +Q    Y  L+    A+    K D    A  F K+A+D   
Sbjct: 68  RLAKDGKVAEADKAFETLEAQGPAGYRLLARFRAAAE-TGKRDPAAGAAEFDKLADDTGL 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +R  A L+AA + +D  + +     LQ L+    P    A E+LG++ALK G  + A
Sbjct: 127 GDGLRDLARLRAALLRLDGPNPDPALANLQGLAA-GTPFRHTAREMLGLAALKKGDYEDA 185

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
              F+++  D ++P  +  R ++  A +   
Sbjct: 186 SRWFDQIVADPDTPRNLRERIEVYAAIVAGG 216


>gi|307946714|ref|ZP_07662049.1| putative TPR repeat-containing protein [Roseibium sp. TrichSKD4]
 gi|307770378|gb|EFO29604.1| putative TPR repeat-containing protein [Roseibium sp. TrichSKD4]
          Length = 227

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/208 (18%), Positives = 87/208 (41%), Gaps = 3/208 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    K +    +  +     ++ ++I+     +  +    E +    G+ F  A+
Sbjct: 7   EVDEDIRQEKYRRLWDR--FGPWVIVVAVLIVVGTGGYRGWQYWQETQAQEAGDKFMAAV 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           EL  S  ++ A  + + +       Y  L+ + +A+  +       A E F + + D   
Sbjct: 65  ELSESANIEGAIEALDALGEAG-GGYPQLAKLRVATEHIKADRKIEALEAFDQASRDPSV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             +++  A L+A  + VD   Y  ++  ++ L+  ++P    A E+L ++A K G  + A
Sbjct: 124 EASLQSIAALRAGYLAVDLEDYAGVADRVEGLTGEADPFRAAARELLALAAWKAGNAEDA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANI 209
           +     +  D  +P  +S R  ++   I
Sbjct: 184 RKWVSAIENDTETPAEVSRRVGILSEVI 211


>gi|163853440|ref|YP_001641483.1| hypothetical protein Mext_4042 [Methylobacterium extorquens PA1]
 gi|163665045|gb|ABY32412.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 236

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 47/211 (22%), Positives = 86/211 (40%), Gaps = 3/211 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    +      +     I  L +L++  +  + Y        +       F +A 
Sbjct: 10  EVDEDYRRDQIANIWKRYN-ALIITLAVLLVAGVGGYNYWRHA-ERTRAEAASVRFDKAN 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L    K ++A   F  I +     Y  L+   +A+    +     A     K+A D   
Sbjct: 68  RLAKDGKAEEADRDFAAIQADGPGGYALLARFRLAAEATKRDAAAGADAY-DKLAADTGI 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A+R  A L+AA + +D +        LQ L+ P+N     A E+LG++ALK G ++ A
Sbjct: 127 GDALRDLARLRAALLRLDGTDPNAALTSLQGLAAPTNAFRHTAREMLGLTALKRGDIEGA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
              F++++ D  +P G+  R ++  A +   
Sbjct: 187 GRWFDQISTDGETPQGLRQRVEIYQALVAGG 217


>gi|307294127|ref|ZP_07573971.1| Protein of unknown function DUF2133 [Sphingobium chlorophenolicum
           L-1]
 gi|306880278|gb|EFN11495.1| Protein of unknown function DUF2133 [Sphingobium chlorophenolicum
           L-1]
          Length = 232

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/214 (18%), Positives = 86/214 (40%), Gaps = 4/214 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E +      +      +   +WI  L++  +L    + Y +    + +   V E   + +
Sbjct: 14  EVDEAVRQDQLLTFWQRFG-RWIVALVVGGLLLFGAFLY-WQHYTKTQSQAVSEEMDKVI 71

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                    DA+   +K+       +   + +  A     KGD+K A   +  +A+D   
Sbjct: 72  STAVGGGTPDAKE-LDKLTQASQPGFRASALLVKAGTAARKGDSKAAIAAYKAMADDASL 130

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  A ++  ++  ++   +++   L+ L+    P    A E++ I+ +K  K   A
Sbjct: 131 DQPYRDLALIRQTTLEYESLQPQQVVDRLKPLAVEGAPWFGSAGELVAIAYMKMRKPDLA 190

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
             +F  +AKD N P  I +R++ + A ++  D  
Sbjct: 191 GPLFAAMAKDKNVPQSIRSRARQM-AGLLGVDAV 223


>gi|294012483|ref|YP_003545943.1| hypothetical protein SJA_C1-24970 [Sphingobium japonicum UT26S]
 gi|292675813|dbj|BAI97331.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 232

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/214 (18%), Positives = 87/214 (40%), Gaps = 4/214 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E +      +      +   +WI   +I+ + + A W Y +    + +   V E   + +
Sbjct: 14  EVDEAVRQDQLLTFWQRFG-RWIVAAVIIGLAAFAGWLY-WQHYTKTQSQAVSEEMDKVI 71

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                    +A+   +K+       +   + +  A     KGD+K A   +  +A+D   
Sbjct: 72  ATAVGGGTPEAKE-LDKLTQASQPGFRASALLVKAGTAARKGDSKAAIAAYKAMADDASL 130

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  A ++  ++  +T   +++   L+ L+    P    A E++ I+ +K  K   A
Sbjct: 131 DRPYRDLALIRQTTLEFETLQPQQVVDRLKPLAVEGAPWFGSAGELVAIAYMKMRKPDLA 190

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
             +F  +AKD + P  I +R++ + A ++  D  
Sbjct: 191 GPLFAAMAKDKDVPQSIRSRARQM-AGLLGVDAV 223


>gi|258542807|ref|YP_003188240.1| hypothetical protein APA01_17320 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633885|dbj|BAH99860.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636944|dbj|BAI02913.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639997|dbj|BAI05959.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256643053|dbj|BAI09008.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256646108|dbj|BAI12056.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256649161|dbj|BAI15102.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256652148|dbj|BAI18082.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655205|dbj|BAI21132.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 231

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/222 (19%), Positives = 83/222 (37%), Gaps = 15/222 (6%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +  + + +    +     I   LI+ +L+    +     S + +       +  AL
Sbjct: 8   EVDEEMQAERLRMAAKRYAGAGIG--LIVAVLAGIGAWSWHVSSQKSQALEATGTYLTAL 65

Query: 62  ELFN-------------SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNA 108
              +             +       +S +K+ S D K    L+ +    +  A+GD K A
Sbjct: 66  RQTDHLPSTPSSGTVDLTTTAQAGLASLQKLASSDAKGVAVLARLQEGGVQAARGDVKGA 125

Query: 109 AEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL 168
              +  V  D  A  A+R  ATL      +DT     +   L  L+    P +  A E L
Sbjct: 126 LAAWDAVQKDPNADSALRDLATLLWCQKQLDTGEPATLRSRLALLTGKGKPWNGLAMEAL 185

Query: 169 GISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
            +  ++ G V +A+  F  L    + P G+  R+Q ++  + 
Sbjct: 186 AVLDVREGHVAEARQKFAALQAAQDVPQGVRNRAQDMMQALD 227


>gi|209964705|ref|YP_002297620.1| hypothetical protein RC1_1403 [Rhodospirillum centenum SW]
 gi|209958171|gb|ACI98807.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 219

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/203 (20%), Positives = 83/203 (40%), Gaps = 8/203 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMIL-------SLAIWFYLFDGSHEKKKNIVGENFAQALE 62
              + +     ++   P+LI   +           W       ++++   +G   AQAL 
Sbjct: 10  EDLRRERAANLWRRFGPVLITAAVLTVAATAGYVAWQRWQSARNQEQTAELGRALAQALP 69

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
              S    +A        ++ +  +  L+  Y A +   +GD + A  ++ ++A  +  P
Sbjct: 70  AGASAPATNAADLLAGAAARTDGAHAALARFYEAGLRARQGDREGAVALYDQLAGTEADP 129

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  A L A    VD+   +++   L  L    NP +  A E+ G+ + + G   +A+
Sbjct: 130 -VFRDLAQLLAVLHQVDSGDPKQLLSRLTPLMGSDNPWNWSARELAGLLSARDGDTARAR 188

Query: 183 TIFEELAKDNNSPFGISTRSQMI 205
            +F +LA D  +P G+  R+  +
Sbjct: 189 ELFSQLADDPQTPAGVRARATEL 211


>gi|240140860|ref|YP_002965340.1| hypothetical protein MexAM1_META1p4432 [Methylobacterium extorquens
           AM1]
 gi|254563369|ref|YP_003070464.1| hypothetical protein METDI5036 [Methylobacterium extorquens DM4]
 gi|240010837|gb|ACS42063.1| hypothetical protein MexAM1_META1p4432 [Methylobacterium extorquens
           AM1]
 gi|254270647|emb|CAX26651.1| hypothetical protein METDI5036 [Methylobacterium extorquens DM4]
          Length = 236

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 47/211 (22%), Positives = 86/211 (40%), Gaps = 3/211 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    +      +     I  L +L++  +  + Y        +       F +A 
Sbjct: 10  EVDEDYRRDQIANIWKRYN-ALIITLAVLLVAGVGGYNYWRHA-ERTRAEAASVRFDKAN 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L    K ++A   F  I +     Y  L+   +A+    +     A     K+A D   
Sbjct: 68  RLAKDGKAEEADRDFAAIQADGPGGYALLARFRLAAEATKRDAAAGADAY-DKLAADTGI 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A+R  A L+AA + +D +        LQ L+ P+N     A E+LG++ALK G ++ A
Sbjct: 127 GDALRDLARLRAALLRLDGTDPNAALTSLQGLAAPTNAFRHTAREMLGLTALKRGDIEGA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
              F++++ D  +P G+  R ++  A +   
Sbjct: 187 GRWFDQISADGETPQGLRQRVEIYQALVAGG 217


>gi|218532300|ref|YP_002423116.1| hypothetical protein Mchl_4412 [Methylobacterium chloromethanicum
           CM4]
 gi|218524603|gb|ACK85188.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 236

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 48/211 (22%), Positives = 86/211 (40%), Gaps = 3/211 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    +      +     I  L +L++  +  + Y        +       F QA 
Sbjct: 10  EVDEDYRRDQIANIWKRYN-ALIITLAVLLVAGVGGYNYWRHA-ERTRAEAASVRFDQAN 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L    K ++A   F  I +     Y  L+   +A+    +     A     K+A D   
Sbjct: 68  RLAKDGKAEEADRDFAAIQADGPGGYALLARFRLAAEATKRDAAAGADAY-DKLAADTGI 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A+R  A L+AA + +D +        LQ L+ P+N     A E+LG++ALK G ++ A
Sbjct: 127 GDALRDLARLRAALLRLDGTDPNAALTSLQGLAAPTNAFRHTAREMLGLTALKRGDIEGA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
              F++++ D  +P G+  R ++  A +   
Sbjct: 187 GRWFDQISADGETPQGLRQRVEIYQALVAGG 217


>gi|85373405|ref|YP_457467.1| hypothetical protein ELI_02890 [Erythrobacter litoralis HTCC2594]
 gi|84786488|gb|ABC62670.1| hypothetical protein ELI_02890 [Erythrobacter litoralis HTCC2594]
          Length = 270

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 45/180 (25%), Positives = 83/180 (46%), Gaps = 1/180 (0%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
           +    +  +DG  E       E    AL+   +  L     + E + + DN      + M
Sbjct: 64  AAFGGYLWWDGQREAALEQDSEVLVSALDQIEAGNLQTGTETLEPLTTSDNAGAQAAALM 123

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
             A I   +GD   AA +F +VAN+  AP A R  AT++  ++  D     E+ + L  +
Sbjct: 124 LQAGIAAQQGDLARAATLFGQVANNSDAPPAYRDLATVRQVALQFDRLEPAEVIQRLSAI 183

Query: 154 SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           + P N     A E++ ++ L+ G    A  +F E+AK +++P  + +R++ + A ++  D
Sbjct: 184 AVPDNAFFGSAGELVAMAHLEKGDRAAAGKLFGEIAKSDDAPQSLRSRARQM-AGMLGVD 242


>gi|182679274|ref|YP_001833420.1| hypothetical protein Bind_2318 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635157|gb|ACB95931.1| conserved hypothetical protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 254

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 42/216 (19%), Positives = 87/216 (40%), Gaps = 3/216 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    +    +G+  ++++   +IL+IL+ A+ + +       +   +G  +  A+
Sbjct: 7   EVDEDVRRERILQFLGR--FRFLIGGVILLILAGAVGWRITVSHRLAEAEAMGARYQAAI 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +L    +   A ++ + +  +  + Y  L+ +  A       D   AA  +  +A D   
Sbjct: 65  DLAQQGEGAQALAALKTLSEEAPQGYATLARLR-AIDETVASDPVAAAGAYAALAEDSRY 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A L+A  + VD    +        L++        A E+L ++ALK      A
Sbjct: 124 PAIFRDLAHLRALYLQVDQLDPKVFEDKAAALAKSDFAFRNSARELLALAALKRKDFDAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
               +E+  D  +P  +  R++  L  + A     K
Sbjct: 184 GHWLDEIVVDPAAPASMRQRAEAFLGLVQAGKPAYK 219


>gi|217976949|ref|YP_002361096.1| hypothetical protein Msil_0763 [Methylocella silvestris BL2]
 gi|217502325|gb|ACK49734.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 328

 Score =  124 bits (312), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 43/211 (20%), Positives = 84/211 (39%), Gaps = 3/211 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    +      K    W     +L++ + A W  ++   H +     G  +  AL
Sbjct: 7   EVDEDYRRERLAKIWTKY-QGWFIGAAVLLVAATAGW-RIYQHFHLQAAEAAGARYEAAL 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L    K  +A + F++I +   K Y  L+++     +V + D   A   +  +  D   
Sbjct: 65  RLSQDGKSAEAEAEFKEIAASGPKGYATLAHLRAVDEIVGR-DPAAAIAAYDALGADPTF 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             + + AA  +AA + VD    +   +    L++PS   H    E+L ++A K    + A
Sbjct: 124 DQSFKEAAQTRAAVLRVDRDDPKAFEEKYGALAQPSFTYHDTIRELLALAAFKREDFEAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
               + +  D  +P  +  R++  L  + A 
Sbjct: 184 GRWLDMIVGDPRAPGPLRQRAEAFLGLVQAG 214


>gi|254440175|ref|ZP_05053669.1| hypothetical protein OA307_5045 [Octadecabacter antarcticus 307]
 gi|198255621|gb|EDY79935.1| hypothetical protein OA307_5045 [Octadecabacter antarcticus 307]
          Length = 229

 Score =  124 bits (312), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 52/205 (25%), Positives = 82/205 (40%), Gaps = 7/205 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    K    M K  Y WIA L++LMI+    +        E     VG+    AL
Sbjct: 10  EVTEEVRKDKLLGYMRK--YGWIAVLVVLMIVGGTAFSEFRKAQSEGAAQAVGDEILVAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E+ +      A  + + I          ++ +  A+ L    D   AA     VA D   
Sbjct: 68  EIDDDQGRAAALQAIDVI-----GPAAAVTGLLTAANLTEIDDISGAAGALDAVALDADI 122

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A L++  I  DT S E+   +L  L+    P    A E L + +++ G +  A
Sbjct: 123 PQVYRDLAALKSVMIKGDTLSIEDRRTMLADLAVAGAPFRVVAQEQLALISVEAGDIDTA 182

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
            T F  LA+D  +  G+  R+  ++
Sbjct: 183 VTQFAALAQDAEATRGLRERAFSMI 207


>gi|188583712|ref|YP_001927157.1| hypothetical protein Mpop_4524 [Methylobacterium populi BJ001]
 gi|179347210|gb|ACB82622.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 237

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 47/211 (22%), Positives = 89/211 (42%), Gaps = 3/211 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    +      +     I    IL++  +  + Y        +     E F +A 
Sbjct: 10  EVDEDYRRDQIAKIWKRYNALIITG-AILLVAGVGGYNYWRHA-ERTRAEAASEQFDRAN 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L    K ++A   F  I ++    Y  L+   +A+    +      A+ +  +AND   
Sbjct: 68  RLAKDGKAEEADRDFAAIRAEAPGGYALLARFRLAAEAAKRD-AAAGAQAYDGLANDTGI 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             ++R  A L+AA + +D +        LQ L+ P+N     A E+LG++ALK G ++ A
Sbjct: 127 GDSLRDLARLRAALLRLDGTDPNPALTSLQGLAAPTNAFRHTAREMLGLTALKRGDIEGA 186

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
              F++++ D  +P G+  R ++  A +   
Sbjct: 187 GRWFDQISADAETPQGLRQRVEVYEALVAGG 217


>gi|167646458|ref|YP_001684121.1| TPR repeat-containing protein [Caulobacter sp. K31]
 gi|167348888|gb|ABZ71623.1| Tetratricopeptide TPR_2 repeat protein [Caulobacter sp. K31]
          Length = 254

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 49/212 (23%), Positives = 81/212 (38%), Gaps = 4/212 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E      S + K    K    W+  L  + IL  A W         +  N   E +  AL
Sbjct: 7   EVEEQLRSDRYKSLALKSL-PWVGALAAVAILGTAGWAGWSSYQQNQT-NKASEAYQAAL 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                     +  +FE I       Y  L+ + + +I +    T +A   F + A     
Sbjct: 65  VSAGKIGPAGSFPAFEAISKDGPPAYKTLALLQMGAIRLEADKTADAVAYFDQAAKLAPN 124

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  +   A L +A  L+DT+ Y+++   L  L    +P    A E L  + L+ G +  A
Sbjct: 125 P-VLGDLARLNSALALLDTAPYKDVEARLTPLMGEKSPYRVQAKEALAFAKLRAGDLAGA 183

Query: 182 KTIFEELAKD-NNSPFGISTRSQMILANIIAS 212
           +  F  L+   +NS   +  R+Q  +A I + 
Sbjct: 184 RGDFSVLSTALDNSSEEVRQRAQGAIAMIDSG 215


>gi|300022383|ref|YP_003754994.1| hypothetical protein Hden_0856 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299524204|gb|ADJ22673.1| Protein of unknown function DUF2133 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 264

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 47/212 (22%), Positives = 97/212 (45%), Gaps = 2/212 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +      +  Y  +       ++     +  F+      +   G +++ A 
Sbjct: 11  EVEQEIRREQMAKLWQR--YSGLIVAAAAFLVLAVAGYKFFESRRIVAEQAAGADYSAAE 68

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L ++ K ++A ++F+KI  +    Y  L+ + +A+ L+  G T +A   +  +A +  A
Sbjct: 69  TLSDNKKKEEAEAAFKKIAEEGPAGYGSLARLQLAAALLKDGKTADAIATYEALAKESGA 128

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              ++  A LQAAS+ +  + Y EI   L  ++    P  + A E+LG++A K GK  +A
Sbjct: 129 DNLLKSFAQLQAASLRMPDADYAEIQNRLTPIAGDDAPFSKSARELLGVAAYKAGKFDEA 188

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           +   E L  D N    +  R +++++ I A++
Sbjct: 189 RKYLEPLLIDPNVSEALQERVKILMSGIAAAE 220


>gi|315499683|ref|YP_004088486.1| hypothetical protein Astex_2696 [Asticcacaulis excentricus CB 48]
 gi|315417695|gb|ADU14335.1| hypothetical protein Astex_2696 [Asticcacaulis excentricus CB 48]
          Length = 243

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/212 (21%), Positives = 90/212 (42%), Gaps = 3/212 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E+       +      K        L + +I +L  W Y        + +   E +  A 
Sbjct: 7   EAEEGLRQDRWAAIAKKSAPFVGGALAVALIGALGFWGYT--SWDASRVSKASEAYVAAQ 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E    N    A++ F+K++      Y  L+   +A + V    T  A ++  + +     
Sbjct: 65  EALTKNDKAAAKADFQKVVDAGAPGYKALALSQLAGLAVEDNKTDEAVKLLEEASKTSSD 124

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           PL +   ATL+A  +++D +S+E++ K L  L++   P    A E L ++ ++ G +Q A
Sbjct: 125 PL-IADLATLKATFLIMDKASFEDVEKRLTPLTKEGRPYAPLAKEALAMAKIQKGDIQGA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           +   + LA   ++   +  R+QM +A I +  
Sbjct: 184 RGDLQALAFSLDASDPLKQRAQMAVALIDSGG 215


>gi|295689709|ref|YP_003593402.1| hypothetical protein Cseg_2324 [Caulobacter segnis ATCC 21756]
 gi|295431612|gb|ADG10784.1| Protein of unknown function DUF2133 [Caulobacter segnis ATCC 21756]
          Length = 249

 Score =  121 bits (303), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 40/175 (22%), Positives = 75/175 (42%), Gaps = 2/175 (1%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           ++ +      + +   E +  ALE   +     A   F+ +     + Y  L+ + +  I
Sbjct: 42  YWGWKSYQTSQADRASEAYQAALETAQTAGPAKAFGQFKAVADGGARGYKALALLQMGDI 101

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            + +  TK A   F + A        +   A L++A  L+DT+SY++I   L  L+   +
Sbjct: 102 RIEENKTKEAVAYFDEAAKAAP-DAILGDLARLKSAFALMDTASYKDIESRLTPLAGEKS 160

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKD-NNSPFGISTRSQMILANIIAS 212
           P   +A E L  + L+ G V  A+  F  LA   +N+   +  R+Q  +  I + 
Sbjct: 161 PYRVYAKEALAFAKLQAGDVAGARGDFVVLANSLDNTSEEVRQRAQAAMQLIDSG 215


>gi|302383645|ref|YP_003819468.1| hypothetical protein Bresu_2537 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194273|gb|ADL01845.1| Protein of unknown function DUF2133 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 267

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/201 (22%), Positives = 87/201 (43%), Gaps = 4/201 (1%)

Query: 15  KMGKCCYKWIAPL--LILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDA 72
           ++ +    W+  +  ++ + L  A+ ++ +      + N     + + +E   S     A
Sbjct: 16  RLKRLARTWLPVVGGILAVALVAALAWWGWQSFQTSQANKASVAYQRGIESLQSGDTTAA 75

Query: 73  RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQ 132
            S+F +     N  Y  L+    A + V      +A ++F   A  D  P+ +   A  +
Sbjct: 76  ESAFAEAEKAGNGAYKALALQQRAGLAVQANRIPDAIKLFDDAAKADSDPM-LADPARYK 134

Query: 133 AASILVDT-SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           AA +L+D   +  ++   L  L+E   PM  FA E LG++ L+F K  +A+  F  L   
Sbjct: 135 AALLLMDNGGTLADLEARLLPLTEDDRPMRPFAQEALGLTRLQFNKPAEAREQFVLLTLG 194

Query: 192 NNSPFGISTRSQMILANIIAS 212
            + P  +  R+Q  ++ I A 
Sbjct: 195 QDVPESVRQRAQAAISMIDAG 215


>gi|254451631|ref|ZP_05065068.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198266037|gb|EDY90307.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 229

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/205 (23%), Positives = 81/205 (39%), Gaps = 7/205 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    K    M K  Y WIA L +L+I+    +              VG+    AL
Sbjct: 10  EVTEEVRKDKLFGYMRK--YGWIAVLAVLLIVGGTAYSEFRKAQTTGAAQAVGDEILAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E+ +        ++ + I          ++ +  A+ L    D   A      VA D  A
Sbjct: 68  EIDDDEGRA---AALQAIDVSGPAA--AITGLLTAANLTETDDIAGAVGALEAVALDADA 122

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A L++  +  DT S E+   +L  L+    P    A E L + +++ G ++ A
Sbjct: 123 PQVYRDLAVLKSVMVQGDTLSIEDRRALLAGLAMAGGPFRVLAQEQLALISVEAGDIETA 182

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
            T F  LA+D  +  G+  R+  ++
Sbjct: 183 VTQFVALAQDAEATRGLRERAFSMI 207


>gi|329850800|ref|ZP_08265645.1| TPR repeat-containing protein [Asticcacaulis biprosthecum C19]
 gi|328841115|gb|EGF90686.1| TPR repeat-containing protein [Asticcacaulis biprosthecum C19]
          Length = 246

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/172 (25%), Positives = 75/172 (43%), Gaps = 1/172 (0%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           F+ F    +K+     E F   +E         A++SFE+     N  Y  +S M +A +
Sbjct: 42  FWGFTTWQDKEVAKASEVFQAGIEAAAKGDSTAAKASFEQTAKGSNSTYKAMSLMQLAGL 101

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
               G T  A ++F   A     P      A L+AA +++D   + +  K L  L++   
Sbjct: 102 AHRDGKTDEAIKLFDDAAKASSDPRV-ADLAALKAAYLVMDKGVFADSQKRLTPLTDAKR 160

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
           P    A E L ++ L+ G    A+     L+ + ++P G+  R+Q ++A I 
Sbjct: 161 PYTFLAKEALAMAKLQNGDAAGARADLNALSFELDAPEGVKQRAQRVVAAID 212


>gi|323138583|ref|ZP_08073651.1| Protein of unknown function DUF2133 [Methylocystis sp. ATCC 49242]
 gi|322396217|gb|EFX98750.1| Protein of unknown function DUF2133 [Methylocystis sp. ATCC 49242]
          Length = 254

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 44/210 (20%), Positives = 81/210 (38%), Gaps = 5/210 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    K      +     I  +  L++ +   W Y  D    K        F  A+
Sbjct: 7   EVDEDVRRDKAADFWRRY-QTPIFVVAFLIVAATGAWSYYQDKRQ-KTAEAANARFEAAV 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L N  K  +A ++F+ I     K Y  L+ +  A    A+ D   A      +  D   
Sbjct: 65  ALANEGKNAEAAAAFDAIAKDGPKGYAALARIRAAE---ARPDKTQALAELNAIGEDPTV 121

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              ++  A L+AA ++++    E++ + L  L   +      A E  G+ AL      +A
Sbjct: 122 DKLMQEVALLRAALLVMEGGDREKLERALGPLMTSNGAFRFSAQEWNGLDALANDDFDEA 181

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIA 211
           + +FE++  D ++P  +  R+      + A
Sbjct: 182 ERVFEQVLADRDAPQSMRQRASAYKGLLHA 211


>gi|148556029|ref|YP_001263611.1| hypothetical protein Swit_3124 [Sphingomonas wittichii RW1]
 gi|148501219|gb|ABQ69473.1| Uncharacterized protein [Sphingomonas wittichii RW1]
          Length = 235

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/182 (19%), Positives = 84/182 (46%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y  IA + +L++L     F  +  + EKK    GE  +  +    +++  +A    + ++
Sbjct: 31  YGRIALVALLLLLVAFAGFLYWRQASEKKAEAQGEQMSALIADVQASRKAEAAKKIDTLV 90

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
           ++    Y   + +  A++   +GDTK+A  I+  +A D+ A    R  + ++   +  D 
Sbjct: 91  AEGGDGYRIAALLTKATLAADRGDTKSAIGIYAGIAADEKAAQPYRDVSLIRQTLLEYDG 150

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
            + +++   L+ L+   N     A E+  ++ ++  +  +A  +   +A+D   P  + T
Sbjct: 151 LTPQQVIDRLKPLAVEGNAFFGTAGEMTAVAMIQANRGAEAGRLLAAVARDKTVPDTLRT 210

Query: 201 RS 202
           R+
Sbjct: 211 RA 212


>gi|197104997|ref|YP_002130374.1| hypothetical protein PHZ_c1534 [Phenylobacterium zucineum HLK1]
 gi|196478417|gb|ACG77945.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 256

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/211 (18%), Positives = 90/211 (42%), Gaps = 3/211 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E      S + +  + +    WI   + L+++++  ++  +D    ++     E +  A 
Sbjct: 7   EVEEQLRSDRYRS-LARRTLPWILAAVALVLVAVLAYW-GWDTWRSREVAKASEQYQAAG 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E   +     A+  + ++       Y  L+ M + ++ + +  T  A ++F + A+    
Sbjct: 65  EALAAGDRAKAQQLWTEVSQSSAGGYKSLALMQLGALNLDENKTDEAVKLFDQAASAAP- 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +  AA L++A  ++DT+ Y+++   L  L +   P    A E L  + L  G    A
Sbjct: 124 DELIGDAARLKSAFAVLDTAPYKDVEARLTPLIKDGRPYRVQAREALAFAKLMAGDTAGA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           +  F  L +  ++  G+  R+Q  ++ I + 
Sbjct: 184 RGDFVVLQQMLDASDGVRARAQAAISLIDSG 214


>gi|162149031|ref|YP_001603492.1| hypothetical protein GDI_3261 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545220|ref|YP_002277449.1| hypothetical protein Gdia_3104 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787608|emb|CAP57204.1| conserved protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532897|gb|ACI52834.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 229

 Score =  111 bits (278), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/223 (18%), Positives = 87/223 (39%), Gaps = 15/223 (6%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E ++D  + + +    +     +A + +         ++ + G    +       +  AL
Sbjct: 8   EVDDDLRAERLRALARRYVAAAVAVVAVAGAGVGGWQYHAWRGRQADRAWAA--TYFTAL 65

Query: 62  ELFNSNKL------------DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAA 109
              +S+++             DA   F  +          L+ +  A++L + GDT+ A 
Sbjct: 66  HAADSSQIVPGETARLTPQQQDALKRFATL-DTAPPGLRTLARLERAALLASSGDTRGAL 124

Query: 110 EIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILG 169
            ++ +VA+D  A   +R  A+L      +D      +   L  L     P    A E   
Sbjct: 125 SLWTQVADDGAADPQLRSLASLLWVQRQIDDGDPATLRSRLTTLDGVGKPWRALAIECEA 184

Query: 170 ISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           +  L+ G+   A+  F +L+ + + P G+ +R+  +L  + AS
Sbjct: 185 MLDLRQGRTADARRRFAQLSAEADVPDGLRSRAGGLLQTLNAS 227


>gi|296532291|ref|ZP_06895030.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296267367|gb|EFH13253.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 216

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/209 (21%), Positives = 81/209 (38%), Gaps = 2/209 (0%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +  + + +    +      A L +L++  L  W         +          Q  
Sbjct: 7   EVQEELRAERARRMALRYGGLV-AGLALLVLAGLGGWQGWRWYQQREATQSAAIFLEQHR 65

Query: 62  ELFNSNKLDDARS-SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                     A    F  + S   + Y  LS +  A++    GD   A  ++ +++ D+ 
Sbjct: 66  AAEAQGADLRAIGDRFAGLASSGPEGYRILSALRAAALKAETGDRDGALALWNQLSADNA 125

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           AP   R  A+L  A   +D+    ++S  L  L+   +     A E+ G+ AL+ G    
Sbjct: 126 APRIYRDLASLMWALHGIDSQDPAQLSARLGPLAAEGSAWRASARELQGLLALRQGDKAT 185

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  F+ LA+D  +P G+  R+  + A +
Sbjct: 186 AKREFDALAQDVTAPQGLRERAGRLAAGL 214



 Score = 38.0 bits (87), Expect = 1.0,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 39/106 (36%), Gaps = 1/106 (0%)

Query: 33  LSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSN 92
            +LA+W  L   +   +      +   AL   +S       +    + ++ +  +   + 
Sbjct: 112 GALALWNQLSADNAAPRIYRDLASLMWALHGIDSQDPAQLSARLGPLAAEGS-AWRASAR 170

Query: 93  MYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV 138
                + + +GD   A   F  +A D  AP  +R  A   AA + V
Sbjct: 171 ELQGLLALRQGDKATAKREFDALAQDVTAPQGLRERAGRLAAGLGV 216


>gi|126732582|ref|ZP_01748379.1| hypothetical protein SSE37_25043 [Sagittula stellata E-37]
 gi|126706866|gb|EBA05935.1| hypothetical protein SSE37_25043 [Sagittula stellata E-37]
          Length = 218

 Score =  108 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 44/211 (20%), Positives = 82/211 (38%), Gaps = 6/211 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    M +  Y WIA L++L+++    W      S E      G++   A+
Sbjct: 10  EVTEEVKRDRLFAMMKR--YGWIAVLIVLLLVGGTAWREYQISSRETAAQAFGDSVLDAM 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           ++   N      ++ E + S        +  M  A    + G+T  A      VA D   
Sbjct: 68  DV---NDAAAKAAALEDLSSDTPSA-RAVLEMLTADAEQSSGETPAAVARLQGVAADTAV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A+ +A  +  D    EE    L+ L+ P  P+   A E L +  ++ G+ + A
Sbjct: 124 PNIYRQIASYKAMMLGFDVLPVEERRAGLEALAVPGQPLRLLAEEQLALVEIEVGEREAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
            T  + +  D+    G+  R+  ++  +   
Sbjct: 184 LTRLQAMLDDSEITAGLRRRASQLIVALGGE 214


>gi|288958552|ref|YP_003448893.1| hypothetical protein AZL_017110 [Azospirillum sp. B510]
 gi|288910860|dbj|BAI72349.1| hypothetical protein AZL_017110 [Azospirillum sp. B510]
          Length = 214

 Score =  108 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/207 (16%), Positives = 82/207 (39%), Gaps = 3/207 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    + +    +     IA    +++++    +  +     +K+         A+
Sbjct: 7   EVDEDLRRDRAEHLFKRYGGAMIAAA--VLVVAGTAGYSFWRNWQAQKRQEQTVALVTAI 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                   +    +        +     L+    A++L+ +G   +AA ++  +A     
Sbjct: 65  SQSGQG-PEKGIEALAAFAGSADPSLAALAQFNAAALLIRQGKPADAATVYDGIAGHGSV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P+  R  ATL A           +++  L  L+  ++P    A E+  + A + G  +KA
Sbjct: 124 PVEYRDLATLLAVMQRAGDGDAAQLTAKLLPLTAETSPWRFTARELTAMLAARSGDTEKA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILAN 208
           +T++++LA D  +P G+  R+  + + 
Sbjct: 184 RTLYKQLADDQLAPSGVRGRAADLASL 210


>gi|296116362|ref|ZP_06834977.1| hypothetical protein GXY_11204 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977062|gb|EFG83825.1| hypothetical protein GXY_11204 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 220

 Score =  107 bits (268), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 73/215 (33%), Gaps = 14/215 (6%)

Query: 7   ANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNS 66
             + + +    +     +A ++++ I      +        +      + +  AL+   +
Sbjct: 1   MRAERLRALARRYMM--LAGVIVVAICIGGGAWQYNAWRVHQADQASADAYFAALKNATT 58

Query: 67  NKLDD------------ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
               D            A      +          LS M  A++LV  GDT  A  ++ +
Sbjct: 59  AHSPDGQPAPLNAQQKTALEQLATLEKTARPPLRALSRMERAALLVNSGDTARALALWAQ 118

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALK 174
           V  D  A   +   A L      +DT+    +   L  L     P    A E   +  L+
Sbjct: 119 VNADQGADPTISSLAGLLWVQHQIDTADPAMLRSRLALLDGAQQPWRGLALECEALLDLR 178

Query: 175 FGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
            G   +A+   E L+ D N   G+ TR+  +L  +
Sbjct: 179 QGHDDEARRRLERLSMDMNVSDGVRTRADGLLQTL 213


>gi|296446240|ref|ZP_06888187.1| Protein of unknown function DUF2133 [Methylosinus trichosporium
           OB3b]
 gi|296256277|gb|EFH03357.1| Protein of unknown function DUF2133 [Methylosinus trichosporium
           OB3b]
          Length = 241

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/211 (20%), Positives = 86/211 (40%), Gaps = 3/211 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D    +      +     +     L++   A W + ++    +      + +  A 
Sbjct: 7   EVDEDVRRDQAANLWKRY-RTPVIVAAALIVAGTAAWSF-YENKRLEAAFAANQRYGAAA 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           EL  + K  +A ++FE +  +  K Y  L+ +  A  L  K D + A   F  VA D   
Sbjct: 65  ELAAAGKSAEAAAAFEAVAKETPKGYATLARLRAAEELA-KSDKEKALAAFDAVAQDKSV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               +  A L+A  + ++     ++   L +L     P    A E++G+ AL  G   +A
Sbjct: 124 DRLTQEVAKLRAGLVALEQGDRSKMVDRLGELVTSDGPFRYTAQELIGLDALNDGDFDEA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           + +F+ L  + ++P  +  R+    A + A+
Sbjct: 184 QRVFKLLLDNLDAPHAMRQRASAYQALLNAA 214


>gi|254489034|ref|ZP_05102239.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214045903|gb|EEB86541.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 243

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 78/201 (38%), Gaps = 6/201 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N++    +    + +  Y WIA L I++I+  A W          K   +G+    AL
Sbjct: 16  EVNDEVRRDRFYFMLKR--YGWIAVLAIVLIVGAAAWNEYQKAQARSKAEALGDAAFAAL 73

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L ++     A S+   + +   +    L     A+  V  GD   A E    +A +   
Sbjct: 74  TLQDTEGRAAALSA---VETDSPRAAAVLG-FLTAAEQVEAGDKSAAIETLNAIAVNGEV 129

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A L++ ++    +   +    L+ L++P N +   A E L +  ++    Q A
Sbjct: 130 PAIYREIAQLKSVTLQGTETPVSDRRLALEALAQPGNTLRLLAEEQLALIEIEENNPQGA 189

Query: 182 KTIFEELAKDNNSPFGISTRS 202
              ++ +  D      +  R+
Sbjct: 190 IDRYQAILLDAEVTADLQQRA 210


>gi|84503433|ref|ZP_01001493.1| hypothetical protein OB2597_03749 [Oceanicola batsensis HTCC2597]
 gi|84388220|gb|EAQ01172.1| hypothetical protein OB2597_03749 [Oceanicola batsensis HTCC2597]
          Length = 205

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/196 (19%), Positives = 72/196 (36%), Gaps = 4/196 (2%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WIA L+IL+I+  A W+         +    G+    ALE     +   A S+ E   
Sbjct: 8   YGWIAVLVILLIVGGAAWYEYDRSRETAQARAFGDAILAALEQGEPLERATALSAIEA-- 65

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
                    + +M  A      GD + A  +   VA +    L  R  A  +A ++  D 
Sbjct: 66  --GTPDARAVRDMLEAGERSTAGDREGALTLLTGVAENPELQLIYRSLAKFRALALSTDD 123

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
               E     + L+   +P+   A E + ++ ++ G   +A      +  +      +  
Sbjct: 124 MGPAERRAEYEDLAGAGSPLRLLAKEQIAVTHIEEGNRDEALRQLNAMLDEAGMTQDLLR 183

Query: 201 RSQMILANIIASDQRN 216
           R   ++ ++  +   N
Sbjct: 184 RVSQLIVSLGGTPGEN 199


>gi|254460969|ref|ZP_05074385.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206677558|gb|EDZ42045.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 224

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/212 (20%), Positives = 78/212 (36%), Gaps = 6/212 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    +    M +  Y WIA L IL ++  A W          +    G     AL
Sbjct: 10  EVSEEMRRDRLYGYMRR--YGWIAVLAILSLVGGAAWNEYSKSQARAEAQSAGNAILAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQD-NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               ++   +   S E + S+D  +    + ++  A+   A  D   A      +A D  
Sbjct: 68  ---EADDPQERVKSLEALQSEDITEGAKAVVSLMQAAEQSAGDDPAGAQTALEAIAVDGS 124

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
            P   R  A+ ++A+    + S E+    L  LS P   +   A E L +  ++ G    
Sbjct: 125 LPEIYRQIASFKSATKSGGSLSMEDRRLRLDALSAPGTSLRLLATEQLAMLDIEAGDTAA 184

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           A    + +  D     G+  R+  ++  + A 
Sbjct: 185 ALEKLQGIVVDAEVTAGLRQRATQLIVALGAE 216


>gi|83943021|ref|ZP_00955481.1| hypothetical protein EE36_12608 [Sulfitobacter sp. EE-36]
 gi|83846029|gb|EAP83906.1| hypothetical protein EE36_12608 [Sulfitobacter sp. EE-36]
          Length = 237

 Score =  101 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 77/201 (38%), Gaps = 6/201 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    +    + +  Y WIA L +++++  A W          +   +G+    AL
Sbjct: 10  EVNEEVRRDRFYFMLKR--YGWIAVLAVILLVGGAAWNEYQKAQARAEAETLGDAMFAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
              ++       ++FEKI + + +    L  +  A+     G+T  A      +  D   
Sbjct: 68  SAEDT---AARAAAFEKIEATNPRAGAMLG-LLTAAEQAQAGETDAAVATLNGIGLDADV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A  +A ++        E    L+ L++P + +   A E L +  ++    + A
Sbjct: 124 PAIYREIAQFKAITLQGSDMPANERRLALENLAQPGSSLRLLAQEQLAMIDIEEDAPEAA 183

Query: 182 KTIFEELAKDNNSPFGISTRS 202
              ++ +  D +    +  R+
Sbjct: 184 IERYQGILNDADVTSDLQQRA 204


>gi|126736008|ref|ZP_01751752.1| hypothetical protein RCCS2_02198 [Roseobacter sp. CCS2]
 gi|126714565|gb|EBA11432.1| hypothetical protein RCCS2_02198 [Roseobacter sp. CCS2]
          Length = 218

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 42/205 (20%), Positives = 71/205 (34%), Gaps = 9/205 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    K    + +  Y WI    +L+++  A W    +          G+    AL
Sbjct: 10  EVTEEVRREKLYGYLRR--YGWIGVAAVLLLVGGAAWNEYSNAQARSAAEATGDALMSAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E  +      A +  E      +     ++ +  A+     GD   AA+    V  +   
Sbjct: 68  EENDPTVRAAAMAQVE-----GDGAAAAVTLLLRAATEQEAGDNAAAAQTLNDVTTNPDV 122

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A L+AA +  D          L+ LS+P  P    A E +    L  G    A
Sbjct: 123 PEMYRDVAALKAAMLPSD--DVAARRANLEALSQPGQPFRLLALEQIAYMTLGEGDADGA 180

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
             +  E+ +D     G+  R Q ++
Sbjct: 181 IAVMREIVEDAGVTRGLRERVQTLM 205


>gi|154246484|ref|YP_001417442.1| hypothetical protein Xaut_2543 [Xanthobacter autotrophicus Py2]
 gi|154160569|gb|ABS67785.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 237

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 89/204 (43%), Gaps = 3/204 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   D    + +    +     IA ++++++   A  +  +     ++       F  A+
Sbjct: 7   EIEEDLRRERLRKLWDRFGGLIIAAIVLVVV--GAAGWSGYKYWRHQQAVTASAAFQSAI 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            LF++ K  +A ++F  +       Y  L+    A+   A+         F  +A D   
Sbjct: 65  SLFDAGKFPEAEAAFAAVAKDGPAGYRTLALFRGAAAAAARD-KAAGVAAFDAIAADAGL 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  VR  A L+AA ILVDT+   E+ + +  ++  + P+   A E L ++ LK G    A
Sbjct: 124 PSLVRELAQLRAALILVDTAGLAEVKQRVAAIAAGTGPLRNAAREALALAELKAGDAAAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMI 205
                E+  D+ +P G+ +R+++I
Sbjct: 184 NKTATEITSDSETPPGVRSRAELI 207


>gi|254474487|ref|ZP_05087873.1| conserved hypothetical protein [Ruegeria sp. R11]
 gi|214028730|gb|EEB69565.1| conserved hypothetical protein [Ruegeria sp. R11]
          Length = 223

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 78/211 (36%), Gaps = 6/211 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    + +  Y WI  + + +I+  A +        +     +G+    AL
Sbjct: 10  EVTEEVRRDRLFLMLKR--YGWIGGVAVALIVGGAAYREYDRAQTQAAAEQLGDQMIAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +  +S    +A S         +   + +  +  A  L   G+   A      +  +   
Sbjct: 68  DSDDSAARAEALSQITA----GSAGGDTVLKLLQAGALADAGERDAAIAALNAIGGNGDV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           PL  R+ AT +A  +  D+    +     + L++P  P+   A E L +  ++ GK ++A
Sbjct: 124 PLIYRHIATFKALGLQQDSLPAADRRIQFEALAQPGAPLDLLAREQLALIDIEEGKTEEA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
            +   ++         +  R+  ++  +  S
Sbjct: 184 ISKLRDIINAATVTSDLQDRASQVIVALGGS 214


>gi|294086066|ref|YP_003552826.1| hypothetical protein SAR116_2499 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665641|gb|ADE40742.1| hypothetical membrane associated protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 208

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/210 (19%), Positives = 77/210 (36%), Gaps = 8/210 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    + +    +   K++    ++++L++      +     K+     + +  +L
Sbjct: 7   EIDEELKKDRAELLWARYG-KYVIGACLVVVLAVGG-HQGYGIYSTKQIEKAADLYHTSL 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                 K DD  SS    + +    Y  L+   IA+     GD   A   +  +A D   
Sbjct: 65  ------KADDVISSLNNNVDELTDGYQMLARFQIAAAEARAGDHAAAQASYSALAEDKNI 118

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               +  A L +       SS + +   L  L   +      A E      L+ GKV  A
Sbjct: 119 DPLYQQFAQLLSVMNAPADSSVQSLQDRLAPLISAAGTWQGLALEQSAGLDLQTGKVDAA 178

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIA 211
           KT  E++ K    P  +  R+Q +L  + A
Sbjct: 179 KTKLEQIVKLTEIPQSLRQRAQRMLDILNA 208


>gi|83954196|ref|ZP_00962916.1| hypothetical protein NAS141_17859 [Sulfitobacter sp. NAS-14.1]
 gi|83841233|gb|EAP80403.1| hypothetical protein NAS141_17859 [Sulfitobacter sp. NAS-14.1]
          Length = 237

 Score = 99.3 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/201 (18%), Positives = 76/201 (37%), Gaps = 6/201 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    +    + +  Y WIA L +++++  A W          +   +G+    AL
Sbjct: 10  EVNEEVRRDRFYFMLKR--YGWIAVLAVILLVGGAAWNEYQKAQARAEAETLGDAMFAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
              ++     A   FEKI + + +    L  +  A+     G+T  A      V  D   
Sbjct: 68  SAEDTAARASA---FEKIEATNPRAGAMLG-LLTAAEQAQAGETDAAVATLNGVGLDADV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A  +A ++        E    L+ L++P + +   A E L +  ++    + A
Sbjct: 124 PAIYREIAQFKAITLQGSDMPANERRLALENLAQPGSSLRLLAQEQLAMIDIEEDAPEAA 183

Query: 182 KTIFEELAKDNNSPFGISTRS 202
              ++ +  D +    +  R+
Sbjct: 184 IERYQGILNDADVTSDLQQRA 204


>gi|330994710|ref|ZP_08318633.1| hypothetical protein SXCC_04598 [Gluconacetobacter sp. SXCC-1]
 gi|329758351|gb|EGG74872.1| hypothetical protein SXCC_04598 [Gluconacetobacter sp. SXCC-1]
          Length = 232

 Score = 98.5 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 72/222 (32%), Gaps = 13/222 (5%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +  + + +    +        +  + I     W Y    +H     +    F    
Sbjct: 8   EVDEEIRAERIRALARRYLVVAGVVVAGICI-GAGGWQYSLSRAHRADAAVSAAYFTAMA 66

Query: 62  ELFNSN------------KLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAA 109
           +   +             +     +  + + ++       L+ M  A++L   GD   A 
Sbjct: 67  DAARAPDAPATGVTPLTTRQKTGLAELQALDAKARPPLRILARMERAALLAGSGDLPGAL 126

Query: 110 EIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILG 169
            ++  VA +      +   A+L      +D+     +   L  L     P    A E   
Sbjct: 127 ALWDGVAQEKAVDPTIAALASLLWVQHQIDSGDPATLRSRLAVLDGTGQPWRGQAIEAEA 186

Query: 170 ISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           +  L+ GK   A+  F  LA D     G+ +R++ +L  +  
Sbjct: 187 LLDLRAGKDADARARFTRLAMDMGVGDGVRSRAEAMLQTMGG 228


>gi|56697189|ref|YP_167553.1| hypothetical protein SPO2330 [Ruegeria pomeroyi DSS-3]
 gi|56678926|gb|AAV95592.1| hypothetical protein SPO2330 [Ruegeria pomeroyi DSS-3]
          Length = 258

 Score = 98.5 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 37/210 (17%), Positives = 75/210 (35%), Gaps = 6/210 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    + +  + WI  L ++ I+  A W          K   +G+    AL
Sbjct: 45  EVTEEVRRDRMFLLLKR--WGWIGGLAVVAIVGGAAWNEYSKAQATAKAQGLGDAVIAAL 102

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
              ++    +A  +       D+     +  +  A+    KGDT  A      +A     
Sbjct: 103 SANDAAARAEALGAITP----DSTGGAAVLALLTAAADSGKGDTAAAVARLETLAAQGDL 158

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A  +A  +  DT    +  +  + L++P  P+   A E L +  +  G  + A
Sbjct: 159 PPVYRQIAAFKALLLQADTLPVSDRRQQFEALAQPGAPLRLLALEQLALIDIAEGDTEAA 218

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIA 211
               + + +D      +  R+  ++  + A
Sbjct: 219 LARLQSIREDAEVSTDLQQRATQLMVALGA 248


>gi|86138477|ref|ZP_01057051.1| hypothetical protein MED193_05216 [Roseobacter sp. MED193]
 gi|85825002|gb|EAQ45203.1| hypothetical protein MED193_05216 [Roseobacter sp. MED193]
          Length = 223

 Score = 98.1 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 43/215 (20%), Positives = 81/215 (37%), Gaps = 7/215 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    + +  Y WI  L +++I+  A +              +G+    AL
Sbjct: 10  EVTEEVRRDRLFVMLKR--YGWIGGLAVVLIVGGAAFSEYNKAKDLAAAQTLGDEMIAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                    +A     +I ++       L+ M  A  L   G  + A      VA D   
Sbjct: 68  SSDEGQPRAEA---LNEISAKTPGGAAVLA-MLQAGALADAGQPEEAVARLQTVALDGDL 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           PL  R+ A+ +A  +  D+ S  E       L++P  P+   A E + +  ++ G  + A
Sbjct: 124 PLIYRHIASFKALGLQQDSLSTAERRLQFDALAQPGAPLALLAAEQIALLDIEEGNAEAA 183

Query: 182 KTIFEELAKDNNSPFGISTRS-QMILANIIASDQR 215
               + + +D      +  R+ Q+I+A   A D+ 
Sbjct: 184 IDRLKAIVEDAGVTADLKERATQVIVALGGALDEA 218


>gi|260433295|ref|ZP_05787266.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417123|gb|EEX10382.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 223

 Score = 96.6 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 71/192 (36%), Gaps = 4/192 (2%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           + W+   L+++I+  A +          +   +G+    A+    +N   +  ++ + + 
Sbjct: 27  WGWVGVALVVLIVGGAAFNEYRKARSASQAQELGDAILAAMA---NNDPSERAAALQAVS 83

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
           +      + +    ++  L   G    A E    +A     P   R  A+ ++  +  DT
Sbjct: 84  AHTAGG-DAVVGFLLSGALTEAGSIPEAVERLNAIAAQGDLPEIYRAIASFKSLLLQADT 142

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
               +  +  + L+    P+   A E L +  +  G  Q A    + L +D  +   I  
Sbjct: 143 LPAADRRQQFEALAAAGAPLRLLAEEQLALIDVAEGDTQAALDRLQALRQDAEAGIEIRQ 202

Query: 201 RSQMILANIIAS 212
           R+  ++  +  +
Sbjct: 203 RAGQLIVALGGT 214


>gi|103487686|ref|YP_617247.1| hypothetical protein Sala_2205 [Sphingopyxis alaskensis RB2256]
 gi|98977763|gb|ABF53914.1| conserved hypothetical protein [Sphingopyxis alaskensis RB2256]
          Length = 253

 Score = 95.4 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 91/217 (41%), Gaps = 6/217 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E +      +    M +   +WI   ++ ++L+   + Y        +     E    AL
Sbjct: 14  EVDEAVRKDRLDTIMQRYG-RWIIGGVLAILLAFGGYLYWNHRQDVARGEQA-EELIAAL 71

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +   +N+   A S  EKI +     Y   + M +A++    GD K AA +  KVA D   
Sbjct: 72  DKLEANQPRAATSELEKIAAAGTPAYRAAATMQLANVKAGAGDLKAAAALMAKVAADTQV 131

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLS---EPSNPMHQFANEILGISALKFGKV 178
             ++R  A ++  +   DT   E +   ++ +    +P++     A E+   +  + G+ 
Sbjct: 132 DRSLRDLALIRQTAFEYDTLKPEAVIARMKPIVDARDPASSWFASAAELSASAHYRLGQF 191

Query: 179 QKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
            +A  ++  +AK  + P  + +RS + +A ++  D  
Sbjct: 192 DRAGALYGRIAKLPDLPKSLQSRS-VQMAGMLGVDAV 227


>gi|259419239|ref|ZP_05743156.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259345461|gb|EEW57315.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 229

 Score = 95.0 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 36/195 (18%), Positives = 70/195 (35%), Gaps = 4/195 (2%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WI  + +L+I+  A W              VG+  + AL   ++     A +      
Sbjct: 34  YGWIGAVAVLLIVGGATWREYSRAKAVSAAQDVGDQISAALTANDAADRAVALADI---- 89

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
           S        + +   A+ L   G+ + AA +   VA     P   R  A  ++  +  +T
Sbjct: 90  SAGEVGAKAVVDFAQAAALADAGEPEKAASLLDAVAQQSELPQVYRDIAAFKSVILQAET 149

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
              E+    L+ L+     +   A+E L +  ++ G    A    +E+A        +  
Sbjct: 150 MPVEDRRLRLETLAAAGGSLQFLASEQLALLDIEAGDTDAALARLKEIAASAGVSRDLQE 209

Query: 201 RSQMILANIIASDQR 215
           R   ++  +  S + 
Sbjct: 210 RVSQVIVALGGSPEA 224


>gi|110679078|ref|YP_682085.1| hypothetical protein RD1_1780 [Roseobacter denitrificans OCh 114]
 gi|109455194|gb|ABG31399.1| hypothetical protein RD1_1780 [Roseobacter denitrificans OCh 114]
          Length = 256

 Score = 95.0 bits (235), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 75/201 (37%), Gaps = 6/201 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    +    + +  Y W+A L++++I+  A W          +   +G+    AL
Sbjct: 41  EVNEEVRRDRFYLMLRR--YGWVAALVVVLIVGGAAWSEYRKAQARAEAERLGDQILDAL 98

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L         ++  + I +        +  +  A+     G+   A     +VA D   
Sbjct: 99  SLSE---PATRQAGLDTIDTATPGAAAVV-RLLSAAEAQQAGELDAALAALEQVAVDGDV 154

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A  ++  +  DT    E  + L+ L+ P  P+   A E L +  +  G  + A
Sbjct: 155 PEIYRQIAAFKSIVLQADTMDPSERRQQLEALAVPGAPLSFLAQEQLALMEVAAGNTEAA 214

Query: 182 KTIFEELAKDNNSPFGISTRS 202
              ++ + +   +   +  R+
Sbjct: 215 LAQYQSILQAEGASADLQQRA 235


>gi|114771863|ref|ZP_01449256.1| hypothetical protein OM2255_13007 [alpha proteobacterium HTCC2255]
 gi|114547679|gb|EAU50570.1| hypothetical protein OM2255_13007 [alpha proteobacterium HTCC2255]
          Length = 225

 Score = 93.1 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/205 (16%), Positives = 78/205 (38%), Gaps = 9/205 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    K      K  Y WI  ++I  ++  A +      +     +  G+    AL
Sbjct: 21  EVSEEVRKDKLFALYKK--YAWIPVVVICSLVGGAGFLEYQKSAKANAASARGDALIAAL 78

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
              +++      +    ++S++     P++ ++ A +L+ + D   +  ++  +      
Sbjct: 79  NQDDASIRASELA----LISENGGDEAPIAKLHRAGVLLEQDDIAGSLAVYDSM---SGG 131

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
                  A L+A  I  +    +   + L  ++ P N     A E   I+ +  G   KA
Sbjct: 132 DDIYSQVAMLKAIMIRGNKMDNDTRMQALDAIATPGNAFRVIAMEQKAIAYIDMGNSDKA 191

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
             IF  L ++ +    +  RS+ ++
Sbjct: 192 IEIFSTLIEEADVSQALIARSKQMI 216


>gi|163736773|ref|ZP_02144192.1| hypothetical protein RGBS107_16616 [Phaeobacter gallaeciensis
           BS107]
 gi|161390643|gb|EDQ14993.1| hypothetical protein RGBS107_16616 [Phaeobacter gallaeciensis
           BS107]
          Length = 223

 Score = 93.1 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 78/211 (36%), Gaps = 6/211 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    + +  Y WI  + +++I+  A          E     +G+    AL
Sbjct: 10  EVTEEVRRDRLFKMLKR--YGWIGGIAVVLIVGGAALREYNRAQTEAASQALGDQMIAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +  +S     A    + I ++     + +  +  A  L   GD   A E    VA +   
Sbjct: 68  DSDDSAARATA---LDAITAETAGG-DTVLKLLQAGALADAGDRAAAVERLNAVARNGEM 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           PL  R+ AT +A  +  ++    +     + L++P  P+   A E L +  ++      A
Sbjct: 124 PLIYRHIATFKALGLQQESLPAADRRIQFEALAQPGAPLALLAQEQLALIDIEEDNTDAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
            +  +E+         +  R+  ++  +  +
Sbjct: 184 ISRLQEIIASAGVTSDLKDRASQVIVALGGA 214


>gi|163743208|ref|ZP_02150590.1| hypothetical protein RG210_14945 [Phaeobacter gallaeciensis 2.10]
 gi|161383625|gb|EDQ08012.1| hypothetical protein RG210_14945 [Phaeobacter gallaeciensis 2.10]
          Length = 223

 Score = 92.7 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 79/211 (37%), Gaps = 6/211 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    + +  Y WI  + +++I+  A          E     +G+    AL
Sbjct: 10  EVTEEVRRDRLFKMLKR--YGWIGGIAVVLIVGGAALREYNRAQTEAASQALGDQMIAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +  +S     A    + I ++     + +  +  A  L   GD   A E    VA +   
Sbjct: 68  DSDDSAARATA---LDAITAETAGG-DTVLKLLQAGALADAGDRAAAVERLNAVARNGEM 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           PL  R+ AT +A  +  ++    +     + L++P  P+   A E L +  ++    + A
Sbjct: 124 PLIYRHIATFKALGLQQESLPAADRRIQFEALAQPGAPLALLAQEQLALIDIEEDNTEAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
            +  +E+         +  R+  ++  +  +
Sbjct: 184 ISRLQEIIASAGVTSDLKDRASQVIVALGGA 214


>gi|154253926|ref|YP_001414750.1| hypothetical protein Plav_3494 [Parvibaculum lavamentivorans DS-1]
 gi|154157876|gb|ABS65093.1| conserved hypothetical protein [Parvibaculum lavamentivorans DS-1]
          Length = 240

 Score = 92.4 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 43/208 (20%), Positives = 94/208 (45%), Gaps = 3/208 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   D    +      K     I  ++ L+++  AI    +      ++      F + +
Sbjct: 7   EVEEDLRREQFSKLWDKYGAWLIGAVVALVLVVAAI--VGWRAWSHSQRVEASARFEETV 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                    +A ++F ++    +  Y  L+ ++ A   +A G+   A  ++ +VAN   A
Sbjct: 65  IKAQDAAPAEAAAAFAELAESTSGGYAVLARLHEADKRLAAGERDVALAVYGEVAN-GGA 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P  VR  A ++   +LVDT+SY+++   +  L + ++P  + A E+L ++A++ G+ + A
Sbjct: 124 PAIVRGMARIKEGLLLVDTASYDDMKARMSPLVDSASPWRENALELLALAAMRDGEWEDA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANI 209
                 +  +  +P G+  R+ +I A +
Sbjct: 184 NRNAAAIIANQATPAGLRDRAHVIQALV 211


>gi|260575152|ref|ZP_05843153.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259022774|gb|EEW26069.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 215

 Score = 90.8 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 40/182 (21%), Positives = 65/182 (35%), Gaps = 7/182 (3%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WI  LL+++++  A +      S        G+    ALE  +      A        
Sbjct: 27  YGWIGILLVVLVVGGAAFSEWNKASKRAAAQAFGDAVLAALEAPDP-----AARRAALAA 81

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
              +     + N+ +AS      D   A     KVA D   P+A R  A L+   +    
Sbjct: 82  VPASGDRAAILNLMLASDPAT--DRAGALAALDKVAADTTLPVAYRDLAVLRRVVLAGAD 139

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
            +  +    L  ++ P  P    A E L    ++ G    A T  + L  D  +P G+  
Sbjct: 140 MAVADRRAALDPIAAPGRPFRPLALEQLAYLQIEAGDTAAAITALQALTVDQEAPSGLRQ 199

Query: 201 RS 202
           R+
Sbjct: 200 RA 201


>gi|254294313|ref|YP_003060336.1| hypothetical protein Hbal_1955 [Hirschia baltica ATCC 49814]
 gi|254042844|gb|ACT59639.1| conserved hypothetical protein [Hirschia baltica ATCC 49814]
          Length = 240

 Score = 90.0 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 51/215 (23%), Positives = 91/215 (42%), Gaps = 5/215 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +  + K      K  + +     I ++  +A   Y FD    K+    G  F   L
Sbjct: 7   EVEENVKADKLNRFWNK-AWPFALGGSIAIVAMVAANSY-FDEQATKEIEANGRTFELGL 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +      +++ RS F  +L +D+   +  +     + L   GDT  AA+     A  +  
Sbjct: 65  KSLEIQDVENTRSRFGALLDKDSGFADLAAQYLAQAELEMAGDTLAAAKALEISAQGEG- 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +   A L+AA +L DT S  E+   L  L    +     A+E++G  A + G +++A
Sbjct: 124 --PLADLAKLKAAYLLADTQSLAEVEAALGDLVGNEDSFGALAHELIGAKAFEEGDMERA 181

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           ++ ++ L    N+P G+  R+   LA I A  + N
Sbjct: 182 RSEYQALTLRLNAPEGVLNRANDALAVIPALTETN 216


>gi|163797495|ref|ZP_02191446.1| hypothetical protein BAL199_23462 [alpha proteobacterium BAL199]
 gi|159177244|gb|EDP61803.1| hypothetical protein BAL199_23462 [alpha proteobacterium BAL199]
          Length = 212

 Score = 90.0 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 84/205 (40%), Gaps = 4/205 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    +      +    W+    + ++L+++   +    S + K   +G+ +  A 
Sbjct: 7   EIDEELQQERAAKLWQRYG-GWLIAAAVGVVLAVSGNVFWNRYSTQLKAE-MGDRYEAAA 64

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           EL  S    D   +F  +       Y  L+ +  A+ L   GDT+ A  +F KVA D   
Sbjct: 65  ELVVSGNPKDGAQAFAALADDAGAGYATLARLREAAALATAGDTEAAILVFRKVATDAKP 124

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P      A L+A  + + T     +   L  +    NP    A E      L+ G+  KA
Sbjct: 125 P--YADLARLRAVRLGIGTGDTSALLSELAPVLAAGNPWRPLAAETEAAIHLRAGETGKA 182

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
            TI++ LA D ++P  +  R+  ++
Sbjct: 183 LTIYKSLADDASTPSQLRARAAEMV 207


>gi|163746869|ref|ZP_02154226.1| hypothetical protein OIHEL45_15739 [Oceanibulbus indolifex HEL-45]
 gi|161379983|gb|EDQ04395.1| hypothetical protein OIHEL45_15739 [Oceanibulbus indolifex HEL-45]
          Length = 234

 Score = 88.9 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 45/214 (21%), Positives = 82/214 (38%), Gaps = 9/214 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    +    M +  Y WIA + ++ I+  A W          +   +G+    AL
Sbjct: 10  EVNEEVRRDRLYGLMRR--YGWIAVVAVIAIVGGAAWNEYSKAQERAQAEALGDAMLAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E   SN   +A      I ++       L+ M  A  L   G+   A E    +A D   
Sbjct: 68  EADASNARAEA---LAPIEAEGPGANAVLNFMR-ADALAEAGEIDAAVEQLDAIALDGDL 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  A  +A ++   +    E  + L+ L++P   +   A E L +  ++ G+  KA
Sbjct: 124 APIYRQLAQFKAVTLQGQSVPVAERRQALEALAQPGAALRLLAEEQLALIDIQEGETGKA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
              ++ +  D  +   +  R+   L  I+A  + 
Sbjct: 184 VARYQSILSDAETTPDLQQRA---LQVIVALGKE 214


>gi|89068272|ref|ZP_01155682.1| hypothetical protein OG2516_02384 [Oceanicola granulosus HTCC2516]
 gi|89046189|gb|EAR52247.1| hypothetical protein OG2516_02384 [Oceanicola granulosus HTCC2516]
          Length = 234

 Score = 88.9 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/211 (18%), Positives = 78/211 (36%), Gaps = 8/211 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    +    + +  Y WIA L++++I+  A W        + +   +G+    A 
Sbjct: 10  EVNEEVRRDRLYGYLRR--YGWIAALVVVLIVGGAAWSEWSRAREQARAQELGDALLAAA 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E+ ++     A  +              ++ M  A      GD+  A      +A+D   
Sbjct: 68  EMEDAEARAAALEA-----LAPEGPAVAVAGMLAAEAQAEAGDSAAATATLAALADDPEV 122

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A L+A  +  +T S  E +    +L+ P  P    A E   ++ +  G  + A
Sbjct: 123 PPLYRDLAALKALMLD-ETMSPAERAAAFGELARPGAPFRMVALEQQALAEVAAGDAETA 181

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
                 + +D +    +  R+  ++  +   
Sbjct: 182 LDTLARIIRDADVSQDLRDRATTLMVALGGE 212


>gi|163733997|ref|ZP_02141438.1| hypothetical protein RLO149_03624 [Roseobacter litoralis Och 149]
 gi|161392533|gb|EDQ16861.1| hypothetical protein RLO149_03624 [Roseobacter litoralis Och 149]
          Length = 225

 Score = 88.9 bits (219), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 78/201 (38%), Gaps = 6/201 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N++    K    + +  Y W+A L++++I+  A W          +   +G+    AL
Sbjct: 10  EVNDEVRRDKFYLMLRR--YGWVAALVVVLIVGGAAWSEYRKAQTRAEAERLGDQILNAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L    +    ++  + I ++       +  +  A+     G+T  A +   +VA D   
Sbjct: 68  SL---GEPATRQAGLDTINAETPTA-KAVVRLLAAAEAQQAGETDTALQALEQVAVDGDV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A  ++  +  DT    E  + L+ L+ P  P+   A E + +  +  G    A
Sbjct: 124 PEIYRQIAAFKSIVLQADTMDPSERRQQLEALAVPGAPLSFLAQEQIALMEVAAGNTDAA 183

Query: 182 KTIFEELAKDNNSPFGISTRS 202
              ++ + +       +  R+
Sbjct: 184 LAQYQSILQAAGVSADLQQRA 204


>gi|255261721|ref|ZP_05341063.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255104056|gb|EET46730.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 231

 Score = 88.5 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 44/210 (20%), Positives = 86/210 (40%), Gaps = 7/210 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N++    +      K  Y W+A L+++ ++  A W        E +   +G+    AL
Sbjct: 10  EVNDEVREDQLFQTFRK--YGWVAALVVVALVGGAAWSEFSKSRTENQAKALGDAVLDAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E        DA ++ E I +  N     ++ +  A+ L       +AA++   V+ D   
Sbjct: 68  ETEE---PVDAVAALETIDATGNAA--AVTALLRAAELQRADAAADAADVLDSVSLDGDV 122

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  AT +A  +  DT    E       LS+P NP    + E + +  ++   ++ A
Sbjct: 123 DPIYRDLATFKALLLRADTLDASERRAGFHALSQPGNPYRLMSVEQIALLDVEADDLEAA 182

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIA 211
              F  + +D  +  G+  R++ ++  + A
Sbjct: 183 LRGFAAILEDAEATTGLRRRARGMIVALGA 212


>gi|126739023|ref|ZP_01754717.1| hypothetical protein RSK20926_21524 [Roseobacter sp. SK209-2-6]
 gi|126719640|gb|EBA16348.1| hypothetical protein RSK20926_21524 [Roseobacter sp. SK209-2-6]
          Length = 223

 Score = 88.5 bits (218), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 40/211 (18%), Positives = 85/211 (40%), Gaps = 6/211 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    + +  Y WI  L +++I+  A +  +     E     +G+    AL
Sbjct: 10  EVTEEVRRDRLFLMLKR--YGWIGGLAVILIVGGATFREINKSKAETAAQDLGDELLAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                 K  +A     KI +        ++ +  A  LV   D   A      VA +   
Sbjct: 68  VHDEDAKRAEA---LSKIAADTEGGKAVVALLQ-AGALVNADDRDAAVARLESVAVNGEL 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P+  R+ A+ +A  +  ++ S EE     + L++P  P+   A+E + +  ++ G  + A
Sbjct: 124 PMIYRHIASFKALLLQQESLSLEERRIQFEALAQPGAPLALLASEQIALLEIEQGNTEAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIAS 212
            T  +++  D ++   +  R+  ++  +  S
Sbjct: 184 ITRLQQITVDASAAADLKERASQVIVALGGS 214


>gi|119385152|ref|YP_916208.1| hypothetical protein Pden_2425 [Paracoccus denitrificans PD1222]
 gi|119374919|gb|ABL70512.1| conserved hypothetical protein [Paracoccus denitrificans PD1222]
          Length = 246

 Score = 88.5 bits (218), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 40/208 (19%), Positives = 72/208 (34%), Gaps = 8/208 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   D    +      +  Y WIA L+IL I+  A W        E +    G+    A 
Sbjct: 26  EVTEDLRRDRLFALFRR--YGWIALLVILGIVGGAAWREYSSSQAETRARAWGDAIMAA- 82

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                 + DD  ++   +    +     LS M  A      G  + AAE     A     
Sbjct: 83  -----RQGDDPITALSAVDPAGSAGRKVLSEMLAAGAEAQAGLPQKAAERLKAAAAGLQN 137

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +   A L+A  +        E  ++L  LS+P  P    A E   ++ +  G+ + A
Sbjct: 138 DPVLHDLALLKAVMVAGPAMDAAERDRLLADLSKPGAPFELLALEQKAVALIGAGRTEDA 197

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANI 209
             +  ++ + +     +  R   ++  +
Sbjct: 198 VMLIGQIQQKDGLSEPLRRRLSEMMITL 225


>gi|114799082|ref|YP_759500.1| hypothetical protein HNE_0772 [Hyphomonas neptunium ATCC 15444]
 gi|114739256|gb|ABI77381.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 238

 Score = 87.7 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/213 (21%), Positives = 88/213 (41%), Gaps = 3/213 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E +      K      K        +  L+I  +A+  ++     E+++          +
Sbjct: 7   EVDEGIRQEKLAGLWKKWRPFVYGGVAALII-GVAVNEFVLKPQAEQRRQERALALESGI 65

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                 + ++A ++F KI+++D KL    ++    +     GD   AAE+   V   +  
Sbjct: 66  RALEDARYEEAEAAFTKIMNEDPKLAPLAAHFLAQTKYEGGGDAAAAAELLASVGGTEGG 125

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P      A L++A    DT S EE+   L  L+   + +   A E++   A + G   +A
Sbjct: 126 P--YERLALLKSAYFKADTQSLEELELSLGSLANDDSTVGALARELIAAKAFEAGDFARA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           +T +  L  D  +P G+  R+++ LA I  + +
Sbjct: 184 RTAYNRLRLDAFAPQGLVRRAEIALAAIPVTAE 216


>gi|114762904|ref|ZP_01442336.1| hypothetical protein 1100011001359_R2601_26321 [Pelagibaca
           bermudensis HTCC2601]
 gi|114544514|gb|EAU47521.1| hypothetical protein R2601_26321 [Roseovarius sp. HTCC2601]
          Length = 218

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 45/207 (21%), Positives = 80/207 (38%), Gaps = 10/207 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    M +  Y WIA LL+++++  A W    +         +G+    AL
Sbjct: 10  EVTEEVRRDRLFAAMKR--YGWIAVLLVILLVGGAAWREYSNAQSRSAAQALGDEILAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNK--LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           E       D+A++    +   D        L  M  AS      D + AA     VA + 
Sbjct: 68  EA------DEAQARVAALSEIDAPTPGAEALIAMLTASEAARAEDMEAAALSLESVAANG 121

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
             P   R  A+ +A S      S +E    L+ L+ P  P+   A E L +  ++ G   
Sbjct: 122 EVPEIYREIASYKAMSQAGSGLSIDERRAGLESLAVPGKPLRLLAEEQLALLDIEAGDRL 181

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMIL 206
            A+     + +D+ +  G+  R+  ++
Sbjct: 182 AAEERLRRIVEDSEATAGLRQRASQMI 208


>gi|254466513|ref|ZP_05079924.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206687421|gb|EDZ47903.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 223

 Score = 86.6 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/192 (19%), Positives = 78/192 (40%), Gaps = 4/192 (2%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WI  + + +I+  A +              +G+    AL++    +  + +++    +
Sbjct: 27  YGWIGGVAVALIVGGAAFREYNKAQERAAAEDLGDQITAALKV----EGSEDQAAALAAV 82

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
           +      + ++ M   + L   G T  AA     VA D   PL  R+ A+ +A S+  +T
Sbjct: 83  TAPGAGGHAIAAMLEVAALAEAGKTAEAAARLEAVAIDGELPLIYRHIASFKALSLQAET 142

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
            S  +     + L++P  P+   A+E L +  ++ G    A     E+A D      +  
Sbjct: 143 LSVADRRLQYEALAQPGAPLALLASEQLALLDIEDGNNDAAIARLREIAADAAVSGDLKD 202

Query: 201 RSQMILANIIAS 212
           R+  ++  +  S
Sbjct: 203 RASQVIVALGGS 214


>gi|83594416|ref|YP_428168.1| hypothetical protein Rru_A3086 [Rhodospirillum rubrum ATCC 11170]
 gi|83577330|gb|ABC23881.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 253

 Score = 83.1 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 73/200 (36%), Gaps = 3/200 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   D    +      +     IA  +++++    +    +      ++      F  A 
Sbjct: 18  EVEEDLRHERLAEIWKQYGGLIIAAAVVVVLAVAGV--QGWRVYQADQRAEQAARFDAAR 75

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +                + +  +  Y PL+ +  A+ L  +G T  A + +  + ND  A
Sbjct: 76  DRLAKGDSAALEDL-AALAADRSSGYAPLAALRRAAALADEGKTDEAIQGYRGLINDSAA 134

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R AA + A    +      EI  +LQ L + + P    A E+  +S+L+ G  + A
Sbjct: 135 DPVFRDAARVLAVLHGLTLLDPAEIGGLLQPLRDGTGPWRPLAEELAAVSSLRQGDSKAA 194

Query: 182 KTIFEELAKDNNSPFGISTR 201
             I   +  D  +P G+  R
Sbjct: 195 IEILRGILGDPQAPRGVRQR 214


>gi|99080830|ref|YP_612984.1| hypothetical protein TM1040_0989 [Ruegeria sp. TM1040]
 gi|99037110|gb|ABF63722.1| hypothetical protein TM1040_0989 [Ruegeria sp. TM1040]
          Length = 222

 Score = 82.3 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 83/199 (41%), Gaps = 5/199 (2%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WI    +L+I+  A W    +         VG+  + AL    ++   +AR++    +
Sbjct: 27  YGWIGAAAVLLIVGGASWREYSNAKAVGAAQDVGDKISAAL----ASDAPEARAAALAEI 82

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
           S D      + +   A+ LV  G+ + AA +   +A +       R  A  ++ ++  +T
Sbjct: 83  SADQAGAQAVVDFAQAAALVDAGEVEQAAALLDGIAQNGDLAQVYRDIAAFKSVTLQAET 142

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
            + EE    L+ L+     M   A+E L +  ++ G+   A     ++A        +  
Sbjct: 143 LAPEERRLRLETLAAAGGTMQFLASEQLALLDIEEGETDAALARLRDIAASAGVSRDLQE 202

Query: 201 RS-QMILANIIASDQRNKK 218
           R  Q+I+A   + D+  ++
Sbjct: 203 RVSQVIVALGGSLDEAAQE 221


>gi|221639111|ref|YP_002525373.1| hypothetical protein RSKD131_1012 [Rhodobacter sphaeroides KD131]
 gi|221159892|gb|ACM00872.1| Hypothetical Protein RSKD131_1012 [Rhodobacter sphaeroides KD131]
          Length = 215

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 35/214 (16%), Positives = 73/214 (34%), Gaps = 9/214 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +      +  Y WIA + ++ ++  A +          +    G+    AL
Sbjct: 10  EVTEEVRRERLFGYFRR--YGWIALVAVIALVGGAAYIEWQKSQDAAESQAFGDAILTAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E  ++     A ++              L ++ +AS   A  D   +      VA +   
Sbjct: 68  EAPDAAARRAAVAA-----IPAEGARAALRDLMVASDPAA--DRAASLRALEGVAANAAL 120

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A R  A L+   +        +    L +++ P  P    A E +    ++ GK  +A
Sbjct: 121 DPAFRDLAVLRRVILAGAEMPVADRRAALDEIAAPGRPYRTLALEQMAYLDVEAGKPAEA 180

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
                 L +D  +  G+  R++ ++  +    Q 
Sbjct: 181 IQTLRNLVQDQEATQGLRRRAEQMITALGGDTQA 214


>gi|126462122|ref|YP_001043236.1| hypothetical protein Rsph17029_1354 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103786|gb|ABN76464.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 215

 Score = 81.6 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 34/214 (15%), Positives = 73/214 (34%), Gaps = 9/214 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +      +  Y WIA + ++ ++  A +          +    G+    AL
Sbjct: 10  EVTEEVRRERLFGYFRR--YGWIALVAVIALVGGAAYIEWQKSQDAAESQAFGDAILTAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E  ++     A ++              L ++ +AS   A  D   +      VA +   
Sbjct: 68  EAPDAAARRAAVAA-----IPAEGARAALRDLMVASDPAA--DRAASLRALEGVAANATL 120

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A R  A L+   +        +    L +++ P  P    A E +    ++ G+  +A
Sbjct: 121 DPAFRDLAVLRRVILAGAEMPVADRRAALDEIAAPGRPYRTLALEQMAYLDVEAGRPAEA 180

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
                 L +D  +  G+  R++ ++  +    Q 
Sbjct: 181 IQTLRSLVQDQEATQGLRRRAEQMITALGGDTQA 214


>gi|332558126|ref|ZP_08412448.1| hypothetical protein RSWS8N_03705 [Rhodobacter sphaeroides WS8N]
 gi|332275838|gb|EGJ21153.1| hypothetical protein RSWS8N_03705 [Rhodobacter sphaeroides WS8N]
          Length = 215

 Score = 81.6 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 35/214 (16%), Positives = 73/214 (34%), Gaps = 9/214 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +      +  Y WIA + ++ ++  A +          +    G+    AL
Sbjct: 10  EVTEEVRRERLFGYFRR--YGWIALVAVIALVGGAAYIEWQKSQDAAESQAFGDAILTAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E  ++     A ++              L ++ +AS   A  D   +      VA +   
Sbjct: 68  EAPDAAARRAAVAA-----IPAEGARAALRDLMVASDPAA--DRAASLRALEGVAANATL 120

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A R  A L+   +        +    L +++ P  P    A E +    ++ GK  +A
Sbjct: 121 DPAFRDLAVLRRVILAGAEMPVADRRAALDEIAAPGRPYRTLALEQMAYLDVETGKPAEA 180

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
                 L +D  +  G+  R++ ++  +    Q 
Sbjct: 181 IQTLRNLVQDQEATQGLRRRAEQMITALGGDTQA 214


>gi|85703429|ref|ZP_01034533.1| hypothetical protein ROS217_21847 [Roseovarius sp. 217]
 gi|85672357|gb|EAQ27214.1| hypothetical protein ROS217_21847 [Roseovarius sp. 217]
          Length = 257

 Score = 81.6 bits (200), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 44/205 (21%), Positives = 71/205 (34%), Gaps = 7/205 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    M +  Y WIA L ILM++  A W              +G+    AL
Sbjct: 38  EVTEEVRRDRLFALMRR--YGWIAVLAILMLVGGAAWNEWRKAQDRAAAQALGDAMLAAL 95

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
              +     DA      I  Q+ +         +A+   A    + AAE  L +A+    
Sbjct: 96  ATEDRAARADA---LNAIEVQNPQT--EAVIALLAAAEAAAETPETAAERLLALADRPDV 150

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  ATL+A  +       E     L  L+     +   A E L +  L+ G   +A
Sbjct: 151 DAVYRNLATLKAVMLPGSGLDAEARRTRLNGLALSGGVLRLLAEEQLALIDLETGNRTEA 210

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
                 +A D  +  G+  R   ++
Sbjct: 211 VARLTAIATDAEATTGLRRRVTQVI 235


>gi|254511213|ref|ZP_05123280.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221534924|gb|EEE37912.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 223

 Score = 80.4 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/177 (17%), Positives = 63/177 (35%), Gaps = 4/177 (2%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
           +          +   +G+    AL     N   +  +S + +  Q       L+ +  AS
Sbjct: 44  FNEYRKARDTSQAEALGDAILSALS---ENGATERVASLQAVEPQSVGGDAVLNMLLSAS 100

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
             +  G  ++A      +A     P   R  A+ +A  +  DT    +  +  + L+ P 
Sbjct: 101 -QIEAGSEQDAVNSLNAIATQGDLPEIYRAIASFKALLLQTDTMPVADRRQQFEALAIPG 159

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
            P+   A E L +  +  G  Q A    + L +D  +   +  R+  ++  +    Q
Sbjct: 160 APLRLLAEEQLALIDVAEGNTQAALDRLQALRQDAEASVDLQQRAAQLIVALGGEPQ 216


>gi|146278198|ref|YP_001168357.1| hypothetical protein Rsph17025_2162 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556439|gb|ABP71052.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 215

 Score = 80.4 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/214 (18%), Positives = 73/214 (34%), Gaps = 9/214 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +      +  Y WIA ++++ I+  A +       H  +    G+    AL
Sbjct: 10  EVTEEVRRERLFGYFRR--YGWIALVIVVAIVGGAAFVEWQKAQHRAESQAFGDALLAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E  ++     A  +              L ++  AS     GD   A     +VA D   
Sbjct: 68  EAPDAAARRAAVEA-----VPAAGDRAALRDLMAASDPA--GDRAAAMAALERVAADATL 120

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  A L+   +        +    L  ++EP  P    A E +    ++ G+  +A
Sbjct: 121 SPVYRDLAVLRRVILGGAELPVADRRAALDGIAEPGRPYRALALEQMAYLEIEAGEPARA 180

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
                 L +D  +P G+  R++  +  +    Q 
Sbjct: 181 IETLRSLTQDQEAPQGLRRRAEQTITALGGGTQA 214


>gi|149913924|ref|ZP_01902456.1| hypothetical protein RAZWK3B_18013 [Roseobacter sp. AzwK-3b]
 gi|149812208|gb|EDM72039.1| hypothetical protein RAZWK3B_18013 [Roseobacter sp. AzwK-3b]
          Length = 224

 Score = 80.4 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 37/205 (18%), Positives = 75/205 (36%), Gaps = 7/205 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    +    M +  Y WIA LL+L+++    W         +   + G+    AL
Sbjct: 13  EVSEEVRRDRLFGLMRR--YGWIAVLLVLLLVGGTAWNEWRKAQERQTAQVFGDAVLAAL 70

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E  +    D   ++   + + +      +    +A+   +    + AA   + +A     
Sbjct: 71  EADSR---DARAAALSGVEAPNPGA--AVMRDLLAAAEASDATPQEAASRLMALAESSGI 125

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  ATL+A ++     S E+    L+ L+         A E L +  ++ G    A
Sbjct: 126 EPVYRQIATLKAVAMPDSGLSVEDRRTRLEGLALAEGLTRLLAEEQLAMIDIETGDTGAA 185

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
                 +  D  S  G+  R+  ++
Sbjct: 186 LERLVAIVGDAQSTPGLRRRASQVI 210


>gi|77463248|ref|YP_352752.1| hypothetical protein RSP_2697 [Rhodobacter sphaeroides 2.4.1]
 gi|77387666|gb|ABA78851.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 215

 Score = 78.5 bits (192), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 34/214 (15%), Positives = 68/214 (31%), Gaps = 9/214 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +      +  Y WIA + ++ ++  A +          +    G+      
Sbjct: 10  EVTEEVRRERLFGYFRR--YGWIALVAVIALVGGAAYIEWQKSQDAAESQAFGDAI---- 63

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L      D A                 L ++ +AS   A  D   +      VA +   
Sbjct: 64  -LAALEAPDAAARRAAVAAIPAEGARAALRDLMVASDPAA--DRAASLRALEGVAANATL 120

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A R  A L+   +        +    L +++ P  P    A E +    ++ GK  +A
Sbjct: 121 DPAFRDLAVLRRVILAGAEMPVADRRAALDEIAAPGRPYRTLALEQMAYLDVEAGKPAEA 180

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
                 L +D  +  G+  R++ ++  +    Q 
Sbjct: 181 IQTLRNLVQDQEATQGLRRRAEQMITALGGDTQA 214


>gi|68171273|ref|ZP_00544675.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999320|gb|EAM85967.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
          Length = 200

 Score = 78.1 bits (191), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 32/174 (18%), Positives = 66/174 (37%), Gaps = 4/174 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           KWI  +++++++  A      +  HEK    +G+    AL +   ++  +       +  
Sbjct: 13  KWICGIIVVLLVVFAGMVSWVNNRHEKLSQRMGDMMYDAL-MGEVSEH-EMIKILNDVAK 70

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            D   Y  L+   +A +     +   A  I+  +A D      +R  A       L+   
Sbjct: 71  VDGSNYQYLAKFKLAGMYGE-NEVAKAQSIYADLAADKRLMPELRELAEYLEIIALLKGE 129

Query: 142 SYEEISKILQK-LSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
             + +   +QK LS  S        E + +  LK   +  A  + +E+  + +S
Sbjct: 130 DLDLLKSKVQKFLSTKSEVYKSSIKEAIAVYMLKNNNIDGAIEVIKEIVGNADS 183


>gi|310815834|ref|YP_003963798.1| hypothetical protein EIO_1363 [Ketogulonicigenium vulgare Y25]
 gi|308754569|gb|ADO42498.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 216

 Score = 77.3 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 43/210 (20%), Positives = 78/210 (37%), Gaps = 7/210 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +      +  Y  IA ++I+++L LAIW+ +   +   +    G+    AL
Sbjct: 10  EVTEEVRRERLFTFFRR--YGGIALIVIVVLLGLAIWYEVSRHNQTAEVRARGDALLSAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E     +     S+  +I +        ++    A      GD   A      VA D  A
Sbjct: 68  EGPAEGR----ASALAQIDA-GEGAVAAVTAFLQADAAADAGDVAGAVATLDAVARDSAA 122

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  ATL++A      +        L+ L   ++     A E L +  L+ G V  A
Sbjct: 123 PRLYRDLATLKSAITGAGVTDANLRRAALEGLVAQNSTYLSLAREQLALIDLETGNVDAA 182

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIA 211
           ++  + +  D  +     +R   +L  + A
Sbjct: 183 RSALQAMVDDAATSDVQRSRIAALLEALGA 212


>gi|88658346|ref|YP_507649.1| hypothetical protein ECH_0854 [Ehrlichia chaffeensis str. Arkansas]
 gi|88599803|gb|ABD45272.1| conserved hypothetical protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 189

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/174 (18%), Positives = 66/174 (37%), Gaps = 4/174 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           KWI  +++++++  A      +  HEK    +G+    AL +   ++  +       +  
Sbjct: 2   KWICGIIVVLLVVFAGMVSWVNNRHEKLSQRMGDMMYDAL-MGEVSEH-EMIKILNDVAK 59

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            D   Y  L+   +A +     +   A  I+  +A D      +R  A       L+   
Sbjct: 60  VDGSNYQYLAKFKLAGMYGE-NEVAKAQSIYADLAADKRLMPELRELAEYLEIIALLKGE 118

Query: 142 SYEEISKILQK-LSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
             + +   +QK LS  S        E + +  LK   +  A  + +E+  + +S
Sbjct: 119 DLDLLKSKVQKFLSTKSEVYKSSIKEAIAVYMLKNNNIDGAIEVIKEIVGNADS 172


>gi|148259764|ref|YP_001233891.1| hypothetical protein Acry_0752 [Acidiphilium cryptum JF-5]
 gi|146401445|gb|ABQ29972.1| Uncharacterized protein-like protein [Acidiphilium cryptum JF-5]
          Length = 247

 Score = 76.2 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 43/218 (19%), Positives = 80/218 (36%), Gaps = 10/218 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIV-------G 54
           E   D  + + +  + +      A     ++L++  W       H++             
Sbjct: 32  EVAEDLRAERTREFLMRYAGAL-AGAAAFVLLAIGGWKAWQWHRHQQDLKAADRYVTLTS 90

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           +   Q   L  S  + DA              Y  L+ +  A++    GD K A +++  
Sbjct: 91  QIGQQEAGLTKSGDIGDA-KRLVDFAGTAPAGYANLARLRAAALYAQAGDLKTAGQLWAA 149

Query: 115 VAN-DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
           VA  +  A   V   A L  A   +      ++   L  L++P NP    A   L +  +
Sbjct: 150 VAAPNSGATPPVHDLALLLLAQHEMGVKPDADVRARLATLNKPGNPWQPLAQLDLALLDM 209

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           K GK + A  + EE++ D  SP  +   +Q ++A +  
Sbjct: 210 KAGKTKSAHGLLEEVSADPASPPNLRNLAQGLIAKLNG 247


>gi|57238975|ref|YP_180111.1| hypothetical protein Erum2440 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578912|ref|YP_197124.1| hypothetical protein ERWE_CDS_02480 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161054|emb|CAH57961.1| putative integral membrane protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417538|emb|CAI26742.1| Hypothetical protein ERWE_CDS_02480 [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 220

 Score = 76.2 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 42/178 (23%), Positives = 78/178 (43%), Gaps = 10/178 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           KW+  L++L+++  A      +  ++K    VG+       L N    D+       I+ 
Sbjct: 33  KWVGLLVLLLLVISAGVLSWINLQNQKTSQRVGDMMYNI--LMNDVGNDEMVKILNDIIK 90

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV--- 138
            +   Y  L+   +ASI       + A  I+ ++AND+     +R  A       L+   
Sbjct: 91  GEKSNYQYLAKFKLASIYSE-DKVEEARVIYAELANDEKLMPELREFARYLEIITLLKMD 149

Query: 139 DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL--AKDNNS 194
           D+   ++  + L  LS+ SN       EI+ IS +K   V+KA  + +E+  A D+++
Sbjct: 150 DSGLLKDRIQKL--LSQKSNVYKSSDKEIVAISMIKDNDVEKAVGVIKEIIGASDSDA 205


>gi|326403268|ref|YP_004283349.1| hypothetical protein ACMV_11200 [Acidiphilium multivorum AIU301]
 gi|325050129|dbj|BAJ80467.1| hypothetical protein ACMV_11200 [Acidiphilium multivorum AIU301]
          Length = 222

 Score = 76.2 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 43/218 (19%), Positives = 80/218 (36%), Gaps = 10/218 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIV-------G 54
           E   D  + + +  + +      A     ++L++  W       H++             
Sbjct: 7   EVAEDLRAERTREFLMRYAGAL-AGAAAFVLLAIGGWKAWQWHRHQQDLKAADRYVTLTS 65

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           +   Q   L  S  + DA              Y  L+ +  A++    GD K A +++  
Sbjct: 66  QIGQQEAGLTKSGDIGDA-KRLVDFAGTAPAGYANLARLRAAALYAQAGDLKTAGQLWAA 124

Query: 115 VAN-DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
           VA  +  A   V   A L  A   +      ++   L  L++P NP    A   L +  +
Sbjct: 125 VAAPNSGATPPVHDLALLLLAQHEMGVKPDADVRARLATLNKPGNPWQPLAQLDLALLDM 184

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           K GK + A  + EE++ D  SP  +   +Q ++A +  
Sbjct: 185 KAGKTKSAHGLLEEVSADPASPPNLRNLAQGLIAKLNG 222


>gi|294677826|ref|YP_003578441.1| hypothetical protein RCAP_rcc02304 [Rhodobacter capsulatus SB 1003]
 gi|294476646|gb|ADE86034.1| conserved hypothetical protein [Rhodobacter capsulatus SB 1003]
          Length = 214

 Score = 76.2 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/201 (17%), Positives = 67/201 (33%), Gaps = 8/201 (3%)

Query: 11  KGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLD 70
           + +       Y WI  + IL ++  + +          +    G+    AL    +    
Sbjct: 17  RDRLFAAFRKYGWIGVVAILGLVGGSAYVEWSKTQRAARAEAFGDGILSAL---EAENPS 73

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT 130
           +A ++      Q       +  +  A+     G    A      VA D   P ++R  A 
Sbjct: 74  EALAALPVAGPQGG-----MRKLLTAAQAAEDGKVDLALADLRAVAGDATLPDSLRQLAR 128

Query: 131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
           L+A  +       E  +  L  L+ P  P    A E   ++AL  G    A     E+  
Sbjct: 129 LKAVLVAGAAMGAEARAAELAALAAPGAPFRLMAMEQQALAALDAGDKDGAIAKAREIMA 188

Query: 191 DNNSPFGISTRSQMILANIIA 211
           ++    G+  R+  ++  +  
Sbjct: 189 EDGVTSGLQQRATELIVALEG 209


>gi|58616971|ref|YP_196170.1| hypothetical protein ERGA_CDS_02440 [Ehrlichia ruminantium str.
           Gardel]
 gi|58416583|emb|CAI27696.1| Hypothetical protein ERGA_CDS_02440 [Ehrlichia ruminantium str.
           Gardel]
          Length = 220

 Score = 76.2 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 41/178 (23%), Positives = 77/178 (43%), Gaps = 10/178 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           KW+  L++L+++  A      +  ++K    VG+       L N    D+       I+ 
Sbjct: 33  KWVGLLVLLLLVISAGVLSWINSQNQKTSQRVGDVMYNI--LMNDVGNDEMVKILNDIIK 90

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV--- 138
            +   Y  L+   +ASI       + A  ++ ++AND+     +R  A       L+   
Sbjct: 91  GEKSNYQYLAKFKLASIYSE-DKVEEARMMYAELANDEKLMPELREFARYLEIITLLKMD 149

Query: 139 DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL--AKDNNS 194
           D    ++  + L  LS+ SN       EI+ IS +K   V+KA  + +E+  A D+++
Sbjct: 150 DAGLLKDRIQKL--LSQKSNVYKSSDKEIVAISMIKDNDVEKAVGVIKEIIGASDSDA 205


>gi|73666867|ref|YP_302883.1| hypothetical protein Ecaj_0236 [Ehrlichia canis str. Jake]
 gi|72394008|gb|AAZ68285.1| conserved hypothetical protein [Ehrlichia canis str. Jake]
          Length = 200

 Score = 75.4 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 72/187 (38%), Gaps = 4/187 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           KW+  + ++ ++  A      +  +EK    +G+    A  L N    D+       +  
Sbjct: 13  KWVCVVAVMSLIVFAGMVSWVNSRNEKVSQHMGDMMYDA--LMNEISDDEMIKILNDVAK 70

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            D   Y  L+   +AS+      T+ A  I+  +A D      +R  A       L+  +
Sbjct: 71  IDESSYQYLAKFKLASMYGE-DKTEEAQSIYADLAADKRLTPELRELAEYLEVITLLKGN 129

Query: 142 SYEEISKILQK-LSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
           + + +   +Q+ LS+ S        E + +S LK   +  A  + +E+    +S   +  
Sbjct: 130 NLDLLKNKVQQFLSKRSEVYTSSIKEAIAVSMLKNNDISGAVGVIKEIVVSADSEPIVYK 189

Query: 201 RSQMILA 207
            +  +L 
Sbjct: 190 NAMDLLQ 196


>gi|159043713|ref|YP_001532507.1| hypothetical protein Dshi_1164 [Dinoroseobacter shibae DFL 12]
 gi|157911473|gb|ABV92906.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 217

 Score = 74.6 bits (182), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 36/205 (17%), Positives = 65/205 (31%), Gaps = 9/205 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    M K  Y WI  L +++I+  A +               G+    AL
Sbjct: 10  EVAEEVRRDRMSRLMRK--YGWIGVLAVVLIVGGAAFNEYRKAQEIAAAQAFGDAVYDAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           E  +      A                    + + +   + GD   AAEI   V  D   
Sbjct: 68  EGSSEQTRLLALQEVNAPEVGAP-------LLGLITAAESTGDPAEAAEILQSVITDPET 120

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   +  A L+   +        E   +L  L   S P    A E   +  ++ G+ + A
Sbjct: 121 PPIYQDLARLRLVLLGDAALPATERRALLDMLILGSGPFRLLALEQRALLEVEAGETEAA 180

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
               +E+ +   +      R+  ++
Sbjct: 181 IATLQEVIRAAGASLAQQQRAAQLV 205


>gi|149204179|ref|ZP_01881147.1| hypothetical protein RTM1035_11675 [Roseovarius sp. TM1035]
 gi|149142621|gb|EDM30666.1| hypothetical protein RTM1035_11675 [Roseovarius sp. TM1035]
          Length = 229

 Score = 74.6 bits (182), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 38/205 (18%), Positives = 72/205 (35%), Gaps = 7/205 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    M +  Y WIA L ILM++  A W        +     +G+    A 
Sbjct: 10  EVTEEVRRDRLFALMRR--YGWIAVLAILMLVGGAAWNEWRKAQDQAAAQALGDAVLAA- 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L   ++   A ++ + I +   +  + ++ +  A       +   A  +   +A+    
Sbjct: 67  -LATEDRSARA-AALDAIEAPGAQAGSVIALLAAAEEAADTPEAAAARLL--ALADRSDV 122

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  ATL+A  +       E     L  L+     +   A E L +  L+ G    A
Sbjct: 123 DAVYRNIATLKAVMLPGSGLDAEARRGRLNGLALSGGVLRLLAEEQLALIDLETGNRDAA 182

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
                 +A D  +  G+  R   ++
Sbjct: 183 LERLGAIASDAEATMGLRRRVTQVI 207


>gi|83952355|ref|ZP_00961086.1| hypothetical protein ISM_09396 [Roseovarius nubinhibens ISM]
 gi|83836028|gb|EAP75326.1| hypothetical protein ISM_09396 [Roseovarius nubinhibens ISM]
          Length = 206

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 43/188 (22%), Positives = 77/188 (40%), Gaps = 9/188 (4%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y WIA L +L+++  A +      +       +G+    ALE       D+A +    + 
Sbjct: 4   YGWIAVLAVLLLVGGAAYNEWRKANERAAAEALGDGILAALEQ------DEAEARVTALQ 57

Query: 81  SQDNK--LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV 138
           + D      + +  +  A   +   D K  AE  + +A     P+  R  ATL+AA+I  
Sbjct: 58  AIDAPDPSADAVVTLLAAGESLGS-DPKATAEALVALAERGDVPMVYRQIATLKAAAIGA 116

Query: 139 DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
           +  + E   ++L  L+  +  +   A E L    ++ G  + A T  E L  D  +  G+
Sbjct: 117 EGLAAETRRELLDGLALGTGTIRVLAEEQLAYLDIETGNQEAALTRLEALYVDAEASEGL 176

Query: 199 STRSQMIL 206
             R   I+
Sbjct: 177 RQRVGQIV 184


>gi|260427043|ref|ZP_05781022.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260421535|gb|EEX14786.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 218

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 42/205 (20%), Positives = 81/205 (39%), Gaps = 6/205 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    +    M +  + W+A LL+L+++  A W        +     +G+    AL
Sbjct: 10  EVTEEVRRDRLFAFMKR--WGWVAVLLVLVLVGGAAWREYTSVRDQAAAQALGDEILAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +   +       S+  +I +        L +M  AS     GD   A +    VA++   
Sbjct: 68  DADEAGAR---VSALSEISAAGPGA-QALIDMLTASEAARAGDADAAEQALEAVASNGDV 123

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P   R  A+ +A S      S E+    L+ L+ P  P+   A E L +  ++ G    A
Sbjct: 124 PEIYREIASYKAFSRSDSGLSAEDRRVGLEALAVPGKPLRLLAEEQLALLEIEQGDTDAA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
               + + +D+ +  G+  R+  ++
Sbjct: 184 TARLQRIIEDSEATAGLRQRASQLI 208


>gi|89054689|ref|YP_510140.1| hypothetical protein Jann_2198 [Jannaschia sp. CCS1]
 gi|88864238|gb|ABD55115.1| hypothetical protein Jann_2198 [Jannaschia sp. CCS1]
          Length = 304

 Score = 73.1 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 32/205 (15%), Positives = 70/205 (34%), Gaps = 8/205 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + +    +    M +  + WI  L+++ I+  A +F   +     +    G+    AL
Sbjct: 30  EVSEEVRRDRLYALMRR--WGWIPILVVIAIVGGAAYFEWQNAQQRAQAEAFGDALLSAL 87

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +  ++     A  + +   ++       +  +  A       D   AA      A     
Sbjct: 88  DNEDTQARVAALEAVDVPSAEAG----IILALLAAGETANGEDRAGAAARLRAAAEAPGV 143

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
                  A L+A  +  D +   E    L+ L+ P  P    A E L +  ++ G +   
Sbjct: 144 ARRYVDLALLKAEML--DPAPEAEARATLEALAAPGAPYSALAEEQLALMEVRAGDLDAG 201

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
                 + +   +  G+  R+  ++
Sbjct: 202 LDRLRAIERSAAATAGLQQRAAQLI 226


>gi|117926863|ref|YP_867480.1| hypothetical protein Mmc1_3589 [Magnetococcus sp. MC-1]
 gi|117610619|gb|ABK46074.1| Tetratricopeptide TPR_2 repeat protein [Magnetococcus sp. MC-1]
          Length = 235

 Score = 71.9 bits (175), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 43/218 (19%), Positives = 82/218 (37%), Gaps = 8/218 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E +      +           WI    I +   LAI+  + D  +  +     + + QAL
Sbjct: 14  EVDEQLAQDRLHKLWENY-KIWIIGSFIGLFAGLAIFVGVRDY-YRAQDQDASDRYIQAL 71

Query: 62  ELFNSNKLDDARSSFEKIL-SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           E  + ++L  A  + + +        Y  LS++  A +L  +GD   A     ++     
Sbjct: 72  EALDKDQLKVAAEALKGLQTKHGEHGYGLLSHLSEAQMLAKQGDFDGAVASLDRLITLAK 131

Query: 121 APL-AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
           A   A+   A + AA +L  +   +     L  + +P +     A E+ G+ A   G  +
Sbjct: 132 AGQPAMADLARINAAYLL--SKQPQRAMVYLDAMRDP-SAYSAHAYELRGVLAQAAGDNK 188

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
            A + +++ A   N P  +S R    +  +   D   K
Sbjct: 189 LALSHYQK-AMQFNPPNTLSQRLMEHMVRMGGMDAVRK 225


>gi|126725457|ref|ZP_01741299.1| hypothetical protein RB2150_04613 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704661|gb|EBA03752.1| hypothetical protein RB2150_04613 [Rhodobacterales bacterium
           HTCC2150]
          Length = 215

 Score = 71.9 bits (175), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 35/214 (16%), Positives = 81/214 (37%), Gaps = 8/214 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N +    +    + K  Y WIA + +++++  A +      S +     +G+    AL
Sbjct: 10  EVNEEVRRDQLYTYLRK--YGWIAAVAVVVLVGGAAYNEYSKASAQSAAQGLGDATMAAL 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            + +     D R++  +I ++       ++ +  A+   A  D   A      + ++  A
Sbjct: 68  SIED---RADQRAALGEIGAEGPSA-EIITLLQGAA--AANNDKPAAIASLTAIIDNADA 121

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               +  A L+   +    +   +   +L  L+ P       A E   +  ++ G V+ A
Sbjct: 122 EEIYKDLARLKLVMLQGADAPAADRIDMLDALAVPGKAFRLIALEQKAVVLVETGDVEGA 181

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
             I +EL  + +    +  R   ++  + A  + 
Sbjct: 182 LVILQELLSEQSLTTDLRQRVTQLIVALGAEPKA 215


>gi|289207921|ref|YP_003459987.1| hypothetical protein TK90_0736 [Thioalkalivibrio sp. K90mix]
 gi|288943552|gb|ADC71251.1| Protein of unknown function DUF2133 [Thioalkalivibrio sp. K90mix]
          Length = 204

 Score = 70.8 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 70/195 (35%), Gaps = 7/195 (3%)

Query: 9   SYKGKCKMGKCCYKWIAPLLI---LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           + + K +  K  +   A  +I   ++ +   I +  + G  E++     + +        
Sbjct: 5   TDEEKAERIKQWWSDNAVAIIAGLVLGIGGLIGWNWWSGHQEERAAGASDMYIAMQGAAQ 64

Query: 66  SNKLDDARSSFEKILSQDNKL-YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +     A    ++++ Q     Y  L+ ++ A + V++GD + A E     A D      
Sbjct: 65  TGNNARAMELADQLIEQGRGTPYRSLAWIFRADLAVSEGDHEAAIEALRS-ARDAAPDRG 123

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R   TL+ A  ++    Y+     L  +            E+ G  A   G    A+  
Sbjct: 124 YRELLTLRMARQMILAEQYDNAESALGDVRRD--AFRGLRLELEGDLARARGDRDLARER 181

Query: 185 FEELAKDNNSPFGIS 199
           + E     ++P  +S
Sbjct: 182 YREALDHGHTPEYLS 196


>gi|88607077|ref|YP_505469.1| hypothetical protein APH_0894 [Anaplasma phagocytophilum HZ]
 gi|88598140|gb|ABD43610.1| conserved hypothetical protein [Anaplasma phagocytophilum HZ]
          Length = 202

 Score = 70.4 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/198 (17%), Positives = 80/198 (40%), Gaps = 8/198 (4%)

Query: 13  KCKMGKCCYKWIAPLLILMILSL--AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLD 70
           + ++G+   ++   ++ +++L+L  +   +  D   EK++   G+     L   + +   
Sbjct: 3   REEIGQFFVRFKGAIMGVVLLALCASGIAFFLDSRSEKQRIKDGDAIYDVLRRNDGS--- 59

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT 130
                  ++ +    +   L+   +A+  V  G   +A E++  +A D      +R  A 
Sbjct: 60  -VEQRLAEVSNTSKGIVARLAKFKLAAGHVRSGSVVSAKELYYDLAADTGLTRELRELAE 118

Query: 131 LQAASILVDTSSYEE-ISKILQKLSEPSNP-MHQFANEILGISALKFGKVQKAKTIFEEL 188
             A  + +D    +E + + L +L+   +      A E L +S L+   V  A  + +E+
Sbjct: 119 YFAIVLSLDGEDIDEALEERLVRLASGKDSIYRSSAKEALIVSELRKNDVDAAVLVMKEV 178

Query: 189 AKDNNSPFGISTRSQMIL 206
             D      I    + +L
Sbjct: 179 LGDPALNMEIRRNVEGLL 196


>gi|326794516|ref|YP_004312336.1| hypothetical protein Marme_1227 [Marinomonas mediterranea MMB-1]
 gi|326545280|gb|ADZ90500.1| Protein of unknown function DUF2133 [Marinomonas mediterranea
           MMB-1]
          Length = 213

 Score = 68.1 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 78/201 (38%), Gaps = 11/201 (5%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGEN-------F 57
           ++  + + + +  K  +K     LIL +      ++ F      +   + E         
Sbjct: 2   SELKTEEEQIEAFKTWWKKNGTALILAVAVGVGGYFGFQAWKTNEATHISEASSLYQTLI 61

Query: 58  AQALEL-FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
             A +L    N+ D A  + +      +  Y   + +++A + V+KG+   A       A
Sbjct: 62  EAASDLDTEKNQKDVAALAAQLNEEYSDTGYAMFAELFVAELEVSKGNYDKAITALEA-A 120

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
                  + +  AT++ A +L +   ++     L+ +++  +      NE+ G   ++ G
Sbjct: 121 VSGTEDQSFQTIATIRIARLLAEKEDFDAALSKLESVTQ--SEFSVQKNELKGDIYVRQG 178

Query: 177 KVQKAKTIFEELAKDNNSPFG 197
           K   A+T +E+  +D  +   
Sbjct: 179 KRDDARTAYEQAKQDLKAGQN 199


>gi|225677202|ref|ZP_03788195.1| hypothetical protein WUni_006950 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590726|gb|EEH11960.1| hypothetical protein WUni_006950 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 204

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 76/204 (37%), Gaps = 17/204 (8%)

Query: 10  YKGKCKMGKCCYKW-------IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
            K K  M K    W       I  L +  +L     + L +  + K+    G+ F + L 
Sbjct: 6   CKSKALMYKYITIWNITMKKYIFLLALAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLF 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L   NK          +L + +  +  L+N   A   ++     + A I+  +A+D  AP
Sbjct: 66  LKKDNK---------PLLEEIDSNWEYLANFERAFNHISDSMPTDTASIYNDLADDKDAP 116

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +R  A       L+  S+ E+I+K      E S      + E + I  +    V+ A 
Sbjct: 117 GVLRELAQYLEVMSLL-HSNGEKINKDKIDNLESSTVYPYSSQEAIAIVKIHNNDVKGAT 175

Query: 183 TIFEELAKDNNSPFGISTRSQMIL 206
            I   L  D   P  I   +Q +L
Sbjct: 176 EILRSLLNDRKCPILIKANAQELL 199


>gi|58698192|ref|ZP_00373113.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630884|ref|YP_002727675.1| hypothetical protein WRi_011980 [Wolbachia sp. wRi]
 gi|58535273|gb|EAL59351.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225592865|gb|ACN95884.1| hypothetical protein WRi_011980 [Wolbachia sp. wRi]
          Length = 204

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 45/204 (22%), Positives = 76/204 (37%), Gaps = 17/204 (8%)

Query: 10  YKGKCKMGKCCYKW-------IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
            K K  M K    W       I  L +  +L     + L +  + K+    G+ F + L 
Sbjct: 6   CKSKALMYKYITIWNITMKKYIFLLALAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLF 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L   NK          +L + +  +  L+N   A   ++     + A I+  +A+D  AP
Sbjct: 66  LKKDNK---------PLLEEIDSNWEYLANFERAFNHISDSMPTDTASIYNDLADDKDAP 116

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +R  A       L+  S+ E+I+K      E S      + E + +  +    V+ A 
Sbjct: 117 GVLRELAQYLEVMSLL-HSNGEKINKDKIDNLESSAVYPYSSQEAIAVVKIHNNDVKGAT 175

Query: 183 TIFEELAKDNNSPFGISTRSQMIL 206
            I   L  D   P  I   +Q +L
Sbjct: 176 EILHSLLNDRKCPILIKANAQELL 199


>gi|84684684|ref|ZP_01012584.1| hypothetical protein 1099457000245_RB2654_02209 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667019|gb|EAQ13489.1| hypothetical protein RB2654_02209 [Rhodobacterales bacterium
           HTCC2654]
          Length = 212

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/173 (13%), Positives = 61/173 (35%), Gaps = 8/173 (4%)

Query: 40  YLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASIL 99
                  +++    G+    A +   ++  +   ++ + + ++ +     +  +  A   
Sbjct: 46  EFLKAREQRQAQATGDAVLAAQD---ADGAEARLAALDGVAAEGDAA-AVIGLIKAAEAE 101

Query: 100 VAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNP 159
                 + A E+   + +D   P   R  ATL+   +     + +E    L  L  P  P
Sbjct: 102 AP----ERADELLAAIESDTSYPALYRDLATLKRVMLPGSPMTADEKVAALDPLLGPGAP 157

Query: 160 MHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
               A E L ++ ++ G  + A      L  D  +   +  R+  ++  +  +
Sbjct: 158 FRVLAEEQLALAEIEAGDAEAALARLNALMDDAEAGDSLRERASQLIVALGGT 210


>gi|307822497|ref|ZP_07652728.1| Protein of unknown function DUF2133 [Methylobacter tundripaludum
           SV96]
 gi|307736101|gb|EFO06947.1| Protein of unknown function DUF2133 [Methylobacter tundripaludum
           SV96]
          Length = 213

 Score = 63.8 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 76/188 (40%), Gaps = 6/188 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      K    +     I  L ++ I+ +  W Y  D    +        + Q 
Sbjct: 1   MYDSEEEQVEALKRWWKENSTATIVGL-VMGIVIILGWNYWQDHKKAQSAQ-ASATYDQL 58

Query: 61  LELFNSNKLDDARSSFEKILSQDNKL-YNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           L+  + NK D      +++  Q     Y   S ++ A +   +GD   A +I   +A + 
Sbjct: 59  LKALDENKNDSVDKLAQRMQEQFKGTEYAAFSGLFQAKLKSQQGDFAAAKQILKTIAAEP 118

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKL-SEPSNPMHQFANEILGISALKFGKV 178
                +   A ++   +++ T  YE+  +++ ++ ++ +       +E++G   +   ++
Sbjct: 119 N--KQLSNIAKIRLVRLMLATGEYEQGLQVINEVDAKAAASYSANYDELVGDLYVALDRL 176

Query: 179 QKAKTIFE 186
            +A+T ++
Sbjct: 177 DEARTSYQ 184


>gi|42521017|ref|NP_966932.1| hypothetical protein WD1220 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410758|gb|AAS14866.1| hypothetical protein WD_1220 [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 204

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 44/204 (21%), Positives = 77/204 (37%), Gaps = 17/204 (8%)

Query: 10  YKGKCKMGKCCY-------KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
            K K  M K          K+I  L +  +L     + L +  + K+    G+ F + L 
Sbjct: 6   CKSKALMYKYITIQNITMKKYIFLLALAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLF 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L   NK          +L + +  +  L+N   A   ++     + A I+  +A+D  AP
Sbjct: 66  LKKDNK---------PLLEEIDSNWEYLANFERAFNHISDSMPTDTASIYNDLADDKDAP 116

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +R  A       L+  S+ E+I+K      E S      + E + +  +    ++ A 
Sbjct: 117 NVLRELAQYLEVMSLL-HSNGEKINKDKIDNLESSTVYPYSSQEAIAVVKIHNNDIKGAT 175

Query: 183 TIFEELAKDNNSPFGISTRSQMIL 206
            I   L  D   P  I   +Q +L
Sbjct: 176 EILRSLLNDRKCPILIKANAQELL 199


>gi|152995387|ref|YP_001340222.1| hypothetical protein Mmwyl1_1358 [Marinomonas sp. MWYL1]
 gi|150836311|gb|ABR70287.1| conserved hypothetical protein [Marinomonas sp. MWYL1]
          Length = 213

 Score = 63.1 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/194 (12%), Positives = 68/194 (35%), Gaps = 11/194 (5%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGEN-------F 57
           ++  + + + +  K  +K    +L++ I      ++ +      + N   E         
Sbjct: 2   SELKTEEEQIEAFKSWWKKNGVMLVVAIAVAVGGYFGWQAWKTSQTNYTSEASALYQNLV 61

Query: 58  AQALELFNSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
             + +L + N         +++     +  Y     +++A +    G    A +      
Sbjct: 62  QASADLSDENNQKTVTFIAKQLADDYGDTGYAMFGQLFLARVDAENGKYDEAIKALDDAI 121

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
                 ++    A L+ A +++    Y      ++K+SE          E++G   +  G
Sbjct: 122 AKTK-DVSFVAIANLRVARLMLQKEDYAGAMARVEKVSEEE--FAAQQQELIGDILISQG 178

Query: 177 KVQKAKTIFEELAK 190
           K   A+  +++ ++
Sbjct: 179 KRDDARVAYQKASE 192


>gi|190571453|ref|YP_001975811.1| hypothetical protein WPa_1067 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190357725|emb|CAQ55175.1| hypothetical protein WP1067 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 205

 Score = 62.7 bits (151), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 44/206 (21%), Positives = 73/206 (35%), Gaps = 20/206 (9%)

Query: 10  YKGKCKMGKCCYKW-------IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
            K K  M K    W       I  L +  +L     + L +  + K+    G+ F + L 
Sbjct: 6   CKSKALMYKYITIWNINMKKYIFLLTLAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLF 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIA-SILVAKGDTKNAAEIFLKVANDDLA 121
           L   NK          +L + +  +  L+N   A + +     T  A+ I+  +A+D  A
Sbjct: 66  LKKDNK---------SLLEEIDSHWEYLANFERAFNHISDSMPTDTASIIYNDLADDKDA 116

Query: 122 PLAVRYAATLQAASILV-DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           P  +R  A       L+  +       KI    S    P    + E + I  +    ++ 
Sbjct: 117 PDVLRELAQYLEVMSLLHSSGEKTNRDKISNLESNAVYPY--SSQEAIAIVKIHSNDIKG 174

Query: 181 AKTIFEELAKDNNSPFGISTRSQMIL 206
           A  I   L  D   P  I   +Q +L
Sbjct: 175 AIEILHSLLNDRECPTLIKANAQELL 200


>gi|58696863|ref|ZP_00372380.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58536925|gb|EAL60101.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila simulans]
          Length = 193

 Score = 61.9 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 75/197 (38%), Gaps = 10/197 (5%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
           YK          K+I  L +  +L     + L +  + K+    G+ F + L L   NK 
Sbjct: 2   YKYITIWNITMKKYIFLLALAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLFLKKDNK- 60

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                    +L + +  +  L+N   A   ++     + A I+  +A+D  AP  +R  A
Sbjct: 61  --------PLLEEIDSNWEYLANFERAFNHISDSMPTDTASIYNDLADDKDAPGVLRELA 112

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
                  L+  S+ E+I+K      E S      + E + +  +    V+ A  I   L 
Sbjct: 113 QYLEVMSLL-HSNGEKINKDKIDNLESSAVYPYSSQEAIAVVKIHNNDVKGATEILHSLL 171

Query: 190 KDNNSPFGISTRSQMIL 206
            D   P  I   +Q +L
Sbjct: 172 NDRKCPILIKANAQELL 188


>gi|238753873|ref|ZP_04615233.1| hypothetical protein yruck0001_6450 [Yersinia ruckeri ATCC 29473]
 gi|238707861|gb|EEQ00219.1| hypothetical protein yruck0001_6450 [Yersinia ruckeri ATCC 29473]
          Length = 206

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 38/188 (20%), Positives = 76/188 (40%), Gaps = 6/188 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y               +F +A E   +N   +  ++ EK   
Sbjct: 23  KALAVGVVLGIGALVGWRYWQSH-QVTALTEASSSFQKASEALAANN-AEGVAAAEKFAQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            ++  Y  L+ + +A   VA+G    AA+    +A  +     +     L+ A + +   
Sbjct: 81  NNSNNYGVLAGLELAHHFVAQGQFDKAAQQL-SLAQGNTKDENLLSLIHLRLARVQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             E+  K L  ++         A +I G + L  G V  A+  + +   ++N+   + + 
Sbjct: 140 KPEDALKTLDAVNGDG--WTAMAQDIRGDALLSKGDVAGARAAYTK-GIESNASQALQSL 196

Query: 202 SQMILANI 209
            +M L N+
Sbjct: 197 LRMKLNNL 204


>gi|99035091|ref|ZP_01314879.1| hypothetical protein Wendoof_01000285 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 182

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 40/185 (21%), Positives = 73/185 (39%), Gaps = 10/185 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L +  +L     + L +  + K+    G+ F + L L   NK          +L 
Sbjct: 3   KYIFLLALAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLFLKKDNK---------PLLE 53

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           + +  +  L+N   A   ++     + A I+  +A+D  AP  +R  A       L+  S
Sbjct: 54  EIDSNWEYLANFERAFNHISDSMPTDTASIYNDLADDKDAPNVLRELAQYLEVMSLL-HS 112

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
           + E+I+K      E S      + E + +  +    ++ A  I   L  D   P  I   
Sbjct: 113 NGEKINKDKIDNLESSTVYPYSSQEAIAVVKIHNNDIKGATEILRSLLNDRKCPILIKAN 172

Query: 202 SQMIL 206
           +Q +L
Sbjct: 173 AQELL 177


>gi|269958961|ref|YP_003328750.1| hypothetical protein ACIS_00923 [Anaplasma centrale str. Israel]
 gi|269848792|gb|ACZ49436.1| hypothetical protein ACIS_00923 [Anaplasma centrale str. Israel]
          Length = 201

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 67/176 (38%), Gaps = 8/176 (4%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
             +   ++F+   E+     G+    AL+       ++   S E++ S        L+  
Sbjct: 26  GASGAAFMFENRREEMLERGGDAMYFALK----GAGEEGIKSLEEV-SHGKGAGAHLAKF 80

Query: 94  YIA-SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS-SYEEISKILQ 151
            +A S +  K D   A +++ K+A        +R  A   +  + V    + +E+   L 
Sbjct: 81  RLAHSYVKDKKDVAAARDMYAKLAAVKGLSRELRELAEYLSVVLSVSLGETGDELESRLM 140

Query: 152 KLSEPSNP-MHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMIL 206
           +L+   +      A E L +  L+   V  A  I  E+  D  S   +   ++ +L
Sbjct: 141 RLASSKDGVYKSSAKEALVVLQLRRNNVNAAVGIMREVLGDTASSPEVRRTAENLL 196


>gi|58584744|ref|YP_198317.1| hypothetical protein Wbm0487 [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58419060|gb|AAW71075.1| Predicted protein [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 181

 Score = 60.4 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 69/186 (37%), Gaps = 13/186 (6%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L +++IL       L +  + K+    G  F + L     NK          +L 
Sbjct: 3   KYIFLLALVLILVGITLHLLHNIDNTKQSITAGNQFYEILFSKKDNK----------LLE 52

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           + +  +  L+N   A   ++     +A  I+  +A++   P  +R  A       L+   
Sbjct: 53  ETDSNWKHLANFEGAFNHISNLTLTDAVSIYSSMADNKDVPNILRELAQYLEIMNLL-HL 111

Query: 142 SYEEI-SKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
           + E+I    +  L          + E + I  +    ++ A  I   L  D   P  I  
Sbjct: 112 NGEKINENKINNLESSI-VYPYSSQEAIAIVKIHNNDIKGAIKILHLLLNDRKCPTLIKD 170

Query: 201 RSQMIL 206
           R+Q +L
Sbjct: 171 RAQELL 176


>gi|85712735|ref|ZP_01043780.1| Uncharacterized conserved membrane protein [Idiomarina baltica
           OS145]
 gi|85693467|gb|EAQ31420.1| Uncharacterized conserved membrane protein [Idiomarina baltica
           OS145]
          Length = 205

 Score = 60.4 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 69/187 (36%), Gaps = 5/187 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+   +    + K    +     IA  +I   L L   +  +D +  + +N     +   
Sbjct: 1   MDQTEEQQVERIKEFWAEHGKGIIAGAII--GLGLFFGWRYYDKATIEAQNTASRGYEAV 58

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   N+ +     ++   I S  N  Y  L+ + +      +GD   A   F  V  D  
Sbjct: 59  VSQLNAGEEGAISNAQNFIKSHQNSQYGYLAALQLGRFAADEGDLATAVTSFQSVI-DGG 117

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   +   A ++ A +L   + Y+    +L    E       FANEI G   +  G   K
Sbjct: 118 ADDNLAAIARVRLARVLAAQAQYQPALDVLN--VELPKAYLAFANEIKGDVYVAQGDTAK 175

Query: 181 AKTIFEE 187
           A+  +E+
Sbjct: 176 AREAYEK 182


>gi|56416623|ref|YP_153697.1| hypothetical protein AM375 [Anaplasma marginale str. St. Maries]
 gi|56387855|gb|AAV86442.1| hypothetical protein AM375 [Anaplasma marginale str. St. Maries]
          Length = 201

 Score = 60.4 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 35/189 (18%), Positives = 77/189 (40%), Gaps = 8/189 (4%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           ++W+  +L+L++L  +   +LF+   E+     G+    AL+       ++   S E++ 
Sbjct: 13  FRWLVVVLVLLVLGASGAAFLFENRREEMFERSGDAVYFALK----GTGEEGIKSLEEVS 68

Query: 81  SQDNKLYNPLSNMYIA-SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
             +      L+   +A S +  K D   A +++ ++A        +R  A   +  + + 
Sbjct: 69  RDEGAG-AHLAKFRLAHSYVKDKKDVAAARDMYAELAAVKGLARELRELAEYLSVVLSMS 127

Query: 140 TS-SYEEISKILQKLSEPSNP-MHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
              +  E+   L  L+   +      A E L +  L+   V  A +I  E+  D  S   
Sbjct: 128 LGETGPELESRLMHLASSKDGVYKSSAKEALVVLQLRRKDVNYAVSIMREILGDTVSSPE 187

Query: 198 ISTRSQMIL 206
           + +  + +L
Sbjct: 188 VKSSVESLL 196


>gi|190574022|ref|YP_001971867.1| putative transmembrane protein [Stenotrophomonas maltophilia K279a]
 gi|190011944|emb|CAQ45565.1| putative transmembrane protein [Stenotrophomonas maltophilia K279a]
          Length = 212

 Score = 59.6 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 35/197 (17%), Positives = 70/197 (35%), Gaps = 12/197 (6%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +    S + +  + K     +  + I +       +  +      K       + +AL  
Sbjct: 8   DEHEQSERVRSWLRKNGASILGGVAIAI--GAIAGWQWYQKDQGGKLASANVEYQKALVG 65

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
              NKLDDA  + + + +  + +Y  L+ + +A   V  G  + A      V        
Sbjct: 66  LQQNKLDDAAKAVKALEAGPSSIYGDLAALQLAKAQVDAGKNEEALATLRAV----KVES 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++  A  + A +LV T   +E  K+L       +     + EI G + +  GK   A+ 
Sbjct: 122 DLQRVADQRVARLLVATGKSDEAIKLL------GSATDSSSLEIHGDALMAQGKRDDARA 175

Query: 184 IFEELAKDNNSPFGIST 200
            +E+  K  +       
Sbjct: 176 QYEKALKSLDVAAPQRR 192


>gi|330446669|ref|ZP_08310321.1| histidyl-tRNA synthetase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490860|dbj|GAA04818.1| histidyl-tRNA synthetase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 203

 Score = 59.6 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 70/175 (40%), Gaps = 4/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +    ++ +  L  W Y     H  K ++  +++ Q +   + N  D    +   I +
Sbjct: 23  KAVVLGAVIGLGGLWGWRYYQSEVHAAK-HVASDSYTQVVSALDENSKDAVAEAKTFIDA 81

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
                Y  L+ + +A + V   D   A E    V N+      +   AT + A I  +  
Sbjct: 82  NKGSQYAVLTALQLAKVQVENKDLNGAVEQLQWVLNNTKDEAIL-PLATTRLARIYAEQQ 140

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
            ++E    L+K++ PS        E+ G   L+ G +  A+  + E  +D +SP 
Sbjct: 141 KFDEALAELKKVTVPS--WKSKVAELRGDILLQKGDITGAREAYVEAQQDGSSPA 193


>gi|84517348|ref|ZP_01004702.1| hypothetical protein SKA53_05930 [Loktanella vestfoldensis SKA53]
 gi|84508828|gb|EAQ05291.1| hypothetical protein SKA53_05930 [Loktanella vestfoldensis SKA53]
          Length = 235

 Score = 59.6 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 68/205 (33%), Gaps = 9/205 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   +    K    + +  Y W+A L++L I+    W                       
Sbjct: 26  EVTEEMRRDKLFGYLRR--YGWVAVLIVLGIVGGTAWNEYRSAQDRAAAQAA-----GDA 78

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            L    + D+A  +              ++ +  AS     G  + AA     +A +   
Sbjct: 79  LLAALAENDEAARATAMAAVSAAGNAAVITALLTASTQQQAGQAEAAAASLSALATNADT 138

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R  A ++AA + V           L  L++P  P    A E +    L+ G    A
Sbjct: 139 TAIYRDLAAIKAAMLPV--GDMPARLAALAPLAQPGQPFRLLALEQMAYLTLETGDQTGA 196

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
             I  ++A+D     G+S R Q +L
Sbjct: 197 VAILRQIAEDAAVTRGLSDRVQTLL 221


>gi|213018854|ref|ZP_03334662.1| hypothetical protein C1A_627 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995805|gb|EEB56445.1| hypothetical protein C1A_627 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 183

 Score = 59.2 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 70/187 (37%), Gaps = 13/187 (6%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L +  +L     + L +  + K+    G+ F + L L   NK          +L 
Sbjct: 3   KYIFLLTLAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLFLKKDNK---------SLLE 53

Query: 82  QDNKLYNPLSNMYIA-SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV-D 139
           + +  +  L+N   A + +     T  A+ I+  +A+D  AP  +R  A       L+  
Sbjct: 54  EIDSHWEYLANFERAFNHISDSMPTDTASIIYNDLADDKDAPDVLRELAQYLEVMSLLHS 113

Query: 140 TSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
           +       KI    S    P    + E + I  +    ++ A  I   L  D   P  I 
Sbjct: 114 SGEKTNRDKISNLESNAVYPY--SSQEAIAIVKIHSNDIKGAIEILHSLLNDRECPTLIK 171

Query: 200 TRSQMIL 206
             +Q +L
Sbjct: 172 ANAQELL 178


>gi|194365438|ref|YP_002028048.1| hypothetical protein Smal_1660 [Stenotrophomonas maltophilia
           R551-3]
 gi|194348242|gb|ACF51365.1| conserved hypothetical protein [Stenotrophomonas maltophilia
           R551-3]
          Length = 212

 Score = 59.2 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 34/197 (17%), Positives = 70/197 (35%), Gaps = 12/197 (6%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +    S + +  + K     +  ++I +       +  +      K       + +AL  
Sbjct: 8   DEHEQSERVRSWLRKNGASILGGVVIAI--GAIAGWQWYQKDQGGKLASANVEYQKALVG 65

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
              NKLDDA  + + + +  + +Y  L+ + +A   V  G  + A      V        
Sbjct: 66  LQQNKLDDASKAVKALEAGPSSIYGDLAALQLAKAQVDAGKNEEALATLRAV----KVEG 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++     + A +LV T   +E  K+L       +     + EI G + +  GK   A+ 
Sbjct: 122 DLQRVVDQRVARLLVATGKSDEAIKLL------GSATDSSSLEIHGDALMAQGKRDDARA 175

Query: 184 IFEELAKDNNSPFGIST 200
            +E+  K  +       
Sbjct: 176 QYEKALKSLDVAAPQRR 192


>gi|15603871|ref|NP_246945.1| hypothetical protein PM2006 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12722448|gb|AAK04090.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 788

 Score = 59.2 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 42/203 (20%), Positives = 73/203 (35%), Gaps = 6/203 (2%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            +  +     L+    L  AI  Y      +  +         AL      + D A  + 
Sbjct: 75  AQAQFNLAGILVEKGALDKAIATYCAISREDDPEAYAKAQLQLALIWAEKGEPDKAIKAC 134

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
             +L +DN      +   +A I V K +   A E +  +  +D  P A    A  Q A I
Sbjct: 135 NSVLREDNPEAYAKAQFQLAFIFVEKNERDKAIEAYEAILREDS-PEAYAQ-AQFQLALI 192

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQF-ANEILGISALKFGKVQKAKTIFEELAKDNNSP 195
             +    ++  K    +    NP     A   L    ++  +  KA   +E + ++ +SP
Sbjct: 193 WAEKGEPDKAIKACNSVLREDNPEAYAKAQFQLAFIFVEKNERDKAIEAYEAILRE-DSP 251

Query: 196 FGISTRSQMILANIIAS-DQRNK 217
              + ++Q  LA I A    +NK
Sbjct: 252 EAYA-KAQFQLALIWAEKGDKNK 273



 Score = 57.3 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 37/158 (23%), Positives = 60/158 (37%), Gaps = 5/158 (3%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
            F  A  L    +LD A  ++  I   D       +   +A ILV KG    A   +  +
Sbjct: 42  QFNLASILREKGELDKAIETYRTISRGDIPKVYAQAQFNLAGILVEKGALDKAIATYCAI 101

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF-ANEILGISALK 174
           +  +  P A    A LQ A I  +    ++  K    +    NP     A   L    ++
Sbjct: 102 SR-EDDPEAYAK-AQLQLALIWAEKGEPDKAIKACNSVLREDNPEAYAKAQFQLAFIFVE 159

Query: 175 FGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
             +  KA   +E + ++ +SP   +  +Q  LA I A 
Sbjct: 160 KNERDKAIEAYEAILRE-DSPEAYAQ-AQFQLALIWAE 195



 Score = 55.4 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 57/150 (38%), Gaps = 3/150 (2%)

Query: 45  SHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
             +  +      F  A      N+ D A  ++E IL +D+      +   +A I   KG+
Sbjct: 139 REDNPEAYAKAQFQLAFIFVEKNERDKAIEAYEAILREDSPEAYAQAQFQLALIWAEKGE 198

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF- 163
              A +    V  +D  P A    A  Q A I V+ +  ++  +  + +    +P     
Sbjct: 199 PDKAIKACNSVLREDN-PEAYAK-AQFQLAFIFVEKNERDKAIEAYEAILREDSPEAYAK 256

Query: 164 ANEILGISALKFGKVQKAKTIFEELAKDNN 193
           A   L +   + G   KA   +  + +++N
Sbjct: 257 AQFQLALIWAEKGDKNKAIKAYRSVLREDN 286



 Score = 55.0 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 55/150 (36%), Gaps = 3/150 (2%)

Query: 45  SHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
             +  +      F  A      N+ D A  ++E IL +D+      +   +A I   KGD
Sbjct: 211 REDNPEAYAKAQFQLAFIFVEKNERDKAIEAYEAILREDSPEAYAKAQFQLALIWAEKGD 270

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF- 163
              A + +  V  +D  P A    A    A +L   S  ++  K    +    +P     
Sbjct: 271 KNKAIKAYRSVLREDN-PDAYAK-AQFNLAFLLSKKSELDKAIKACNSVLREDSPEAYAK 328

Query: 164 ANEILGISALKFGKVQKAKTIFEELAKDNN 193
           A   L +   + G   KA   +  + +++N
Sbjct: 329 AQFQLALIWAEKGDKNKAIKAYRSVLREDN 358



 Score = 51.9 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 51/128 (39%), Gaps = 4/128 (3%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           F QA + ++    + A   F KI   D  LY  L+   +ASIL  KG+   A E +  ++
Sbjct: 8   FDQAKQAYDDGNFEKAIELFNKINPHDKALY-FLAQFNLASILREKGELDKAIETYRTIS 66

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF-ANEILGISALKF 175
                P      A    A ILV+  + ++       +S   +P     A   L +   + 
Sbjct: 67  R-GDIPKVYAQ-AQFNLAGILVEKGALDKAIATYCAISREDDPEAYAKAQLQLALIWAEK 124

Query: 176 GKVQKAKT 183
           G+  KA  
Sbjct: 125 GEPDKAIK 132



 Score = 37.7 bits (86), Expect = 1.2,   Method: Composition-based stats.
 Identities = 13/76 (17%), Positives = 27/76 (35%)

Query: 45  SHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
             +  +      F  AL        + A  ++  +L +DN      +   +A I + K +
Sbjct: 319 REDSPEAYAKAQFQLALIWAEKGDKNKAIKAYRSVLREDNPEAYAKAQFQLACIFIEKDE 378

Query: 105 TKNAAEIFLKVANDDL 120
              A +    V ++D 
Sbjct: 379 PDKAIKACNSVLHEDN 394


>gi|21231433|ref|NP_637350.1| hypothetical protein XCC1985 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768513|ref|YP_243275.1| hypothetical protein XC_2199 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991679|ref|YP_001903689.1| hypothetical protein xccb100_2285 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21113103|gb|AAM41274.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573845|gb|AAY49255.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167733439|emb|CAP51640.1| Putative membrane protein [Xanthomonas campestris pv. campestris]
          Length = 212

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 52/149 (34%), Gaps = 10/149 (6%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +   +          +   ++      LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQKRNTTASVEANARYEAVVKSIQGKDLDKAAKDIVALDDGKGGVYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            +  G T  A +       D  A   ++     + A +L D+   +E  K+L    +   
Sbjct: 101 QMDAGKTAEAIKTL----RDVPAEGELKQIVQQRLARVLTDSGKPDEAIKLLADAQD--- 153

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEE 187
                + EI   + +K GK  +A+ ++ +
Sbjct: 154 ---HTSLEIRADALVKQGKRDEARALYTK 179


>gi|222474989|ref|YP_002563404.1| hypothetical protein AMF_275 [Anaplasma marginale str. Florida]
 gi|255002969|ref|ZP_05277933.1| hypothetical protein AmarPR_01471 [Anaplasma marginale str. Puerto
           Rico]
 gi|255004097|ref|ZP_05278898.1| hypothetical protein AmarV_01626 [Anaplasma marginale str.
           Virginia]
 gi|222419125|gb|ACM49148.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 201

 Score = 58.1 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 66/176 (37%), Gaps = 8/176 (4%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
             +   +LF+   E+     G+    AL+       ++   S E++   +      L+  
Sbjct: 26  GASGAAFLFENRREEMFERSGDAVYFALK----GTGEEGIKSLEEVSRDEGAG-AHLAKF 80

Query: 94  YIA-SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS-SYEEISKILQ 151
            +A S +  K D   A +++ ++A        +R  A   +  + +    +  E+   L 
Sbjct: 81  RLAHSYVKDKKDVAAARDMYAELAAVKGLARELRELAEYLSVVLSMSLGETGPELESRLM 140

Query: 152 KLSEPSNP-MHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMIL 206
            L+   +      A E L +  L+   V  A +I  E+  D  S   + +  + +L
Sbjct: 141 HLASSKDGVYKSSAKEALVVLQLRRKDVNYAVSIMREILGDTASSPEVKSSVESLL 196


>gi|90579363|ref|ZP_01235173.1| hypothetical protein VAS14_06638 [Vibrio angustum S14]
 gi|90440196|gb|EAS65377.1| hypothetical protein VAS14_06638 [Vibrio angustum S14]
          Length = 203

 Score = 58.1 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 68/175 (38%), Gaps = 4/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +    ++ +  L  W Y     H  K +   +++ Q +   + N  D    +   I +
Sbjct: 23  KAVVLGAVIGLGGLWGWRYYQSEVHAAK-HAASDSYTQVVSALDENSKDAVAEAKTFIDA 81

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
                Y  L+ + +A + V   D   A      V N+      +   AT + A I  +  
Sbjct: 82  NKGSQYAVLTALQLAKVQVDNKDLDGAVTQLQWVLNNTKDEAIL-PLATTRLARIYAEQQ 140

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
            ++E    L+K++ PS        E+ G   L+ G +  A+  + E  ++ +SP 
Sbjct: 141 KFDEALAELKKVTVPS--WKSKVAELRGDILLQKGDITGAREAYVEAQQEGSSPA 193


>gi|114332131|ref|YP_748353.1| hypothetical protein Neut_2166 [Nitrosomonas eutropha C91]
 gi|114309145|gb|ABI60388.1| conserved hypothetical protein [Nitrosomonas eutropha C91]
          Length = 212

 Score = 58.1 bits (139), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 29/206 (14%), Positives = 77/206 (37%), Gaps = 8/206 (3%)

Query: 9   SYKGKCKMGKCCYKWIAPLLILMIL---SLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
             + K    K  +      L+L I+   ++ +   L++    ++     + +    +   
Sbjct: 7   EEQEKIDRLKAWWSANGATLLLTIVVFAAVVVGTRLWNHYKGEQARQAADLYTVLQQQVE 66

Query: 66  SNKLDDARSSFEKILSQDNKL--YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
                +  +   ++L Q      Y   + +  A   V  G+ ++A ++   V +    P 
Sbjct: 67  KGSEFEKITDAAQLLIQGFPGSGYASRAALIAAHSAVQAGNNQSARDMLQWVLDHTEEPE 126

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
             +  A ++ A++LVD   Y++   +L   ++          ++ G +    GK+ +A+ 
Sbjct: 127 V-KDLARIRLANVLVDEGKYDQALSLLN--AQHGASFTGLYADLRGDALAASGKIDEARA 183

Query: 184 IFEELAKDNNSPFGISTRSQMILANI 209
            +++     ++        QM L  +
Sbjct: 184 AYQKALDSLDTQGAYRNVVQMKLDAL 209


>gi|319943738|ref|ZP_08018019.1| tetratricopeptide repeat protein [Lautropia mirabilis ATCC 51599]
 gi|319742971|gb|EFV95377.1| tetratricopeptide repeat protein [Lautropia mirabilis ATCC 51599]
          Length = 213

 Score = 57.7 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 60/155 (38%), Gaps = 7/155 (4%)

Query: 28  LILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ-DNKL 86
           L ++ L++   +  ++  H+ +       +A  L   +S K++  R  ++ I     + +
Sbjct: 28  LAVIALAVFAGWRAWNWYHDSQAQDAAREYAGLLSAADSGKIEQVRERYDAIQKGYGSSV 87

Query: 87  YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEI 146
           Y  ++ +  A           A      V  +   P   +  A ++ A +L+D   Y+E 
Sbjct: 88  YAGMAGLRAAEAFAKANQPDAAVAALESVMKNSTEP-GFKPIAGVRLAGLLLDQKKYDEA 146

Query: 147 SKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           +K     +  S  +   + E+    A + G +  A
Sbjct: 147 TK-----AIDSGNIGPVSGEMAASVADRRGDILAA 176


>gi|242240153|ref|YP_002988334.1| hypothetical protein Dd703_2735 [Dickeya dadantii Ech703]
 gi|242132210|gb|ACS86512.1| conserved hypothetical protein [Dickeya dadantii Ech703]
          Length = 208

 Score = 57.7 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 79/189 (41%), Gaps = 6/189 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE-LFNSNKLDDARSSFEKIL 80
           K +A  ++L + +L  W +  +   E         + QA++ L  +    +  +  ++  
Sbjct: 23  KALAVGVVLGVGALVGWRFWQNH-QESTAMASSMAYQQAMDTLTAAAGKPEGIAGIQQFA 81

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
           ++++  Y+ L+++ +A     + D   A +   +  +       ++    L+ A +L+  
Sbjct: 82  AEEHGSYSALASLSLARQYADQNDFPKAEQQLRQALSQTK-DADLQTIVNLRLARVLLQQ 140

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
              ++  K L   +  S      A ++ G + +  G  Q A+  + +    +N P G+ +
Sbjct: 141 KKADDALKTLD--AVKSAGWLAMAADVRGDALVSKGDTQGARDAYNQ-GIASNPPQGLQS 197

Query: 201 RSQMILANI 209
             +M L N+
Sbjct: 198 ILRMKLNNL 206


>gi|254523546|ref|ZP_05135601.1| Tetratricopeptide repeat family protein [Stenotrophomonas sp.
           SKA14]
 gi|219721137|gb|EED39662.1| Tetratricopeptide repeat family protein [Stenotrophomonas sp.
           SKA14]
          Length = 212

 Score = 57.7 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 34/197 (17%), Positives = 70/197 (35%), Gaps = 12/197 (6%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +    S + +  + K     +  ++I +       +  +      K       + +AL  
Sbjct: 8   DEHEQSERVRSWLRKNGASILGGVVIAI--GAIAGWQWYQKDQGGKLASANVEYQKALLG 65

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
              NKLDDA  + + + +  + +Y  L+ + +A   V  G  + A      V        
Sbjct: 66  LQQNKLDDASKAVKALEAGPSSIYGDLAALQLAKAQVDAGKNEEALATLRGV----KVEG 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++     + A +LV T   +E  K+L       +     + EI G + +  GK   A+ 
Sbjct: 122 DLQRVVDQRVARLLVATGKSDEAIKLL------GSAADSSSLEIHGDALMAQGKRDDARA 175

Query: 184 IFEELAKDNNSPFGIST 200
            +E+  K  +       
Sbjct: 176 QYEKALKSLDVAAPQRR 192


>gi|198283715|ref|YP_002220036.1| hypothetical protein Lferr_1607 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218665406|ref|YP_002426344.1| hypothetical protein AFE_1935 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198248236|gb|ACH83829.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218517619|gb|ACK78205.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 203

 Score = 57.7 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 70/186 (37%), Gaps = 4/186 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL-SQD 83
               I+++L  A+ F+ ++     +       + + ++   + +   AR+S + ++    
Sbjct: 17  VIAGIIIVLLAAMGFFGYEKYQRHQVERAAVLYNELVDTLVAGQTSTARASADTLVHQYG 76

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
           +  Y   +  ++A +         A      V     AP  ++  ATL  A + +D    
Sbjct: 77  HTPYAIFARFFLARMDSESNQIPAAEAELNSVIQAKNAPRGLKSIATLSLARLYLDQ--- 133

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           ++  K L  L  P        NEI G + +   +  KA   ++       +     +  Q
Sbjct: 134 KQAQKALDMLKAPDAAFATLQNEIQGDAYVALHQDGKAMRAYQAAIAALPAADPYRSYLQ 193

Query: 204 MILANI 209
           M +ANI
Sbjct: 194 MKMANI 199


>gi|289666004|ref|ZP_06487585.1| hypothetical protein XcampvN_23760 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289670464|ref|ZP_06491539.1| hypothetical protein XcampmN_18748 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 212

 Score = 57.3 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/184 (14%), Positives = 64/184 (34%), Gaps = 12/184 (6%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +      + +  + K     +    IL+ L+L + +  +      +       +   ++ 
Sbjct: 8   DEHEQGERVRSWLRKNGAGLVGG--ILVGLALILGWQWWQKHTNTELVEANTRYQAVVKS 65

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             +  LD A      +      +Y  L+ + +A   V  G    A +    V  +     
Sbjct: 66  IQAKDLDKAAKDIVALDDGKGGIYAELAALRLAKAQVDAGKNAEAIKTLRDVPAEGELKQ 125

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            V+     + A +L ++   +E  K+L    +        + EI   + +  GK  +A+ 
Sbjct: 126 IVQQ----RLARVLTESGKPDEAIKLLADAQD------HASLEIRADALVAQGKPDEARA 175

Query: 184 IFEE 187
           ++ +
Sbjct: 176 LYTK 179


>gi|89072704|ref|ZP_01159269.1| hypothetical protein SKA34_19279 [Photobacterium sp. SKA34]
 gi|89051524|gb|EAR56978.1| hypothetical protein SKA34_19279 [Photobacterium sp. SKA34]
          Length = 203

 Score = 56.9 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 38/175 (21%), Positives = 70/175 (40%), Gaps = 4/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +    ++ +  L  W Y     H  K +I  +N+ Q +   + N  D    +   I +
Sbjct: 23  KAVVLGAVIGLGGLWGWRYYQSEVHVAK-HIASDNYTQVVSALDENSKDAVAEAKTFIDA 81

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
             +  Y  L+ + +A + V   D   A E    V N       +   AT + A I  +  
Sbjct: 82  NKDSQYAVLTALQLAKVQVDNKDLDGAVEQLQWVINHTKDEAIL-PLATTRLARIYAEQQ 140

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
            ++E    L+K++ PS        E+ G   L+ G +  A+  + E  ++ +SP 
Sbjct: 141 KFDEALAELKKVTVPS--WKSKVAELRGDILLQKGDINGAREAYVEAQQEGSSPA 193


>gi|254449221|ref|ZP_05062670.1| conserved hypothetical protein [gamma proteobacterium HTCC5015]
 gi|198261198|gb|EDY85494.1| conserved hypothetical protein [gamma proteobacterium HTCC5015]
          Length = 220

 Score = 56.9 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 38/195 (19%), Positives = 74/195 (37%), Gaps = 5/195 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
           A L +++ LS    +Y +      ++      F + L     +  D+A +  ++++S   
Sbjct: 26  AVLGVVLGLSGLFGWYQWQDYQGGQQAGASAVFTELLRGVQEDNTDNAPALADQLVSDYA 85

Query: 85  KL-YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y  L  +  A + V  GD + AA     V  D+ +       ATL+ A + +     
Sbjct: 86  GTHYANLGQLAAARVAVEAGDLETAASRLQWVV-DNASASHFEQVATLRLAQLALGQDQL 144

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
            +  ++L       +     A E+ G  A+  G    A+  ++  A +   P     R +
Sbjct: 145 AKAEQLLSG--TFPSSYMAIAEELRGDLAVAQGDSNAARVAYDR-ALNAELPLQNPMRVE 201

Query: 204 MILANIIASDQRNKK 218
           M   N+   D  N +
Sbjct: 202 MKRDNLGNVDLTNTE 216


>gi|238921037|ref|YP_002934552.1| membrane protein [Edwardsiella ictaluri 93-146]
 gi|238870606|gb|ACR70317.1| membrane protein [Edwardsiella ictaluri 93-146]
          Length = 206

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 31/185 (16%), Positives = 64/185 (34%), Gaps = 6/185 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  +      +    +     +  ++I  I +L  W Y              +++  A E
Sbjct: 5   STENEQVDAIRHFFQEYGKTLVVGVVI-GIGALLGWRYWVGHQQANMAQ-ASQSYQLASE 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +  K D    S E  + ++   Y  L+ + +A   V K D   A       A      
Sbjct: 63  ALSGGKKDGVMLS-EAFIKENGNNYGVLAALQLAQYEVEKSDFAKAQTQL-AWAEGQAKD 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
           + ++  + L+ A + +  +  +   K L  ++         A +I G   LK G  + A+
Sbjct: 121 VNLKALSNLRLARVQLQENQLDAALKTLDGVTAKG--WQPLAQDIRGDVLLKKGDAKGAR 178

Query: 183 TIFEE 187
             + +
Sbjct: 179 EAYSK 183


>gi|238758837|ref|ZP_04620010.1| hypothetical protein yaldo0001_24180 [Yersinia aldovae ATCC 35236]
 gi|238702945|gb|EEP95489.1| hypothetical protein yaldo0001_24180 [Yersinia aldovae ATCC 35236]
          Length = 206

 Score = 56.5 bits (135), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 69/188 (36%), Gaps = 6/188 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y     +          + QA     +N  D    + EK + 
Sbjct: 23  KALAVGVVLGIGALVGWRYWQSHQNTAMTEASS-AYQQASNALLANSADGVAIA-EKFVQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y  L+ + +A   V +G+   A +   +          +     L+ A + +   
Sbjct: 81  GNKNNYGVLAGLELAHHFVEQGEFDKATQQLSQALGQTKDENLL-SLINLRLARVQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             ++  K L  +          A ++ G + L  G +  A+  + +   ++N+   +   
Sbjct: 140 KPDQALKTLDAVQGDG--WTAMAQDVRGDALLSKGDIAGARAAYSK-GVESNASQALQAL 196

Query: 202 SQMILANI 209
            +M L N+
Sbjct: 197 LRMKLNNL 204


>gi|285018366|ref|YP_003376077.1| hypothetical protein XALc_1588 [Xanthomonas albilineans GPE PC73]
 gi|283473584|emb|CBA16087.1| hypothetical protein, tpr repeat protein [Xanthomonas albilineans]
          Length = 212

 Score = 56.5 bits (135), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/184 (13%), Positives = 65/184 (35%), Gaps = 12/184 (6%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +    S + +  + K     I  +   + L   + +  +     +        +   L+ 
Sbjct: 8   DEHEQSERVRTWLRKNGAGLIGGIA--LGLGAILGWQWWAKQRSENLAQANSRYEAVLKS 65

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             + +LD A     ++    + +Y  L+ + +A      G +  A      +  D     
Sbjct: 66  IEAKQLDKAGKDLTQLQQGSSDIYVVLAGLRLAKAQADAGKSDAALATLRALKADG---- 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++     + A +L+     E+  K+L   ++ +  +     EI G + +  GK   A+ 
Sbjct: 122 EIKRLVDQRMAFLLLQAGKPEDALKLLAS-ADDTRSL-----EIRGDALIAQGKRDAARD 175

Query: 184 IFEE 187
           ++ +
Sbjct: 176 VYVK 179


>gi|270264727|ref|ZP_06192992.1| tetratricopeptide TPR_4 [Serratia odorifera 4Rx13]
 gi|270041410|gb|EFA14509.1| tetratricopeptide TPR_4 [Serratia odorifera 4Rx13]
          Length = 206

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 59/162 (36%), Gaps = 4/162 (2%)

Query: 26  PLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNK 85
            + +++ +   + +  +            +++ +A +   + K DD  ++ E     ++ 
Sbjct: 26  AVGVVLGIGALVGWRFWQNHQNSNMMAASQSYQEASDHLAAGKPDDVSAA-EAFAKANSN 84

Query: 86  LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE 145
            Y  L+++ +A   V + D   A +  +           +    +L+ A + +     +E
Sbjct: 85  SYGVLASLELAKHFVEQNDFAKAEQQLVLAQGQTKDDNLL-AMVSLRLARVQLQEKKLDE 143

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
             K L  +          A +  G + L  G  + A+  + +
Sbjct: 144 ALKTLDGVKGEG--WAAMAQDARGDALLAKGDTKGAREAYSK 183


>gi|304322073|ref|YP_003855716.1| hypothetical protein PB2503_12684 [Parvularcula bermudensis
           HTCC2503]
 gi|303300975|gb|ADM10574.1| hypothetical protein PB2503_12684 [Parvularcula bermudensis
           HTCC2503]
          Length = 260

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 40/215 (18%), Positives = 79/215 (36%), Gaps = 8/215 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E ++D    K      +     +    I+ +   A  F +     ++        F++A+
Sbjct: 10  EVDDDLLQDKVMATARRYGPLALGAAAIVTVAVGA--FSITQSRGDRAAVERATLFSEAV 67

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                ++   A          D  LY  ++ M  A+ L  +G    AA     +A D   
Sbjct: 68  AAAEQDESAGAAIMLAAADRLD-GLYQRMAEMQAAAYLAREGLGAEAATELQAIAADGSL 126

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P+ +R  A L+A  I+ D     +++  L      +  M   A E+  +  L+  K   A
Sbjct: 127 PMRLRDVARLKAGYIMADLDQ--DVAARLAA-DVETPAMKGLARELEALILLEQEKYGDA 183

Query: 182 KTIFEELAKDNNSP--FGISTRSQMILANIIASDQ 214
                +LA+   +    G++ R++++     A  Q
Sbjct: 184 YAALTDLAEGQGAGVTAGLAARARLLAPVADAGRQ 218


>gi|88812663|ref|ZP_01127910.1| hypothetical protein NB231_00720 [Nitrococcus mobilis Nb-231]
 gi|88790079|gb|EAR21199.1| hypothetical protein NB231_00720 [Nitrococcus mobilis Nb-231]
          Length = 213

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 70/190 (36%), Gaps = 6/190 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + +    + +   G+     IA ++I ++ S+  W         ++        A   +L
Sbjct: 6   SEEEQIDQIRRWWGEYGRSVIAGVIIALV-SILGWQQWHGYRDRQELAAAAAYQALVADL 64

Query: 64  FNSNKLDDARSSFEKILSQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
            +      A+S  E++ S+     Y  L+ + +A   V + D + A +   + A D    
Sbjct: 65  GD-GNTAAAKSQAEQLQSEHEGSAYAVLAALQMAGQYVKQDDLQAAGKAL-RWAVDHTQL 122

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
            A++  A L+ A +L+     +   ++ Q    P +       E++G   +       A 
Sbjct: 123 PALQTIARLRLARVLLGAGDAKAALQVAQP--VPKDAFAGQFQELIGDIHIAQSDQASAI 180

Query: 183 TIFEELAKDN 192
             ++    D 
Sbjct: 181 KAYQAALADG 190


>gi|290475997|ref|YP_003468893.1| hypothetical protein XBJ1_3005 [Xenorhabdus bovienii SS-2004]
 gi|289175326|emb|CBJ82129.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004]
          Length = 206

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 35/188 (18%), Positives = 73/188 (38%), Gaps = 6/188 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K++A  L+L I  LA W Y        +       F +  +   S    ++  + EK  +
Sbjct: 23  KYLAVGLVLGIGVLAGWHYWQSH-QTNQLQDTAATFEKLNKSLESG-SKESVVATEKFAN 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           + N +Y  +++M +A   V + D   A +  L  A+       ++  A+++ A +     
Sbjct: 81  ETNNIYGVMADMDLAKRAVEQNDLAQAEKRLLA-ASGKAKDENMQALASIRLARVQFAED 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             +   K L+++             I G    K G +  A+  +     + + P  + + 
Sbjct: 140 KTDAALKTLEQVKGKG--WLVAVENIRGDILTKKGDIAGARAAYSR-GLEADGPQSLKSS 196

Query: 202 SQMILANI 209
            Q+ L N+
Sbjct: 197 IQIKLNNL 204


>gi|37525334|ref|NP_928678.1| hypothetical protein plu1378 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784761|emb|CAE13671.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 206

 Score = 55.4 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 76/184 (41%), Gaps = 5/184 (2%)

Query: 26  PLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNK 85
            L +++     I +  +      +     E F + ++        ++ ++ EK  S+ N 
Sbjct: 26  VLGLVLGAGALIGWRYWQSHQTNQLQESAEAFER-VDRGLITSTKESHTAAEKFASETNN 84

Query: 86  LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE 145
            Y  +++M++A + V K +   A + FL  A   +    ++    ++ A + +     + 
Sbjct: 85  SYGVMAHMHLAQLAVEKNELTKADQ-FLSAATGQVKNEDLQALVNIRLARVQLAEDKADA 143

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
             K L++     +     A +I G + +K G +  A+  + +    +NSP  I +   + 
Sbjct: 144 ALKTLEQ--VKGSGWVGVAEDIRGDALVKKGDIAGARAAYTK-GLSSNSPQAIKSMLNLK 200

Query: 206 LANI 209
           L N+
Sbjct: 201 LNNL 204


>gi|332141962|ref|YP_004427700.1| putative membrane-associated protein with TPR-like domain
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|327551984|gb|AEA98702.1| putative membrane-associated protein with TPR-like domain
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 206

 Score = 55.4 bits (132), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 60/180 (33%), Gaps = 7/180 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  +      K    +     I     L +  L  W Y  +   E K       +  A+E
Sbjct: 5   ATEEQQVEAIKRFWKEHGTAIIVGAA-LGLGGLWGWRYYSETQIESK-EAASVAYQNAVE 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
            F S   D   ++F  I    +  Y  ++ +  A   V  GD   AA     V       
Sbjct: 63  TFGSEGSDAKVNAF--IEENKDSGYASIAGLLAAKQAVDAGDLDAAASHLNSVV-TFAEN 119

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++  A+L+ + + ++ +  +     L  ++          +E+ G    K GK   A+
Sbjct: 120 DELKVLASLRLSRVQIEMNQLDAALSTLSNVTND--AFSAEVSELKGDVYQKQGKFDDAR 177


>gi|284006776|emb|CBA72039.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 206

 Score = 55.0 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 62/160 (38%), Gaps = 5/160 (3%)

Query: 28  LILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLY 87
           L++ + ++  W Y              ++F Q      +     A ++ E+  ++ N +Y
Sbjct: 29  LVIGVGAIIGWNYWQSH-QANSLQESAQSFEQISSQLQTGSN-QALAAAEQFANETNNIY 86

Query: 88  NPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEIS 147
             L+N+ +A I V K D   A +  LK          ++    ++ A + +  +  ++  
Sbjct: 87  GVLTNIELAKIAVEKNDIAGAEKALLKALTIAKVDD-LKDLLNVRLARVQLALNKPDQAL 145

Query: 148 KILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
             L ++ +          +I G   LK G +  A+  + +
Sbjct: 146 ISLTQVQDKG--WSSIVEDIRGDILLKKGDIASARAAYSK 183


>gi|332140451|ref|YP_004426189.1| putative membrane-associated protein with TPR-like domain
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550473|gb|AEA97191.1| putative membrane-associated protein with TPR-like domain
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 206

 Score = 55.0 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 60/180 (33%), Gaps = 7/180 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  +      K    +     I     L +  L  W Y  +   E K       +  A+E
Sbjct: 5   ATEEQQVEAIKRFWKEHGTAIIVGAA-LGLGGLWGWRYYSETQIESK-EAASVAYQNAVE 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
            F S   D   ++F  I    +  Y  ++ +  A   V  GD   AA     V       
Sbjct: 63  TFGSEGSDAKVNAF--IEENKDSGYASIAGLLAAKQAVDAGDLDAAASHLNSVV-TFAEN 119

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++  A+L+ + + ++ +  +     L  ++          +E+ G    K GK   A+
Sbjct: 120 DELKVLASLRLSRVQIEMNQLDAALSTLSNVTND--AFSAEISELKGDVYQKQGKFDDAR 177


>gi|4033490|sp|O52728|YA57_ACTAC RecName: Full=UPF0070 protein 1057
 gi|2921819|gb|AAC04858.1| hypothetical protein 1057 [Aggregatibacter actinomycetemcomitans]
          Length = 204

 Score = 55.0 bits (131), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 61/174 (35%), Gaps = 4/174 (2%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           YK+I    ++    +  W Y       +K +     + QAL  +  +    A    + I 
Sbjct: 22  YKFIIVCFVIAFGGVFGWNYWQSH-QIQKMHKASAEYEQALFNYQKDPKAQAEQFNQFIK 80

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
           + +   Y  L+ +  A I V   D   A +   +          +   + L+ AS+    
Sbjct: 81  NNEKTSYAVLALLDKAKIAVENKDFPLAEDALKQAMAQSNDD-ILSSVSALRLASVQFQL 139

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
              +   + L+  S      +   N + G   L  G  + AK  +++  ++  +
Sbjct: 140 GQLDPALESLK--SVKEQAWNSAKNLLAGDIQLAKGDKETAKKSYQQAQENAGA 191


>gi|257093697|ref|YP_003167338.1| hypothetical protein CAP2UW1_2113 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257046221|gb|ACV35409.1| conserved hypothetical protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 227

 Score = 54.6 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 35/185 (18%), Positives = 77/185 (41%), Gaps = 12/185 (6%)

Query: 9   SYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGEN------FAQALE 62
             + +    K  +K    LL+ ++ + +I    + G +  ++N   +         +A+ 
Sbjct: 7   EEQEQIAEIKAWWKQYGNLLLGIVTAASIGVIAWQGWNWYQRNQAAQASMVYGVLQKAVR 66

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             ++ ++  A      +    +  Y P++ +  A  + A GDTK A+   + V       
Sbjct: 67  ENDAQRIKTAAGEL--LEKYGSTAYAPMAALSAAKAMFAAGDTKTASLQLVWVVEHGKD- 123

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +R  A L+ A++L+D  +Y+E  K L   +     +    +    +SA   GK  +A+
Sbjct: 124 -ELRDLARLRLAAVLLDEKAYDEALKQLAGNTTGGFAVRFLGSRGDVLSA--QGKTAEAR 180

Query: 183 TIFEE 187
             ++E
Sbjct: 181 AAYQE 185


>gi|261868683|ref|YP_003256605.1| hypothetical protein D11S_2032 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261414015|gb|ACX83386.1| hypothetical protein D11S_2032 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 204

 Score = 54.2 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 61/174 (35%), Gaps = 4/174 (2%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           YK+I    ++    +  W Y       +K +     + QAL  +  +    A    + I 
Sbjct: 22  YKFIIVCFVIAFGGVFGWNYWQSH-QIQKMHKASAEYEQALFNYQKDPKAQAEQFNQFIK 80

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
           + +   Y  L+ +  A I V   D   A +   +          +   + L+ AS+    
Sbjct: 81  NNEKTSYAVLALLDKAKIAVENKDFPLAEDALKQAMAQSNDD-ILSSVSALRLASVQFQL 139

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
              +   + L+  S      +   N + G   L  G  + AK  +++  ++  +
Sbjct: 140 GQLDPALESLK--SVKEQAWNSAKNLLAGDIQLAKGDKEAAKKSYQQAQENAGA 191


>gi|91205041|ref|YP_537396.1| hypothetical protein RBE_0226 [Rickettsia bellii RML369-C]
 gi|157827612|ref|YP_001496676.1| hypothetical protein A1I_06615 [Rickettsia bellii OSU 85-389]
 gi|91068585|gb|ABE04307.1| unknown [Rickettsia bellii RML369-C]
 gi|157802916|gb|ABV79639.1| hypothetical protein A1I_06615 [Rickettsia bellii OSU 85-389]
          Length = 222

 Score = 54.2 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 28/168 (16%), Positives = 68/168 (40%), Gaps = 6/168 (3%)

Query: 51  NIVGENFAQALEL-FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAA 109
              G+ F +A+ L       + A S+ E ++   +     ++ +   +I ++      A 
Sbjct: 54  QKNGDIFVKAVNLEAVQGNKELAISTLENLVGISDTKIKEIALLEQVAIKLSGQQNSEAK 113

Query: 110 EIFLKVANDDLAPLAVRYAATLQAASILVDT-----SSYEEISKILQKLSEPSNPMHQFA 164
           ++  K+  +      V   A +   S+++D      +  E++ K L    + + P    A
Sbjct: 114 DLLSKIIENKEYSEIVTSYARIAWCSLVIDDEKLDIADKEKLVKYLNYFDDENKPFWATA 173

Query: 165 NEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           N +  I  +K   + +A+     L   NN+   +  +++ +LA +  +
Sbjct: 174 NIMKAIWDIKSNMLAEAEKNLRSLVASNNTSDLLKDQAKALLAGLDRA 221


>gi|293391765|ref|ZP_06636099.1| hypothetical protein D7S_1930 [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952299|gb|EFE02418.1| hypothetical protein D7S_1930 [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 204

 Score = 54.2 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 61/174 (35%), Gaps = 4/174 (2%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           YK+I    ++    +  W Y       +K +     + QAL  +  +    A    + I 
Sbjct: 22  YKFIIVCFVIAFGGVFGWNYWQSY-QVQKMHNASAEYEQALFNYQKDPKAQAEQFNQFIK 80

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
           + +   Y  L+ +  A I V   D   A +   +          +   + L+ AS+    
Sbjct: 81  NNEKTSYAVLALLDKAKIAVENKDFPLAEDALKQAMAQSNDD-ILSSVSALRLASVQFQL 139

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
              +   + L+  S      +   N + G   L  G  + AK  +++  ++  +
Sbjct: 140 GQLDPALESLK--SVKEQAWNSAKNLLAGDIQLAKGDKEAAKKSYQQAQENAGA 191


>gi|50083799|ref|YP_045309.1| hypothetical protein ACIAD0563 [Acinetobacter sp. ADP1]
 gi|49529775|emb|CAG67487.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 233

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 33/187 (17%), Positives = 67/187 (35%), Gaps = 11/187 (5%)

Query: 9   SYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           S + +    K   K     +I  IL   I F+ +    +K         A+  +L +  +
Sbjct: 5   SEEEQLDNLKSFTKKYGSAIISGILIALIAFFGWQYWQKKTLAENQTRTAKVQQLIDQAQ 64

Query: 69  LDDAR--------SSFEKILSQDNKLYNPL-SNMYIASILVAKGDTKNAAEIFLKVANDD 119
             +A         ++ +KI+         + +   +A I   KGD   A +   K+ N  
Sbjct: 65  AAEANPDALNNLYAAADKIVKDAPDSIQAVQTEFLLAKIAYDKGDYATAEKSLKKIENSK 124

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
           +    +     L+ A+  +    Y+E  K L  +++P       A E  G   +    + 
Sbjct: 125 INDEGLVQLIKLRLANAQLAQKKYDEALKTLSLVTDP--AFKATAEEARGDVYVAKNDIA 182

Query: 180 KAKTIFE 186
            A+  ++
Sbjct: 183 SARKAYQ 189


>gi|215487863|ref|YP_002330294.1| hypothetical protein E2348C_2796 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|215265935|emb|CAS10344.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
          Length = 206

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 73/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A  +IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-KALAVGVILGVGALIGWRYWNSHQVDSARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGVLASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|157371842|ref|YP_001479831.1| hypothetical protein Spro_3607 [Serratia proteamaculans 568]
 gi|157323606|gb|ABV42703.1| conserved hypothetical protein [Serratia proteamaculans 568]
          Length = 206

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 65/166 (39%), Gaps = 5/166 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y     +     +  +++ +A +   S K DD  ++ EK   
Sbjct: 23  KALAVGVVLGIGALVGWRYWQSHEN-SNMMVASQSYQEASDRLASGKPDDVAAA-EKFAQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            ++  Y  L+++ +A   V + +   A++    +A        +     L+ A + +   
Sbjct: 81  ANSNSYGVLASLELAKHFVEQNEFAKASQQL-VLAQGQTKDENMLSMINLRLARVQLQEK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
             ++  K L  +          A +  G   L  G  + A+  + +
Sbjct: 140 KLDDALKTLDGVKGEG--WAAMAQDTRGDVLLAKGDTKGAREAYSK 183


>gi|194432129|ref|ZP_03064418.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|194419658|gb|EDX35738.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|320180503|gb|EFW55434.1| hypothetical protein SGB_02403 [Shigella boydii ATCC 9905]
 gi|332087960|gb|EGI93085.1| hypothetical protein SB521682_2893 [Shigella boydii 5216-82]
 gi|332089693|gb|EGI94794.1| hypothetical protein SD15574_2915 [Shigella dysenteriae 155-74]
          Length = 206

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 73/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A  +IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-KALAVGVILGVGALIGWRYWNSHQVDSARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A I V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARIQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|253988869|ref|YP_003040225.1| hypothetical protein PAU_01388 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780319|emb|CAQ83480.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 206

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 68/185 (36%), Gaps = 6/185 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +N +      +          +  L +L   +L  W Y +      +     E F Q   
Sbjct: 5   TNENEQVDAIRRFFANNGKALVFGL-VLGAGALIGWRY-WQSHQTNQLQTSAEAFEQVNS 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
              S    ++ ++ EK  S+ N  Y  ++ M +A + V K +   A E FL  A      
Sbjct: 63  GLLSG-TKESNTAVEKFASETNNSYGVMAYMQLAKLAVEKNELAKA-EQFLSTAVGQTKS 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++    ++ A + +     +   K L++     +     A ++ G + LK G +  A+
Sbjct: 121 ENLQSLVNIRLARVQLAEDKADVALKTLEQ--VKGSGWIAVAEDVRGDALLKKGDIAGAR 178

Query: 183 TIFEE 187
             + +
Sbjct: 179 AAYTK 183


>gi|294340465|emb|CAZ88846.1| conserved hypothetical protein; putative TPR domain [Thiomonas sp.
           3As]
          Length = 212

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 36/185 (19%), Positives = 66/185 (35%), Gaps = 6/185 (3%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           +       +L +      +Y +      +       F Q      SN  D    ++  + 
Sbjct: 21  WGTQISAGVLAVAVGFAGYYGWQWWQRNQGAKAAVVFEQVQAAIQSNNPDKIEQAWAVMQ 80

Query: 81  SQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
           S+     Y  ++ + +A  L   G  + A     K A++  A  + R  A L  +++ +D
Sbjct: 81  SKAPGSAYAGMAALAVAKSLHDAGKNEQAIAAL-KWASEHAAGPSARSVARLNLSALQID 139

Query: 140 TSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
              Y E  K L  + EP+           G  A+  G+   A+T +E   K    P   S
Sbjct: 140 AKQYAEAIKTLADVPEPTFAALFDIRR--GDLAMLQGQRDAARTAYEAALK--ALPADSS 195

Query: 200 TRSQM 204
            R+ +
Sbjct: 196 QRAAV 200


>gi|319794356|ref|YP_004155996.1| hypothetical protein Varpa_3701 [Variovorax paradoxus EPS]
 gi|315596819|gb|ADU37885.1| Protein of unknown function DUF2133 [Variovorax paradoxus EPS]
          Length = 230

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/187 (13%), Positives = 59/187 (31%), Gaps = 4/187 (2%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y  +   ++L++    + +  +      K       + +      S  ++  +     + 
Sbjct: 23  YGTLITWVVLLVAGAFVAWNGWQYFQRNKAAQAAALYDEVERSTQSGDVERIQRVLGDMK 82

Query: 81  SQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
            +     Y   + +  A  L  KG  + +      VA         +  A L+ A+ L+D
Sbjct: 83  ERFAGTAYAQQAGLLAAKTLYEKGKVEESRAALGWVA-QSAVDPGYQAIAKLRLAAELLD 141

Query: 140 TSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
             SY+E  K L               +  G   +  GK  +A+  + +      +     
Sbjct: 142 GKSYDEALKQLDG--NVPKEFEPLVADRKGDIYMAQGKRDEAQQEYRKAWTGLGATSDYR 199

Query: 200 TRSQMIL 206
              ++ L
Sbjct: 200 RLVEIKL 206


>gi|262274785|ref|ZP_06052596.1| membrane protein [Grimontia hollisae CIP 101886]
 gi|262221348|gb|EEY72662.1| membrane protein [Grimontia hollisae CIP 101886]
          Length = 201

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 50/154 (32%), Gaps = 5/154 (3%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
             L  ++ L     +  +    E  +    + + Q +    +     A       +    
Sbjct: 25  VVLGAVIGLGGLYGWRYYQAEMETGREQASDAYTQVVSALVAGD-AQAEEKAATFIKDHE 83

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y  L  + +A   V  GD   AAE   +V         ++  AT++ A +  +  +Y+
Sbjct: 84  GAYTSLLALQLAKSFVEAGDLTLAAEQLRRV--QSSKDDTLKTLATVRLARVEAELGNYD 141

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKV 178
                L  ++  S        E+ G   L+ G  
Sbjct: 142 AALSQLNSVTTDS--WKAQVEELRGDIELRRGDE 173


>gi|315634911|ref|ZP_07890193.1| conserved hypothetical protein [Aggregatibacter segnis ATCC 33393]
 gi|315476463|gb|EFU67213.1| conserved hypothetical protein [Aggregatibacter segnis ATCC 33393]
          Length = 204

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 30/195 (15%), Positives = 69/195 (35%), Gaps = 8/195 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E   + ++ K      +  YK+I    ++    +  W Y       +K +     + Q 
Sbjct: 5   IEEEQELSAIKA---WWQENYKFIIVCFVIAFGGVFGWNYWQSH-QLQKIHNASAEYEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L  +  +         + I + +   Y  L+ +  A I V   D   A +   +      
Sbjct: 61  LFNYAKDPKAQEEQFSQFIKNNEKTGYAVLALLDKAKIAVENQDFAQAEDALKQAVAQST 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   + L+ A++      ++   + L+         +   N ++G   L  G    
Sbjct: 121 DD-VLSSVSALRLAAVQFQLGQFDPALESLKL--VKEQAWNGAKNMLVGDIQLAKGDKDA 177

Query: 181 AKTIFEELAKDNNSP 195
           AK+ +++ A+ N +P
Sbjct: 178 AKSAYQQ-AQQNATP 191


>gi|254499339|ref|ZP_05112010.1| transmembrane protein [Legionella drancourtii LLAP12]
 gi|254351444|gb|EET10308.1| transmembrane protein [Legionella drancourtii LLAP12]
          Length = 220

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 70/189 (37%), Gaps = 8/189 (4%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      K    +  Y  +    + ++L     +       +K        + Q + L 
Sbjct: 3   EEEQLESIKKWWKR--YGNVVMFAVSLVLLAVAGYRYLTWHQDKLTQQASIAYEQMM-LA 59

Query: 65  NSNKLDDARSSFEK--ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
            SN    A  S+    I   D  +Y  +++M +A I ++K     A     ++  D+   
Sbjct: 60  MSNHNVKAVKSYANELIKDHDKTVYADVAHMTLAKIYISKNKLDKAQAEL-RIVADNSKM 118

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
           L+++  A ++ A IL    SY      L ++           NE+ G      G+ Q+A 
Sbjct: 119 LSLKQIAKIRIARILTAEKSYANALTELSRI--EDTTYLPVINELKGDIYGATGQYQEAM 176

Query: 183 TIFEELAKD 191
           + +++ + +
Sbjct: 177 SSYKKASDE 185


>gi|323967961|gb|EGB63373.1| yfgM [Escherichia coli M863]
 gi|323977304|gb|EGB72390.1| yfgM [Escherichia coli TW10509]
 gi|327252220|gb|EGE63892.1| hypothetical protein ECSTEC7V_3068 [Escherichia coli STEC_7v]
          Length = 206

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 73/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A  +IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-KALAVGVILGVGALIGWRYWNSHQVDSTRS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAATQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|304398583|ref|ZP_07380455.1| Protein of unknown function DUF2133 [Pantoea sp. aB]
 gi|304353794|gb|EFM18169.1| Protein of unknown function DUF2133 [Pantoea sp. aB]
          Length = 205

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 68/194 (35%), Gaps = 6/194 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           SN +  +   +        K +A  +++ I +L  W Y      +     V   + Q   
Sbjct: 5   SNENEQTDALRNFFANNG-KALAIGVVIGIAALGGWRYWSSHQDDT-AKSVSAQYQQLTS 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
              + K  +   +  +  S+++  Y  L+ M +A   V  G    AA +      D    
Sbjct: 63  AMQAGKP-ETLEAVNRFASENSNTYGALAAMDLAKQYVDAGQLDKAASLLQNGLKDTK-D 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++    L+ A I +  +  +   K L  +            +I G + L  G  Q A+
Sbjct: 121 ANLQAVINLRLARIQLQQNQADAALKTLDGVKGDG--WTAIVADIRGEALLTKGDKQGAR 178

Query: 183 TIFEELAKDNNSPF 196
             + +  + + SP 
Sbjct: 179 DAWSKGVESDASPA 192


>gi|111073626|emb|CAL29488.1| hypothetical protein OW2-B [Wolbachia endosymbiont of Onchocerca
           volvulus]
          Length = 202

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 36/187 (19%), Positives = 67/187 (35%), Gaps = 16/187 (8%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L ++  L + I + L++    K+  I G  F + L      K          +L 
Sbjct: 25  KYILLLTLIPFLVIIILYSLYNIDSTKQSTIAGNKFYKVLFSKKDIK----------LLE 74

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           +    +  L+N   A   ++     +AA I+  +A++   P  +R  A       L   +
Sbjct: 75  EIGSSWKCLANFESAFNHISNLTPTDAASIYNDMADNQDIPNVLRELAQYLEVMSLFCNN 134

Query: 142 SY--EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
               E+    L+            + E + I  +    ++ A  I   L  D   P  I 
Sbjct: 135 EKINEDKINNLESSIV----YPYSSQEAIAIIKIHNNDIKGAVKILHSLLNDRKCPTLIK 190

Query: 200 TRSQMIL 206
             +Q +L
Sbjct: 191 ANAQELL 197


>gi|110834719|ref|YP_693578.1| hypothetical protein ABO_1858 [Alcanivorax borkumensis SK2]
 gi|110647830|emb|CAL17306.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 207

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 38/208 (18%), Positives = 80/208 (38%), Gaps = 8/208 (3%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
           ++    +   +  +         ++L + +L  W    D   E+      +++   +E  
Sbjct: 3   DEEEQAELLKEWWQKNGTATIITVVLAVAALIGWREWQDHQGEQSAE-ASKHYQVMVEAL 61

Query: 65  NSNKLDDAR--SSFEKILSQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            + ++D+A      E +        Y   +N+  A + V  GD ++AA +   V +D   
Sbjct: 62  TAQEVDEATVNQKAEALKENFPGSAYANYANLAQARLAVQAGDYESAASLLQSVVDDGAT 121

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              + Y A L+   +L+   +Y++ +  L       +  +  A E+ G  A   G  Q A
Sbjct: 122 DALI-YTARLRLVRVLLQQEAYDKAAAELDN--SFPSAFNGMALELRGDLAKARGDHQAA 178

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANI 209
              + + A +     G   R QM L ++
Sbjct: 179 TDAYTQ-ALETLQDNGEKDRVQMKLDDL 205


>gi|166712108|ref|ZP_02243315.1| hypothetical protein Xoryp_11790 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 212

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/150 (14%), Positives = 52/150 (34%), Gaps = 10/150 (6%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
            +  +      +       +   ++   +  LD+A      +      +Y  L+ + +A 
Sbjct: 40  GWQWWQKYTNTELVEANTRYEAVVKSIQAKNLDNAAKDIVALDDGKGGIYAELAALRLAK 99

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
             V  G    A +    V  +      V+     + A +L ++   +E  K+L    +  
Sbjct: 100 AQVDAGKNAEAIKTLRDVPAEGELKQIVQQ----RLARVLTESGKPDEAIKLLADAQD-- 153

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEE 187
                 + EI   + +  GK  +A+ ++ +
Sbjct: 154 ----HASLEIRADALVAQGKPDEARALYTK 179


>gi|74313039|ref|YP_311458.1| hypothetical protein SSON_2595 [Shigella sonnei Ss046]
 gi|73856516|gb|AAZ89223.1| conserved hypothetical protein [Shigella sonnei Ss046]
          Length = 206

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 73/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A  +IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-KALAVGVILGVGALIGWRYWNSHQVDSARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGKALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|325919428|ref|ZP_08181454.1| hypothetical protein XGA_0393 [Xanthomonas gardneri ATCC 19865]
 gi|325550094|gb|EGD20922.1| hypothetical protein XGA_0393 [Xanthomonas gardneri ATCC 19865]
          Length = 212

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/150 (14%), Positives = 50/150 (33%), Gaps = 10/150 (6%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
            +  +      +       +   ++      LD A      +      +Y  L+ + +A 
Sbjct: 40  GWQWWQKHTNTQSVEANTRYEAVVKSIQGKGLDKAAKEIVALDDGKGGIYAELAALRLAK 99

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
             V  G    A +    V  +      V+     + A +L ++   +E  K+L    +  
Sbjct: 100 AQVDAGKHAEAIKTLRDVPAEGELKQIVQQ----RLARVLTESGKPDEAIKLLADAQD-- 153

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEE 187
                 + EI   + +  GK  +A+ ++ +
Sbjct: 154 ----HTSLEIRADALVVQGKPDEARALYGK 179


>gi|161830472|ref|YP_001597098.1| hypothetical protein COXBURSA331_A1392 [Coxiella burnetii RSA 331]
 gi|161762339|gb|ABX77981.1| conserved hypothetical protein [Coxiella burnetii RSA 331]
          Length = 206

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 65/186 (34%), Gaps = 5/186 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E  +D    +   K  +   + IA  +++ +L    W Y      E K       + Q  
Sbjct: 3   ELLSDQEQIEMIKKWWRDYGRAIALAIVIGLLIGFGWRYWHRHQLE-KTERASALYMQLQ 61

Query: 62  ELFNSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            L + N  D  +   ++++       Y  +++   A   V +     A +    V   + 
Sbjct: 62  ILASQNAWDKTKPLTDRLIKDYGKTPYAAMASFLNAKRAVEQNHLPLALDQLQWVMK-NA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  A L+A+ IL+  +  +    +LQ  +           EI G      G  + 
Sbjct: 121 IVSDLKQLARLRASRILLAENRPKAALNLLQ--TVDDQAYQPLVGEIKGDIYAAMGNRES 178

Query: 181 AKTIFE 186
           AK  +E
Sbjct: 179 AKQFYE 184


>gi|16130438|ref|NP_417008.1| conserved protein, UPF0070 family [Escherichia coli str. K-12
           substr. MG1655]
 gi|82777898|ref|YP_404247.1| hypothetical protein SDY_2709 [Shigella dysenteriae Sd197]
 gi|89109319|ref|AP_003099.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|157158004|ref|YP_001463835.1| hypothetical protein EcE24377A_2797 [Escherichia coli E24377A]
 gi|157161988|ref|YP_001459306.1| hypothetical protein EcHS_A2664 [Escherichia coli HS]
 gi|170019204|ref|YP_001724158.1| hypothetical protein EcolC_1164 [Escherichia coli ATCC 8739]
 gi|170082123|ref|YP_001731443.1| hypothetical protein ECDH10B_2679 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170682168|ref|YP_001744701.1| hypothetical protein EcSMS35_2665 [Escherichia coli SMS-3-5]
 gi|187730758|ref|YP_001881304.1| hypothetical protein SbBS512_E2888 [Shigella boydii CDC 3083-94]
 gi|188493088|ref|ZP_03000358.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|191167663|ref|ZP_03029472.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|191172634|ref|ZP_03034173.1| conserved hypothetical protein [Escherichia coli F11]
 gi|193064011|ref|ZP_03045096.1| conserved hypothetical protein [Escherichia coli E22]
 gi|193068350|ref|ZP_03049313.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194427259|ref|ZP_03059809.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194437588|ref|ZP_03069684.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|209919990|ref|YP_002294074.1| hypothetical protein ECSE_2799 [Escherichia coli SE11]
 gi|218555038|ref|YP_002387951.1| hypothetical protein ECIAI1_2565 [Escherichia coli IAI1]
 gi|218696140|ref|YP_002403807.1| hypothetical protein EC55989_2798 [Escherichia coli 55989]
 gi|218706016|ref|YP_002413535.1| hypothetical protein ECUMN_2833 [Escherichia coli UMN026]
 gi|238901678|ref|YP_002927474.1| hypothetical protein BWG_2277 [Escherichia coli BW2952]
 gi|253772593|ref|YP_003035424.1| hypothetical protein ECBD_1173 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162487|ref|YP_003045595.1| hypothetical protein ECB_02405 [Escherichia coli B str. REL606]
 gi|256017339|ref|ZP_05431204.1| hypothetical protein ShiD9_00390 [Shigella sp. D9]
 gi|256021801|ref|ZP_05435666.1| hypothetical protein E4_00395 [Escherichia sp. 4_1_40B]
 gi|260845143|ref|YP_003222921.1| hypothetical protein ECO103_3030 [Escherichia coli O103:H2 str.
           12009]
 gi|260856607|ref|YP_003230498.1| hypothetical protein ECO26_3560 [Escherichia coli O26:H11 str.
           11368]
 gi|260869202|ref|YP_003235604.1| hypothetical protein ECO111_3237 [Escherichia coli O111:H- str.
           11128]
 gi|291283734|ref|YP_003500552.1| hypothetical protein G2583_3037 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293405954|ref|ZP_06649946.1| membrane protein [Escherichia coli FVEC1412]
 gi|293415778|ref|ZP_06658421.1| yfgM protein [Escherichia coli B185]
 gi|293446866|ref|ZP_06663288.1| yfgM protein [Escherichia coli B088]
 gi|297518017|ref|ZP_06936403.1| hypothetical protein EcolOP_10297 [Escherichia coli OP50]
 gi|298381755|ref|ZP_06991354.1| yfgM protein [Escherichia coli FVEC1302]
 gi|300817717|ref|ZP_07097932.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300820817|ref|ZP_07100967.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|300898383|ref|ZP_07116726.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300904313|ref|ZP_07122170.1| hypothetical protein HMPREF9536_02398 [Escherichia coli MS 84-1]
 gi|300920668|ref|ZP_07137079.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300927124|ref|ZP_07142872.1| hypothetical protein HMPREF9548_05109 [Escherichia coli MS 182-1]
 gi|300930153|ref|ZP_07145574.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|300951782|ref|ZP_07165597.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300958857|ref|ZP_07170965.1| hypothetical protein HMPREF9547_04549 [Escherichia coli MS 175-1]
 gi|300998069|ref|ZP_07181929.1| hypothetical protein HMPREF9553_05402 [Escherichia coli MS 200-1]
 gi|301022373|ref|ZP_07186260.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|301024745|ref|ZP_07188385.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|301302870|ref|ZP_07208998.1| hypothetical protein HMPREF9347_01448 [Escherichia coli MS 124-1]
 gi|301330396|ref|ZP_07223038.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|301648268|ref|ZP_07248011.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|307139148|ref|ZP_07498504.1| hypothetical protein EcolH7_13618 [Escherichia coli H736]
 gi|307312492|ref|ZP_07592125.1| Protein of unknown function DUF2133 [Escherichia coli W]
 gi|309784736|ref|ZP_07679369.1| UPF0070 protein yfgM [Shigella dysenteriae 1617]
 gi|309794440|ref|ZP_07688863.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|312965429|ref|ZP_07779661.1| UPF0070 protein yfgM [Escherichia coli 2362-75]
 gi|312973246|ref|ZP_07787418.1| UPF0070 protein yfgM [Escherichia coli 1827-70]
 gi|331643133|ref|ZP_08344268.1| putative inner membrane protein [Escherichia coli H736]
 gi|331653941|ref|ZP_08354942.1| putative inner membrane protein [Escherichia coli M718]
 gi|331664076|ref|ZP_08364986.1| putative inner membrane protein [Escherichia coli TA143]
 gi|331669259|ref|ZP_08370107.1| putative inner membrane protein [Escherichia coli TA271]
 gi|331673968|ref|ZP_08374731.1| putative inner membrane protein [Escherichia coli TA280]
 gi|331678504|ref|ZP_08379179.1| putative inner membrane protein [Escherichia coli H591]
 gi|332278334|ref|ZP_08390747.1| conserved hypothetical protein [Shigella sp. D9]
 gi|4033493|sp|P76576|YFGM_ECOLI RecName: Full=UPF0070 protein yfgM
 gi|1788860|gb|AAC75566.1| conserved protein, UPF0070 family [Escherichia coli str. K-12
           substr. MG1655]
 gi|81242046|gb|ABB62756.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|85675434|dbj|BAA16399.2| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|157067668|gb|ABV06923.1| conserved hypothetical protein [Escherichia coli HS]
 gi|157080034|gb|ABV19742.1| conserved hypothetical protein [Escherichia coli E24377A]
 gi|169754132|gb|ACA76831.1| conserved hypothetical protein [Escherichia coli ATCC 8739]
 gi|169889958|gb|ACB03665.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170519886|gb|ACB18064.1| conserved hypothetical protein [Escherichia coli SMS-3-5]
 gi|187427750|gb|ACD07024.1| conserved hypothetical protein [Shigella boydii CDC 3083-94]
 gi|188488287|gb|EDU63390.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|190902262|gb|EDV62002.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|190907107|gb|EDV66707.1| conserved hypothetical protein [Escherichia coli F11]
 gi|192929246|gb|EDV82855.1| conserved hypothetical protein [Escherichia coli E22]
 gi|192958302|gb|EDV88742.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194414580|gb|EDX30852.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194423394|gb|EDX39385.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|209763398|gb|ACI80011.1| hypothetical protein ECs3375 [Escherichia coli]
 gi|209763404|gb|ACI80014.1| hypothetical protein ECs3375 [Escherichia coli]
 gi|209913249|dbj|BAG78323.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218352872|emb|CAU98671.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218361806|emb|CAQ99405.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218433113|emb|CAR14010.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|238860355|gb|ACR62353.1| conserved protein [Escherichia coli BW2952]
 gi|242378111|emb|CAQ32884.1| conserved protein [Escherichia coli BL21(DE3)]
 gi|253323637|gb|ACT28239.1| conserved hypothetical protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974388|gb|ACT40059.1| hypothetical protein ECB_02405 [Escherichia coli B str. REL606]
 gi|253978555|gb|ACT44225.1| hypothetical protein ECD_02405 [Escherichia coli BL21(DE3)]
 gi|257755256|dbj|BAI26758.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257760290|dbj|BAI31787.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257765558|dbj|BAI37053.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|260448407|gb|ACX38829.1| conserved hypothetical protein [Escherichia coli DH1]
 gi|284922463|emb|CBG35550.1| conserved hypothetical protein [Escherichia coli 042]
 gi|290763607|gb|ADD57568.1| UPF0070 protein yfgM [Escherichia coli O55:H7 str. CB9615]
 gi|291323696|gb|EFE63124.1| yfgM protein [Escherichia coli B088]
 gi|291428162|gb|EFF01189.1| membrane protein [Escherichia coli FVEC1412]
 gi|291433426|gb|EFF06405.1| yfgM protein [Escherichia coli B185]
 gi|298279197|gb|EFI20711.1| yfgM protein [Escherichia coli FVEC1302]
 gi|299881272|gb|EFI89483.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|300304048|gb|EFJ58568.1| hypothetical protein HMPREF9553_05402 [Escherichia coli MS 200-1]
 gi|300314509|gb|EFJ64293.1| hypothetical protein HMPREF9547_04549 [Escherichia coli MS 175-1]
 gi|300357923|gb|EFJ73793.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300396414|gb|EFJ79952.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|300403745|gb|EFJ87283.1| hypothetical protein HMPREF9536_02398 [Escherichia coli MS 84-1]
 gi|300412349|gb|EFJ95659.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300416894|gb|EFK00205.1| hypothetical protein HMPREF9548_05109 [Escherichia coli MS 182-1]
 gi|300448979|gb|EFK12599.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300461959|gb|EFK25452.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|300526570|gb|EFK47639.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|300529705|gb|EFK50767.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300841805|gb|EFK69565.1| hypothetical protein HMPREF9347_01448 [Escherichia coli MS 124-1]
 gi|300843625|gb|EFK71385.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|301073655|gb|EFK88461.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|306907415|gb|EFN37919.1| Protein of unknown function DUF2133 [Escherichia coli W]
 gi|308121896|gb|EFO59158.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|308927106|gb|EFP72580.1| UPF0070 protein yfgM [Shigella dysenteriae 1617]
 gi|309702845|emb|CBJ02176.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|310331841|gb|EFP99076.1| UPF0070 protein yfgM [Escherichia coli 1827-70]
 gi|312289849|gb|EFR17737.1| UPF0070 protein yfgM [Escherichia coli 2362-75]
 gi|315061832|gb|ADT76159.1| conserved hypothetical protein [Escherichia coli W]
 gi|315137137|dbj|BAJ44296.1| hypothetical protein ECDH1ME8569_2440 [Escherichia coli DH1]
 gi|315256533|gb|EFU36501.1| putative inner membrane protein [Escherichia coli MS 85-1]
 gi|315300480|gb|EFU59709.1| conserved hypothetical protein [Escherichia coli MS 16-3]
 gi|315615772|gb|EFU96404.1| UPF0070 protein yfgM [Escherichia coli 3431]
 gi|320175076|gb|EFW50189.1| hypothetical protein SDB_02437 [Shigella dysenteriae CDC 74-1112]
 gi|320185213|gb|EFW59993.1| hypothetical protein SGF_02749 [Shigella flexneri CDC 796-83]
 gi|320200077|gb|EFW74666.1| hypothetical protein ECoL_02913 [Escherichia coli EC4100B]
 gi|320640857|gb|EFX10345.1| hypothetical protein ECO5101_04487 [Escherichia coli O157:H7 str.
           G5101]
 gi|320646300|gb|EFX15227.1| hypothetical protein ECO9389_06673 [Escherichia coli O157:H- str.
           493-89]
 gi|320651805|gb|EFX20185.1| hypothetical protein ECO2687_02991 [Escherichia coli O157:H- str. H
           2687]
 gi|320657191|gb|EFX25000.1| hypothetical protein ECO7815_13194 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662797|gb|EFX30129.1| hypothetical protein ECO5905_00861 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320667601|gb|EFX34516.1| hypothetical protein ECOSU61_20448 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323156167|gb|EFZ42326.1| hypothetical protein ECEPECA14_1944 [Escherichia coli EPECa14]
 gi|323159383|gb|EFZ45368.1| hypothetical protein ECE128010_4434 [Escherichia coli E128010]
 gi|323177363|gb|EFZ62951.1| hypothetical protein ECOK1180_3849 [Escherichia coli 1180]
 gi|323184426|gb|EFZ69801.1| hypothetical protein ECOK1357_2147 [Escherichia coli 1357]
 gi|323188369|gb|EFZ73661.1| hypothetical protein ECRN5871_3475 [Escherichia coli RN587/1]
 gi|323377587|gb|ADX49855.1| Protein of unknown function DUF2133 [Escherichia coli KO11]
 gi|323936406|gb|EGB32696.1| yfgM [Escherichia coli E1520]
 gi|323941225|gb|EGB37410.1| yfgM [Escherichia coli E482]
 gi|323944735|gb|EGB40802.1| yfgM [Escherichia coli H120]
 gi|323961329|gb|EGB56941.1| yfgM [Escherichia coli H489]
 gi|323971074|gb|EGB66322.1| yfgM [Escherichia coli TA007]
 gi|324011230|gb|EGB80449.1| hypothetical protein HMPREF9533_04773 [Escherichia coli MS 60-1]
 gi|324020073|gb|EGB89292.1| hypothetical protein HMPREF9542_01238 [Escherichia coli MS 117-3]
 gi|324118143|gb|EGC12040.1| yfgM [Escherichia coli E1167]
 gi|331039931|gb|EGI12151.1| putative inner membrane protein [Escherichia coli H736]
 gi|331048790|gb|EGI20866.1| putative inner membrane protein [Escherichia coli M718]
 gi|331059875|gb|EGI31852.1| putative inner membrane protein [Escherichia coli TA143]
 gi|331064453|gb|EGI36364.1| putative inner membrane protein [Escherichia coli TA271]
 gi|331069241|gb|EGI40633.1| putative inner membrane protein [Escherichia coli TA280]
 gi|331074964|gb|EGI46284.1| putative inner membrane protein [Escherichia coli H591]
 gi|332092742|gb|EGI97811.1| hypothetical protein SB359474_2926 [Shigella boydii 3594-74]
 gi|332100686|gb|EGJ04032.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332344385|gb|AEE57719.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|333000701|gb|EGK20277.1| hypothetical protein SFVA6_3393 [Shigella flexneri VA-6]
          Length = 206

 Score = 52.7 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 73/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A  +IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-KALAVGVILGVGALIGWRYWNSHQVDSARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|218701023|ref|YP_002408652.1| hypothetical protein ECIAI39_2714 [Escherichia coli IAI39]
 gi|300940236|ref|ZP_07154834.1| conserved hypothetical protein [Escherichia coli MS 21-1]
 gi|218371009|emb|CAR18837.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|300454932|gb|EFK18425.1| conserved hypothetical protein [Escherichia coli MS 21-1]
          Length = 206

 Score = 52.7 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 73/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A  +IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-KALAVGVILGVGALIGWRYWNSHQVDSARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAATQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|225851488|ref|YP_002731722.1| tetratricopeptide repeat domain protein [Persephonella marina
           EX-H1]
 gi|225645952|gb|ACO04138.1| tetratricopeptide repeat domain protein [Persephonella marina
           EX-H1]
          Length = 934

 Score = 52.7 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 35/166 (21%), Positives = 65/166 (39%), Gaps = 15/166 (9%)

Query: 37  IWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIA 96
            WF+    +++K      + + +A+  FN+  LD A S  +    +        S   +A
Sbjct: 482 GWFFFKKRNYQKAYEAFTDEYMKAVSAFNAGDLDKAYSLVKGKKDRK-------SRFLLA 534

Query: 97  SILVAKGDTKNAAEIFLKVAN-DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSE 155
            I + KGD   A +I  +++  DD         A    A        Y E  K  +  +E
Sbjct: 535 YIFMRKGDIDKARDILRELSKGDDKIAQQ----AGYLYAYSYFSEGKYIEAIKAFRDYAE 590

Query: 156 P--SNPMHQFANEILGISALKFGKVQKAKTIFEE-LAKDNNSPFGI 198
                 +   A   +  S    G+ +KA+ I+++ + +  N+P  I
Sbjct: 591 KYRGTELGNLAVLRMADSYYNAGQKEKARKIYQQFIEEHANTPEAI 636



 Score = 42.3 bits (98), Expect = 0.048,   Method: Composition-based stats.
 Identities = 27/173 (15%), Positives = 63/173 (36%), Gaps = 25/173 (14%)

Query: 41  LFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKL-------------- 86
            ++   ++K   + + F +  E  N+ +  DA      +  +++                
Sbjct: 609 YYNAGQKEKARKIYQQFIE--EHANTPEAIDAAYQLTVLEMEESGADVASQIEKFIEKYP 666

Query: 87  -YNP--LSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
            Y    L  + +  +   K +   A +I+ ++     A +     A  +   +   +   
Sbjct: 667 QYPFVSLLKLQLGDLYTEKQEYDKAEKIYRELIE---ADIKESEYALYKLGYLKYISGDK 723

Query: 144 EEISKILQKLSE--PSNPMHQFANEILGISALKFGKVQKAKTIFEEL-AKDNN 193
           ++  KIL +  +  P    +  A E+L     + G + KA  + ++L A D N
Sbjct: 724 DQAVKILTRYIKIYPRGEFNVQAKELLAKIFEEQGDLDKAIAVMKKLPATDEN 776


>gi|221198079|ref|ZP_03571125.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221204363|ref|ZP_03577380.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221175220|gb|EEE07650.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221182011|gb|EEE14412.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 209

 Score = 52.7 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 39/202 (19%), Positives = 78/202 (38%), Gaps = 10/202 (4%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +   +    K    +  +  +   ++L  L +A  F  ++    ++       + Q  + 
Sbjct: 5   DEQESIESLKAWWAR--WGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKA 62

Query: 64  FNSN-KLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +N K   AR++ +         Y  ++ +  A +L A GDT  A +  L+ A D    
Sbjct: 63  AAANDKTTIARAAADMEDKYGRTAYAQMTALSAAKVLYAAGDTAGA-KAQLQWAADHAKD 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+
Sbjct: 122 DEYKQIAKLRLASLLLDEKAYDAGLALLSG--TPMDAFKGLVADRRGDLLAAQGKTDDAR 179

Query: 183 TIF----EELAKDNNSPFGIST 200
           T +    + L+KD+ S   +  
Sbjct: 180 TAYKLALDSLSKDDQSARQLVQ 201


>gi|24113842|ref|NP_708352.1| hypothetical protein SF2559 [Shigella flexneri 2a str. 301]
 gi|30063905|ref|NP_838076.1| hypothetical protein S2731 [Shigella flexneri 2a str. 2457T]
 gi|82544962|ref|YP_408909.1| hypothetical protein SBO_2537 [Shigella boydii Sb227]
 gi|24052933|gb|AAN44059.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30042160|gb|AAP17886.1| hypothetical protein S2731 [Shigella flexneri 2a str. 2457T]
 gi|81246373|gb|ABB67081.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|281601915|gb|ADA74899.1| conserved hypothetical protein [Shigella flexneri 2002017]
 gi|313650999|gb|EFS15399.1| UPF0070 protein yfgM [Shigella flexneri 2a str. 2457T]
 gi|332755563|gb|EGJ85927.1| hypothetical protein SFK671_3110 [Shigella flexneri K-671]
 gi|332756318|gb|EGJ86669.1| hypothetical protein SF274771_3063 [Shigella flexneri 2747-71]
 gi|332766346|gb|EGJ96556.1| hypothetical protein SF293071_3050 [Shigella flexneri 2930-71]
 gi|333016243|gb|EGK35574.1| hypothetical protein SFK304_3329 [Shigella flexneri K-304]
          Length = 206

 Score = 52.3 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 72/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A   IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-KALAVGGILGVGALTGWRYWNSHQVDSARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|161524638|ref|YP_001579650.1| hypothetical protein Bmul_1465 [Burkholderia multivorans ATCC
           17616]
 gi|189350606|ref|YP_001946234.1| hypothetical protein BMULJ_01778 [Burkholderia multivorans ATCC
           17616]
 gi|221212771|ref|ZP_03585747.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|160342067|gb|ABX15153.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
 gi|189334628|dbj|BAG43698.1| putative membrane protein [Burkholderia multivorans ATCC 17616]
 gi|221166984|gb|EED99454.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 209

 Score = 52.3 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 38/202 (18%), Positives = 77/202 (38%), Gaps = 10/202 (4%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +   +    K    +  +  +   ++L  L +A  F  ++    ++       + Q  + 
Sbjct: 5   DEQESIESLKAWWAR--WGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKA 62

Query: 64  FNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +N     AR++ +         Y  ++ +  A +L A GDT  A +  L+ A D    
Sbjct: 63  AAANDKATIARAAADMEDKYGRTAYAQMTALSAAKVLYAAGDTAGA-KAQLQWAADHAKD 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+
Sbjct: 122 DEYKQIAKLRLASLLLDEKAYDAGLALLSG--TPMDAFKGLVADRRGDLLAAQGKTDDAR 179

Query: 183 TIF----EELAKDNNSPFGIST 200
           T +    + L+KD+ S   +  
Sbjct: 180 TAYKLALDSLSKDDQSARQLVQ 201


>gi|119944925|ref|YP_942605.1| hypothetical protein Ping_1170 [Psychromonas ingrahamii 37]
 gi|119863529|gb|ABM03006.1| conserved hypothetical protein [Psychromonas ingrahamii 37]
          Length = 226

 Score = 52.3 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 67/161 (41%), Gaps = 4/161 (2%)

Query: 27  LLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEK-ILSQDNK 85
           +  ++ L+    +  ++ S    +    + ++  L  F S   +    S    I    + 
Sbjct: 31  IAAVIGLAGLWGWRFYNASVITGQEEASQAYSDMLVKFESQGGEAGLDSIRAFIAGNQDN 90

Query: 86  LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE 145
            Y  L+++ +A   V + D   A   F+++ + +     +     L+ A +      YE+
Sbjct: 91  NYGVLASLLLAKEAVQQKDFALAKAQFVQLQSQNEY-APLNAVINLRLARVEAQLGEYEQ 149

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             K L  ++EPS      AN++ G   L  G ++KA+T F+
Sbjct: 150 ALKTLTLITEPS--FLAKANQVKGSIYLNMGDIEKARTAFQ 188


>gi|121604776|ref|YP_982105.1| hypothetical protein Pnap_1874 [Polaromonas naphthalenivorans CJ2]
 gi|120593745|gb|ABM37184.1| conserved hypothetical protein [Polaromonas naphthalenivorans CJ2]
          Length = 230

 Score = 52.3 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/133 (15%), Positives = 45/133 (33%), Gaps = 2/133 (1%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y  +    ++++L     +  +      +       F +      S +      +   + 
Sbjct: 23  YGNLITWALIVVLGAFAAWNGYQYWQRSQAAQASVMFDEIERAVQSGETARIDRALADMK 82

Query: 81  SQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
            +  +  Y   + +  A     KG+   A      VA D  A    +  A L+ A IL++
Sbjct: 83  ERFGSTAYAQQAGLLAAKAHYDKGNVDAARAALTWVA-DKAADPGYQAVAKLRLAGILLE 141

Query: 140 TSSYEEISKILQK 152
             +Y+E  + +  
Sbjct: 142 KKAYDEALQQVSG 154


>gi|320157272|ref|YP_004189651.1| hypothetical protein VVM_04008 [Vibrio vulnificus MO6-24/O]
 gi|319932584|gb|ADV87448.1| hypothetical protein VVMO6_02426 [Vibrio vulnificus MO6-24/O]
          Length = 204

 Score = 52.3 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 36/196 (18%), Positives = 72/196 (36%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +    +      K   K +    ++ +  L  W Y  D S  + +    +N+  A+  
Sbjct: 5   NTEEEQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQD-SVTQAREAASQNYTSAINA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             +   + A      I S D K Y+ L+ + +A   V  GD   A     K A  +    
Sbjct: 64  LQAKGAEAAADVEAFIASNDVKEYSVLAALQLAKAQVTAGDLNAALTQL-KWAQSNSKDA 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+    T + A +  +  +++     L K++           E+ G  AL+ G  + A +
Sbjct: 123 ALIPLTTYRIARVEAELGNFDAAKAELAKVT--DASWTGRVAELRGDIALRQGDKEAAYS 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  +  ++   + 
Sbjct: 181 AYSEAQQAADAGQTLQ 196


>gi|197124020|ref|YP_002135971.1| hypothetical protein AnaeK_3630 [Anaeromyxobacter sp. K]
 gi|196173869|gb|ACG74842.1| protein of unknown function DUF124 [Anaeromyxobacter sp. K]
          Length = 428

 Score = 52.3 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 57/135 (42%), Gaps = 7/135 (5%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
            A+  EL      D AR++ E+ L    K    L+ +  A     +G   +AA  + ++ 
Sbjct: 19  LARGTELLAQGDADRARAALERALELGPKDAKVLALLGQACY--RQGQFDDAAIAWQRLV 76

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
           +++    A    A +      +    +EE  + L+ ++   NP H+ A   LG++ L+ G
Sbjct: 77  DENPVEPA----ARVNLGLAFLKAKHHEEARRQLE-IALDLNPDHRKAMGYLGLALLESG 131

Query: 177 KVQKAKTIFEELAKD 191
               A+  F +   D
Sbjct: 132 DPAGAREWFRKAGSD 146


>gi|228474051|ref|ZP_04058792.1| TPR repeat protein [Capnocytophaga gingivalis ATCC 33624]
 gi|228274565|gb|EEK13406.1| TPR repeat protein [Capnocytophaga gingivalis ATCC 33624]
          Length = 996

 Score = 52.3 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 29/175 (16%), Positives = 64/175 (36%), Gaps = 5/175 (2%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKL-YNPLSNMY 94
           A W             I    F  A  L+  NK  +A+ + EK L    K      +  Y
Sbjct: 701 AAWAKALGYVKVSDSEIDSAAFDAAERLYVQNKKQEAKVALEKYLKDYPKGTGASQAEFY 760

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL- 153
           +A I   +     A  ++ KV               ++ ++I ++    +++  +L+++ 
Sbjct: 761 LAQIYFDENQKDKALPLYEKVLAQGR--NEYSEQVLVRLSNIYLEKEDTDKVLPLLEEIE 818

Query: 154 -SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
            +        FA   L  +  K  +  KA    +++  +  +   +   +++I+A
Sbjct: 819 KTSSVAQNLIFARSNLMKAFYKKKEHAKAIVYAKKILAEKGADNRLKNDARVIMA 873



 Score = 39.2 bits (90), Expect = 0.36,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 39/113 (34%), Gaps = 2/113 (1%)

Query: 87  YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEI 146
           Y   +N  + +    KGDTK A   + KV                Q    L      E  
Sbjct: 100 YATHANFEMGNYYFDKGDTKTAIAWYDKV-QIPTLSAEQHEKFNFQYGYALFAHGDKETA 158

Query: 147 SKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
            + L ++ + S    + A   LG  A      Q+A   F+++ ++      +S
Sbjct: 159 QQYLSQV-KDSKEYGKKAAYYLGYIAYDADDYQQANQFFQQVEQEKELSKNLS 210


>gi|308187768|ref|YP_003931899.1| UPF0070 protein [Pantoea vagans C9-1]
 gi|308058278|gb|ADO10450.1| UPF0070 protein [Pantoea vagans C9-1]
          Length = 205

 Score = 52.3 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 68/194 (35%), Gaps = 6/194 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           SN +  +   +        K +A  +++ I +L  W Y      +     V   + Q   
Sbjct: 5   SNENEQTDALRNFFASNG-KALAIGVVIGIAALGGWRYWSSHQDDT-AKSVSAQYQQLTS 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
              + K  +   +  +  S+++  Y  L+ M +A   V  G    AA +      D    
Sbjct: 63  AMQAGKP-ETLEAVSRFASENSNTYGALAAMDLAKQYVDAGQLDKAATLLQNGLKDTK-D 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++    L+ A I +  +  +   K L  +            +I G + L  G  Q A+
Sbjct: 121 ANLQAVINLRLARIQLQQNQADAALKTLDGVKGDG--WTAIVADIRGEALLTKGDKQGAR 178

Query: 183 TIFEELAKDNNSPF 196
             + +  + + SP 
Sbjct: 179 DAWSKGVESDASPA 192


>gi|15832629|ref|NP_311402.1| hypothetical protein ECs3375 [Escherichia coli O157:H7 str. Sakai]
 gi|168748428|ref|ZP_02773450.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|168756285|ref|ZP_02781292.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|168761123|ref|ZP_02786130.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|168768605|ref|ZP_02793612.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773573|ref|ZP_02798580.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|168778479|ref|ZP_02803486.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|168787859|ref|ZP_02812866.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|168798884|ref|ZP_02823891.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|195936655|ref|ZP_03082037.1| hypothetical protein EscherichcoliO157_09365 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208806764|ref|ZP_03249101.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208813431|ref|ZP_03254760.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208820375|ref|ZP_03260695.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209397682|ref|YP_002271983.1| hypothetical protein ECH74115_3737 [Escherichia coli O157:H7 str.
           EC4115]
 gi|217326764|ref|ZP_03442847.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|254794459|ref|YP_003079296.1| hypothetical protein ECSP_3453 [Escherichia coli O157:H7 str.
           TW14359]
 gi|261223055|ref|ZP_05937336.1| hypothetical protein EscherichiacoliO157_00410 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261259394|ref|ZP_05951927.1| hypothetical protein EscherichiacoliO157EcO_26821 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|13362845|dbj|BAB36798.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|187770561|gb|EDU34405.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017062|gb|EDU55184.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|189003185|gb|EDU72171.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|189356601|gb|EDU75020.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362284|gb|EDU80703.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|189368453|gb|EDU86869.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|189372330|gb|EDU90746.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|189378605|gb|EDU97021.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|208726565|gb|EDZ76166.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734708|gb|EDZ83395.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740498|gb|EDZ88180.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209159082|gb|ACI36515.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4115]
 gi|209763400|gb|ACI80012.1| hypothetical protein ECs3375 [Escherichia coli]
 gi|209763402|gb|ACI80013.1| hypothetical protein ECs3375 [Escherichia coli]
 gi|209763406|gb|ACI80015.1| hypothetical protein ECs3375 [Escherichia coli]
 gi|217319131|gb|EEC27556.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|254593859|gb|ACT73220.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|320188846|gb|EFW63505.1| hypothetical protein ECoD_03839 [Escherichia coli O157:H7 str.
           EC1212]
 gi|326340311|gb|EGD64115.1| hypothetical protein ECF_04027 [Escherichia coli O157:H7 str. 1125]
 gi|326344995|gb|EGD68739.1| hypothetical protein ECoA_01842 [Escherichia coli O157:H7 str.
           1044]
          Length = 206

 Score = 52.3 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 73/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A  +IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAIKRFFAENG-KALAVGVILGVGALIGWRYWNSHQVDSARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|296136230|ref|YP_003643472.1| Protein of unknown function DUF2133 [Thiomonas intermedia K12]
 gi|295796352|gb|ADG31142.1| Protein of unknown function DUF2133 [Thiomonas intermedia K12]
          Length = 212

 Score = 52.3 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 36/185 (19%), Positives = 66/185 (35%), Gaps = 6/185 (3%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           +       +L +      +Y +      +       F Q      SN  D    ++  + 
Sbjct: 21  WGTQISAGVLAVAVGFAGYYGWQWWQRSQGAKAAVVFEQVQAALQSNSPDKIEQAWAVMQ 80

Query: 81  SQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
           S+     Y  ++ + +A  L   G  + A     K A++  A  + R  A L  +++ +D
Sbjct: 81  SKAPGSAYAGMAALAVAKSLHDAGKNEQAIAAL-KWASEHAAGPSARSVARLNLSALQID 139

Query: 140 TSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
              Y E  K L  + EP+           G  A+  G+   A+T +E   K    P   S
Sbjct: 140 AKQYAEAIKTLADVPEPTFAALFDIRR--GDLAMLQGQRDAARTAYEAALK--ALPADSS 195

Query: 200 TRSQM 204
            R+ +
Sbjct: 196 QRAAV 200


>gi|170023541|ref|YP_001720046.1| hypothetical protein YPK_1295 [Yersinia pseudotuberculosis YPIII]
 gi|169750075|gb|ACA67593.1| conserved hypothetical protein [Yersinia pseudotuberculosis YPIII]
          Length = 211

 Score = 51.9 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 72/191 (37%), Gaps = 7/191 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHE--KKKNIVGENFAQALELFNSNKL-DDARSSFEK 78
           K +A  ++L I +L  W Y     +    + +   +  + AL   ++  +  D+ +  EK
Sbjct: 23  KALAVGVVLGIGALVGWRYWQGNQNTVMTEASSAYQKVSTALSTNSAGNVSADSIALAEK 82

Query: 79  ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV 138
            +  +   Y  L  + +A   V +     AA+   +          +     L+ A + +
Sbjct: 83  FVQSNKNNYGVLVGLELAHDFVEQNAFDKAAQQLSQALGQTKDENLL-SLINLRLARVQL 141

Query: 139 DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
                +E  K L  +          A ++ G + L  G    A+  + + A ++N+   +
Sbjct: 142 QLKKPDEALKTLDAVQGDG--WTAMAQDVRGDALLSKGDTAGARAAYSK-AIESNASQAL 198

Query: 199 STRSQMILANI 209
               +M L N+
Sbjct: 199 QALLRMKLNNL 209


>gi|218708643|ref|YP_002416264.1| hypothetical protein VS_0621 [Vibrio splendidus LGP32]
 gi|218321662|emb|CAV17616.1| Conserved hypothetical protein [Vibrio splendidus LGP32]
          Length = 204

 Score = 51.9 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 33/196 (16%), Positives = 72/196 (36%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +++    +      K   K +    ++ +  L  W Y  D   E +     E++  A+  
Sbjct: 5   DSEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVEAR-EAASESYTSAISA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            ++  +D        I +  +  Y+ L+ M +A   V  GD   A E   + A       
Sbjct: 64  LDAKGVDAQSDIQAFIDANKDAEYSVLAAMQLAKAQVQAGDLTAALEQL-EWAKSATKDA 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+    T + A I  +   ++     L+ +++ S        E+ G  +L+ G    A +
Sbjct: 123 ALAPLLTYRVARIKAEQGEFDAALTDLEAMTDESWTGRVA--ELRGDISLRKGDTDAAYS 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  +  ++   + 
Sbjct: 181 AYSEAQQAADASQTLQ 196


>gi|26248877|ref|NP_754917.1| hypothetical protein c3035 [Escherichia coli CFT073]
 gi|91211839|ref|YP_541825.1| hypothetical protein UTI89_C2834 [Escherichia coli UTI89]
 gi|117624742|ref|YP_853655.1| hypothetical protein APECO1_4011 [Escherichia coli APEC O1]
 gi|218559439|ref|YP_002392352.1| hypothetical protein ECS88_2689 [Escherichia coli S88]
 gi|218690633|ref|YP_002398845.1| hypothetical protein ECED1_2944 [Escherichia coli ED1a]
 gi|227887548|ref|ZP_04005353.1| tetratricopeptide repeat family protein [Escherichia coli 83972]
 gi|237705023|ref|ZP_04535504.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|300981975|ref|ZP_07175821.1| conserved hypothetical protein [Escherichia coli MS 45-1]
 gi|301047146|ref|ZP_07194241.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|306814417|ref|ZP_07448579.1| hypothetical protein ECNC101_20287 [Escherichia coli NC101]
 gi|331648210|ref|ZP_08349300.1| putative inner membrane protein [Escherichia coli M605]
 gi|331658658|ref|ZP_08359602.1| putative inner membrane protein [Escherichia coli TA206]
 gi|26109283|gb|AAN81485.1|AE016764_167 Hypothetical protein yfgM [Escherichia coli CFT073]
 gi|91073413|gb|ABE08294.1| hypothetical protein YfgM [Escherichia coli UTI89]
 gi|115513866|gb|ABJ01941.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|218366208|emb|CAR03956.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218428197|emb|CAR09114.2| conserved hypothetical protein [Escherichia coli ED1a]
 gi|222034224|emb|CAP76965.1| UPF0070 protein yfgM [Escherichia coli LF82]
 gi|226901389|gb|EEH87648.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227835898|gb|EEJ46364.1| tetratricopeptide repeat family protein [Escherichia coli 83972]
 gi|281179567|dbj|BAI55897.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|294491027|gb|ADE89783.1| conserved hypothetical protein [Escherichia coli IHE3034]
 gi|300300932|gb|EFJ57317.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|300408870|gb|EFJ92408.1| conserved hypothetical protein [Escherichia coli MS 45-1]
 gi|305851811|gb|EFM52263.1| hypothetical protein ECNC101_20287 [Escherichia coli NC101]
 gi|307554536|gb|ADN47311.1| conserved membrane protein YfgM [Escherichia coli ABU 83972]
 gi|307625931|gb|ADN70235.1| hypothetical protein UM146_04140 [Escherichia coli UM146]
 gi|312947090|gb|ADR27917.1| hypothetical protein NRG857_12505 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315288065|gb|EFU47465.1| conserved hypothetical protein [Escherichia coli MS 110-3]
 gi|315292447|gb|EFU51799.1| conserved hypothetical protein [Escherichia coli MS 153-1]
 gi|320196350|gb|EFW70974.1| hypothetical protein EcoM_01743 [Escherichia coli WV_060327]
 gi|323949173|gb|EGB45064.1| yfgM [Escherichia coli H252]
 gi|323955754|gb|EGB51512.1| yfgM [Escherichia coli H263]
 gi|324008521|gb|EGB77740.1| hypothetical protein HMPREF9532_01786 [Escherichia coli MS 57-2]
 gi|330912288|gb|EGH40798.1| hypothetical protein ECAA86_02687 [Escherichia coli AA86]
 gi|331043070|gb|EGI15210.1| putative inner membrane protein [Escherichia coli M605]
 gi|331054323|gb|EGI26350.1| putative inner membrane protein [Escherichia coli TA206]
          Length = 206

 Score = 51.9 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 73/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A  +IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-KALAVGVILGVGALIGWRYWNSHQVDSARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDAIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|86159982|ref|YP_466767.1| hypothetical protein Adeh_3564 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85776493|gb|ABC83330.1| conserved hypothetical protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 433

 Score = 51.9 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 57/135 (42%), Gaps = 7/135 (5%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
            A+  EL      D AR++ E+ L    K    L+ +  A     +G   +AA  + ++ 
Sbjct: 19  LARGTELLAQGDADRARAALERALELGPKDAKVLALLGQACY--RQGQFDDAAIAWQRLV 76

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
           +++    A    A +      +    +EE  + L+ ++   NP H+ A   LG++ L+ G
Sbjct: 77  DENPVEPA----ARVNLGLAFLKAKHHEEARRQLE-IALDLNPDHRKAMGYLGLALLESG 131

Query: 177 KVQKAKTIFEELAKD 191
               A+  F +   D
Sbjct: 132 DPAAAREWFRKAGSD 146


>gi|257453873|ref|ZP_05619151.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
 gi|257448800|gb|EEV23765.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
          Length = 279

 Score = 51.9 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 38/189 (20%), Positives = 66/189 (34%), Gaps = 21/189 (11%)

Query: 18  KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGE--------------NFAQALEL 63
           K    +I   +IL++     W Y              +                  A + 
Sbjct: 21  KQYGGYILSAIILVLAGYFGWSYWQKHGGNIDTAAANDFAKIQSDQNNIETLTTQAASDT 80

Query: 64  FNSNKLDDARSSFEK-----ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
               +L  A+++ +K     + + DN +Y   + M  A     K D K AA    K +  
Sbjct: 81  KAQAQLTTAQTNLDKDLGEFVANHDNSVYTWQALMLQAKQQTDKNDLKAAAATLQKASQL 140

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKV 178
            L    ++  A L+ A +L+  +  +   K LQ  S           EILG  A + G  
Sbjct: 141 TLKDDGLKAIAILRQAQVLLSDNQADAAQKRLQ--SPLPAAFEASKLEILGDIANQQGDK 198

Query: 179 QKAKTIFEE 187
           + A T +++
Sbjct: 199 KAAATHYQK 207


>gi|300717949|ref|YP_003742752.1| hypothetical protein [Erwinia billingiae Eb661]
 gi|299063785|emb|CAX60905.1| Conserved uncharacterized protein [Erwinia billingiae Eb661]
          Length = 206

 Score = 51.9 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 33/209 (15%), Positives = 72/209 (34%), Gaps = 7/209 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           SN +      +    +     +  ++I  I +LA W Y      +         + Q   
Sbjct: 5   SNENEQVDALRGFFAQNGKALVIGVII-GIGALAGWRYWSSH-EDGSSRETSAAYQQVSG 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +S+K  +  ++  K  S+++  Y  L+++ +A           AA        D    
Sbjct: 63  ALDSSKP-ETLAAAAKFASENSNTYGALASLDVAKRYADGNQLDQAAAQLQSGLKDTK-D 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++    L+ A I +     +E  K L  +            ++ G + L  G  + A 
Sbjct: 121 ANLQAVLNLRLARIQLQQKKPDEAVKTLDLIKGDG--WTAIVADVRGEALLSKGDTKGAH 178

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIA 211
             + +   D+++   +    QM + N+  
Sbjct: 179 DAWSK-GIDSDASPALKEMLQMKMNNLPG 206


>gi|170767286|ref|ZP_02901739.1| conserved hypothetical protein [Escherichia albertii TW07627]
 gi|170123620|gb|EDS92551.1| conserved hypothetical protein [Escherichia albertii TW07627]
          Length = 206

 Score = 51.9 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 73/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A  +IL + +L  W Y      E  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-KALAVGVILGVGALIGWRYWNSHQVESARS-ASLAYQNAVIA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|327394801|dbj|BAK12223.1| transmembrane protein YfgM [Pantoea ananatis AJ13355]
          Length = 205

 Score = 51.9 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 31/194 (15%), Positives = 65/194 (33%), Gaps = 6/194 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           SN +      +        K +A  +++ I +L  W Y      +     V   + +   
Sbjct: 5   SNENEQVDALRRFFANNG-KALAVGVVIGIAALGGWRYWSSHQQDS-AKTVSAEYQKVTR 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
              + K  +   +     S+++  Y  L+ + +A   V       AA +      D    
Sbjct: 63  AMQAGKP-ETLEAVNTFASENSNTYGALAALDLAKQYVDSNQLDKAATLLQNGLKDTK-D 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++    L+ A I +  +  +   K L  +            +I G + L  G  Q A+
Sbjct: 121 ANLQAVINLRLARIQLQQNQADAALKTLDSVKGDG--WTAIVADIRGEALLSKGDKQGAR 178

Query: 183 TIFEELAKDNNSPF 196
             + +  + + SP 
Sbjct: 179 DAWSKGVESDASPA 192


>gi|148270125|ref|YP_001244585.1| TPR repeat-containing protein [Thermotoga petrophila RKU-1]
 gi|147735669|gb|ABQ47009.1| Tetratricopeptide TPR_2 repeat protein [Thermotoga petrophila
           RKU-1]
          Length = 357

 Score = 51.9 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 62/135 (45%), Gaps = 9/135 (6%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           F      +  N+ D A  + E++L  D      L  +    +    G+ + A E+  K+ 
Sbjct: 203 FMITEAYYEMNRKDLAVKALERLLEIDPDNIPALYQLSQ--LYRELGNEEKAREMEEKIM 260

Query: 117 N-DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
           N     P  +   A +     ++    Y+E+++ L+K+   S+P++  A  +L +  +K 
Sbjct: 261 NCKPKYPTELEPWARV-----MLKHGRYKEVAEELEKI-VESSPLNTLARLLLVVPYVKL 314

Query: 176 GKVQKAKTIFEELAK 190
           G++ KA+ I +++ +
Sbjct: 315 GQIDKAREILDDIGQ 329


>gi|84387627|ref|ZP_00990644.1| hypothetical protein V12B01_09156 [Vibrio splendidus 12B01]
 gi|84377472|gb|EAP94338.1| hypothetical protein V12B01_09156 [Vibrio splendidus 12B01]
          Length = 204

 Score = 51.9 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 33/196 (16%), Positives = 72/196 (36%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +++    +      K   K +    ++ +  L  W Y  D   E +  +  E +   +  
Sbjct: 5   DSEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVEAR-EVASEGYTSVISA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            ++  +D        I +  +  Y+ L+ M +A   V  GD   A E   + A       
Sbjct: 64  LDAKGVDAQSDIQAFIDANKDAEYSVLAAMQLAKAQVQAGDLAAALEQL-EWAKSATKDA 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+    T +AA I  +   ++     L+ +++ S        E+ G  +L+ G    A +
Sbjct: 123 ALTPLLTYRAARIKAEQGEFDAALTDLEAMTDESWTGRVA--ELRGDISLRKGDTDAAYS 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  +  ++   + 
Sbjct: 181 AYSEAQQAADASQTLQ 196


>gi|56476108|ref|YP_157697.1| putative transmembrane protein [Aromatoleum aromaticum EbN1]
 gi|56312151|emb|CAI06796.1| putative transmembrane protein [Aromatoleum aromaticum EbN1]
          Length = 215

 Score = 51.9 bits (123), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 64/152 (42%), Gaps = 4/152 (2%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNK-LYNPLSNMY 94
           ++ +  F     K+ +  G  +    +         AR +  +I+ + +  +Y  ++ + 
Sbjct: 37  SVGWQGFRWYQNKQASEAGALYFVVQQAAERGDAQKAREAAGQIIEKFSGTVYAEMAALL 96

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLS 154
            A +  + G+ KNA      +         +R  A L+ AS+L+D  ++ +    LQ  +
Sbjct: 97  SAGVQFSAGEGKNARAQLEWLVE-HGDDAVLRDIARLRLASVLLDEGAHADALARLQ--A 153

Query: 155 EPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
           EP   +     ++ G      GK+ +A++ ++
Sbjct: 154 EPDAALKGRFADLRGDVLAANGKLAEARSAYQ 185


>gi|110642678|ref|YP_670408.1| hypothetical protein ECP_2518 [Escherichia coli 536]
 gi|110344270|gb|ABG70507.1| hypothetical protein YfgM (putative membrane protein) [Escherichia
           coli 536]
          Length = 206

 Score = 51.9 bits (123), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 73/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   + +A  +IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-QALAVGVILGVGALIGWRYWNSHQVDSARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|326336387|ref|ZP_08202558.1| TPR-domain containing protein [Capnocytophaga sp. oral taxon 338
           str. F0234]
 gi|325691561|gb|EGD33529.1| TPR-domain containing protein [Capnocytophaga sp. oral taxon 338
           str. F0234]
          Length = 995

 Score = 51.9 bits (123), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 26/175 (14%), Positives = 65/175 (37%), Gaps = 5/175 (2%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPL-SNMY 94
           A W             +    F  A   +  NK  +A+ + EK L +  K  N   +  Y
Sbjct: 700 AQWAKSLGYVEVSDNELDNAAFEAAERQYIQNKKQEAKGALEKYLKEFPKGVNTAQARFY 759

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL- 153
           +A +       + A  ++ KV  +            ++ ++I ++    +++  +L+++ 
Sbjct: 760 LAQLYFEANQKEKALPLYEKVLEEGR--NEYSEQVLVRLSNIYLEKEEIDKVIPLLKEIE 817

Query: 154 -SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
            +        FA   L     +     +A    +++  + N+   +   +++I+A
Sbjct: 818 KTSSVAQNLIFARSNLMKGFYRQKDYPQAIEYAKKILAEKNADNRLKNDARVIMA 872



 Score = 42.7 bits (99), Expect = 0.037,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 7/143 (4%)

Query: 58  AQALELFNSNKLDDARSSFEKILSQDNKL-YNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           + AL L  +     A +  E+ L       Y   +N  I     +KG+TK+A   + KV 
Sbjct: 74  SSALRLGQAG----ANAQMEQYLRDYPSSPYATNANFEIGEYYFSKGNTKSAIAWYDKV- 128

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
                  A R     Q    L      E  ++      + S    + A+  LG  A    
Sbjct: 129 QISSLSAAQREKFNFQYGYALFAHGDKET-AQRYLSQVKDSKEYGKKASYYLGYIAYDAD 187

Query: 177 KVQKAKTIFEELAKDNNSPFGIS 199
             ++A   F+++ ++      +S
Sbjct: 188 DYKQANEFFQKVGQEKELNKNLS 210


>gi|22125254|ref|NP_668677.1| hypothetical protein y1355 [Yersinia pestis KIM 10]
 gi|45442515|ref|NP_994054.1| hypothetical protein YP_2743 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597155|ref|YP_071346.1| hypothetical protein YPTB2839 [Yersinia pseudotuberculosis IP
           32953]
 gi|108808311|ref|YP_652227.1| hypothetical protein YPA_2317 [Yersinia pestis Antiqua]
 gi|108811424|ref|YP_647191.1| hypothetical protein YPN_1261 [Yersinia pestis Nepal516]
 gi|145599494|ref|YP_001163570.1| hypothetical protein YPDSF_2222 [Yersinia pestis Pestoides F]
 gi|149365337|ref|ZP_01887372.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|153948923|ref|YP_001400169.1| hypothetical protein YpsIP31758_1188 [Yersinia pseudotuberculosis
           IP 31758]
 gi|162419351|ref|YP_001605022.1| hypothetical protein YpAngola_A0416 [Yersinia pestis Angola]
 gi|165925919|ref|ZP_02221751.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165937074|ref|ZP_02225639.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166008103|ref|ZP_02229001.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212296|ref|ZP_02238331.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167398834|ref|ZP_02304358.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421303|ref|ZP_02313056.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167423399|ref|ZP_02315152.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167470076|ref|ZP_02334780.1| hypothetical protein YpesF_19823 [Yersinia pestis FV-1]
 gi|186896250|ref|YP_001873362.1| membrane protein [Yersinia pseudotuberculosis PB1/+]
 gi|218929937|ref|YP_002347812.1| hypothetical protein YPO2877 [Yersinia pestis CO92]
 gi|229838456|ref|ZP_04458615.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229895158|ref|ZP_04510334.1| conserved protein [Yersinia pestis Pestoides A]
 gi|229899023|ref|ZP_04514167.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901681|ref|ZP_04516803.1| conserved protein [Yersinia pestis Nepal516]
 gi|270489876|ref|ZP_06206950.1| conserved hypothetical protein [Yersinia pestis KIM D27]
 gi|294504561|ref|YP_003568623.1| hypothetical protein YPZ3_2451 [Yersinia pestis Z176003]
 gi|21958125|gb|AAM84928.1|AE013738_5 hypothetical protein y1355 [Yersinia pestis KIM 10]
 gi|45437380|gb|AAS62931.1| putative membrane protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|51590437|emb|CAH22077.1| putative membrane protein [Yersinia pseudotuberculosis IP 32953]
 gi|108775072|gb|ABG17591.1| membrane protein [Yersinia pestis Nepal516]
 gi|108780224|gb|ABG14282.1| putative membrane protein [Yersinia pestis Antiqua]
 gi|115348548|emb|CAL21488.1| putative membrane protein [Yersinia pestis CO92]
 gi|145211190|gb|ABP40597.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149291750|gb|EDM41824.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|152960418|gb|ABS47879.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           31758]
 gi|162352166|gb|ABX86114.1| conserved hypothetical protein [Yersinia pestis Angola]
 gi|165914937|gb|EDR33549.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165922123|gb|EDR39300.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165992485|gb|EDR44786.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206227|gb|EDR50707.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960792|gb|EDR56813.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167051338|gb|EDR62746.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057569|gb|EDR67315.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|186699276|gb|ACC89905.1| membrane protein [Yersinia pseudotuberculosis PB1/+]
 gi|229681610|gb|EEO77704.1| conserved protein [Yersinia pestis Nepal516]
 gi|229687968|gb|EEO80040.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229694822|gb|EEO84869.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701920|gb|EEO89943.1| conserved protein [Yersinia pestis Pestoides A]
 gi|262362444|gb|ACY59165.1| hypothetical protein YPD4_2258 [Yersinia pestis D106004]
 gi|262366549|gb|ACY63106.1| hypothetical protein YPD8_2431 [Yersinia pestis D182038]
 gi|270338380|gb|EFA49157.1| conserved hypothetical protein [Yersinia pestis KIM D27]
 gi|294355020|gb|ADE65361.1| hypothetical protein YPZ3_2451 [Yersinia pestis Z176003]
 gi|320016013|gb|ADV99584.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 211

 Score = 51.5 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 70/191 (36%), Gaps = 7/191 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFAQALELFNSNKL-DDARSSFEK 78
           K +A  ++L I +L  W Y     +          +  + AL   ++  +  D+ +  EK
Sbjct: 23  KALAVGVVLGIGALVGWRYWQGNQNTAMTEASSAYQKVSTALSTNSAGNVSADSIALAEK 82

Query: 79  ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV 138
            +  +   Y  L  + +A   V +     AA+   +          +     L+ A + +
Sbjct: 83  FVQSNKNNYGVLVGLELAHDFVEQNAFDKAAQQLSQALGQTKDENLL-SLINLRLARVQL 141

Query: 139 DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
                +E  K L  +          A ++ G + L  G    A+  + + A ++N+   +
Sbjct: 142 QLKKPDEALKTLDAVQGDG--WTAMAQDVRGDALLSKGDTAGARAAYSK-AIESNASQAL 198

Query: 199 STRSQMILANI 209
               +M L N+
Sbjct: 199 QALLRMKLNNL 209


>gi|110806444|ref|YP_689964.1| hypothetical protein SFV_2560 [Shigella flexneri 5 str. 8401]
 gi|110615992|gb|ABF04659.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|332754200|gb|EGJ84568.1| hypothetical protein SF434370_2727 [Shigella flexneri 4343-70]
 gi|333001734|gb|EGK21300.1| hypothetical protein SFK218_3509 [Shigella flexneri K-218]
 gi|333002308|gb|EGK21872.1| hypothetical protein SFK272_3305 [Shigella flexneri K-272]
 gi|333016131|gb|EGK35463.1| hypothetical protein SFK227_3142 [Shigella flexneri K-227]
          Length = 206

 Score = 51.5 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 72/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A   IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-KALAVGGILGVGALIGWRYWNSHQVDSARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|291618409|ref|YP_003521151.1| YfgM [Pantoea ananatis LMG 20103]
 gi|291153439|gb|ADD78023.1| YfgM [Pantoea ananatis LMG 20103]
          Length = 205

 Score = 51.5 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 30/194 (15%), Positives = 65/194 (33%), Gaps = 6/194 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           SN +      +        K +A  +++ I +L  W Y      +     +   + +   
Sbjct: 5   SNENEQVDALRRFFANNG-KALAVGVVIGIAALGGWRYWSSHQQDS-AKTISAEYQKVTR 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
              + K  +   +     S+++  Y  L+ + +A   V       AA +      D    
Sbjct: 63  AMQAGKP-ETLEAVNTFASENSNTYGALAALDLAKQYVDSNQLDKAATLLQNGLKDTK-D 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++    L+ A I +  +  +   K L  +            +I G + L  G  Q A+
Sbjct: 121 ANLQAVINLRLARIQLQQNQADAALKTLDSVKGDG--WTAIVADIRGEALLSKGDKQGAR 178

Query: 183 TIFEELAKDNNSPF 196
             + +  + + SP 
Sbjct: 179 DAWSKGVESDASPA 192


>gi|237654045|ref|YP_002890359.1| hypothetical protein Tmz1t_3388 [Thauera sp. MZ1T]
 gi|237625292|gb|ACR01982.1| conserved hypothetical protein [Thauera sp. MZ1T]
          Length = 214

 Score = 51.5 bits (122), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 51/132 (38%), Gaps = 2/132 (1%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y      L ++    ++ +  ++    +     G  +    +    N+   AR +  +++
Sbjct: 22  YGNFVVTLAVVAALASVGWQAWNWYQSRNAGEAGALYYAVQQAVEKNEPQKAREAAGRLV 81

Query: 81  SQDNKLYNP-LSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
           S+        L  +  A++    GD  NA    L+ A D  +  A+R  A L+ A++L+ 
Sbjct: 82  SEHGGSVGAQLGALLSAAMQFESGDLANA-RAQLEWAADKGSDPALRELARLRLAAVLLQ 140

Query: 140 TSSYEEISKILQ 151
               +     LQ
Sbjct: 141 AGELDAALARLQ 152


>gi|15803036|ref|NP_289066.1| hypothetical protein Z3776 [Escherichia coli O157:H7 EDL933]
 gi|12516904|gb|AAG57623.1|AE005480_10 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
          Length = 206

 Score = 51.5 bits (122), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 73/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A  +IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAIKRFFAENG-KALAVGVILGVGALIGWRYWNSHQVDXARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|291613883|ref|YP_003524040.1| hypothetical protein Slit_1416 [Sideroxydans lithotrophicus ES-1]
 gi|291583995|gb|ADE11653.1| Protein of unknown function DUF2133 [Sideroxydans lithotrophicus
           ES-1]
          Length = 212

 Score = 51.5 bits (122), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 75/206 (36%), Gaps = 5/206 (2%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    +      K   KW+   L++  +  A   Y  +    +      + +A+ ++  
Sbjct: 7   QEQEQVEELKAWWKANGKWVVGALLVGSIGFAGTTYWRNHKASQAAEAA-KLYAEVVKQV 65

Query: 65  NSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            SN       + + ++S+  +  Y P + +  A   +   D  +A      V        
Sbjct: 66  ASNDAKRISDAADALVSRYGSSAYAPRAQLLAAQANLQARDAAHAKVELQWVIE-HADET 124

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++  A L+ AS+L+D   Y+E  K L      S            +SA   GK+ +A+ 
Sbjct: 125 GLQDTARLKLASVLLDEKKYDEALKQLDAAHPDSFTGLYSDLRGDVLSA--QGKIAEARV 182

Query: 184 IFEELAKDNNSPFGISTRSQMILANI 209
            +++     ++  G     Q+ L  +
Sbjct: 183 AYQQAYDKMDAKSGYRNLIQLKLDGL 208


>gi|317490871|ref|ZP_07949307.1| hypothetical protein HMPREF0864_00069 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920418|gb|EFV41741.1| hypothetical protein HMPREF0864_00069 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 206

 Score = 51.5 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 69/172 (40%), Gaps = 6/172 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +++ I +L  W Y  +     +     +++ QA E     K  D  +  EK + 
Sbjct: 23  KALAIGVVIGIGALLGWRYWQNHQQ-AEMTGASQSYQQASEALTGGK-ADGVALAEKFIE 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           ++   Y  L+ + +A   V + D   A E  L  A        ++    L+ A + +  +
Sbjct: 81  KNANNYGVLAALQLAQHEVDQKDFAKA-EHQLAWAQGQAKDENLKSLIDLRLARVQLQEN 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE-LAKDN 192
             ++  K L  +          A ++ G   +K G V+ A+  + + LA D 
Sbjct: 140 KLDDALKTLDLVKATG--WVAMAQDVRGDVLVKKGDVKGAREAYSKGLASDA 189


>gi|293410927|ref|ZP_06654503.1| UPF0070 protein yfgM [Escherichia coli B354]
 gi|291471395|gb|EFF13879.1| UPF0070 protein yfgM [Escherichia coli B354]
          Length = 206

 Score = 51.5 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 73/193 (37%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A  +IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-KALAVGVILGVGALIGWRYWNSHQVDSARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  +            ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKLADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|331684161|ref|ZP_08384757.1| putative inner membrane protein [Escherichia coli H299]
 gi|331079113|gb|EGI50315.1| putative inner membrane protein [Escherichia coli H299]
          Length = 206

 Score = 51.5 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 74/193 (38%), Gaps = 6/193 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      K    +   K +A  +IL + +L  W Y      +  ++     +  A+  
Sbjct: 6   NENDQVEAVKRFFAENG-KALAVGVILGVGALIGWRYWNSHQVDSARS-ASLAYQNAVTA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K D   ++ EK  +++   Y  L+++ +A   V K + + AA    +   D     
Sbjct: 64  VSEGKPDSIPAA-EKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS-DE 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++    L+ A + V     +   K L  + +          ++ G + L  G  Q A++
Sbjct: 122 NLKAVINLRLARVQVQLKQADAALKTLDAIKDEG--WAAIVADLRGEALLSKGDKQGARS 179

Query: 184 IFEELAKDNNSPF 196
            +E   K + +P 
Sbjct: 180 AWEAGVKSDVTPA 192


>gi|256829285|ref|YP_003158013.1| hypothetical protein Dbac_1504 [Desulfomicrobium baculatum DSM
           4028]
 gi|256578461|gb|ACU89597.1| conserved hypothetical protein [Desulfomicrobium baculatum DSM
           4028]
          Length = 215

 Score = 51.1 bits (121), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 30/168 (17%), Positives = 65/168 (38%), Gaps = 9/168 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K I   +  +++++A++  +      +++  V E     + + +           E   +
Sbjct: 34  KPIGITVGGIVMAVAVYSGVTTYQESQREKAVSE-LGVIMTMADQ---TARIEKLEAFAA 89

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
              K     + + +A I + + D + AA  +  V         +R  A L  A  L+   
Sbjct: 90  SGPKELRSAAQLELARIFMDQNDYEKAAGAWRSVGQSSD----IRVIAGLGEAKALILKG 145

Query: 142 SYEEISKILQKLSEPSNPMHQFANEI-LGISALKFGKVQKAKTIFEEL 188
            Y +  +IL  L + ++     A    L  +A K G++  A + +E L
Sbjct: 146 EYAKAVEILSGLKKDASQEFLPAISANLAFAAEKAGQIDLAISEYEAL 193


>gi|86145596|ref|ZP_01063926.1| hypothetical protein MED222_01542 [Vibrio sp. MED222]
 gi|85836567|gb|EAQ54693.1| hypothetical protein MED222_01542 [Vibrio sp. MED222]
          Length = 204

 Score = 51.1 bits (121), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 33/196 (16%), Positives = 72/196 (36%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +++    +      K   K +    ++ +  L  W Y  D   E +     E++  A+  
Sbjct: 5   DSEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVEAR-EAASESYTSAISA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            ++  +D        I +  +  Y+ L+ M +A   V  GD   A E   + A       
Sbjct: 64  LDAKGVDAQSDIQAFIDANKDAEYSVLAAMQLAKAQVQAGDLTAALEQL-EWAKSATKDA 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+    T + A I  +   ++     L+ +++ S        E+ G  +L+ G    A +
Sbjct: 123 ALAPLLTYRVARIKAEQGEFDAALTDLEAMTDES--WKDRVAELRGDISLRKGDTDAAYS 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  +  ++   + 
Sbjct: 181 AYSEAQQAADASQTLQ 196


>gi|239815180|ref|YP_002944090.1| hypothetical protein Vapar_2189 [Variovorax paradoxus S110]
 gi|239801757|gb|ACS18824.1| conserved hypothetical protein [Variovorax paradoxus S110]
          Length = 230

 Score = 51.1 bits (121), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 21/133 (15%), Positives = 47/133 (35%), Gaps = 2/133 (1%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y  +   ++L++    + +  +      K       + +      S  ++  +     + 
Sbjct: 23  YGTLITWVVLLVAGAFVAWNGWQYFQRNKAAQAAALYDEVERSTQSGDVERIQRVLGDMK 82

Query: 81  SQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
            +     Y   + +  A  L  KG+ + +      VA         +  A L+ A+ L+D
Sbjct: 83  ERFAGTAYAQQAGLLAAKALYEKGNAEASRAALGWVA-QSAVDPGYKAVAKLRLAAELLD 141

Query: 140 TSSYEEISKILQK 152
           + SY+E  K L  
Sbjct: 142 SKSYDEALKQLSG 154


>gi|21242763|ref|NP_642345.1| hypothetical protein XAC2019 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21108243|gb|AAM36881.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 212

 Score = 51.1 bits (121), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 21/149 (14%), Positives = 50/149 (33%), Gaps = 10/149 (6%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +              +   ++   +  LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQTRTNTALVEANGRYEAVVKSIQAKDLDKAAKDIVALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A +       D  A   ++     + A +L ++   +E  K+L    +   
Sbjct: 101 QVDAGKNDEAIKTL----RDVPAEGELKQIVQQRLARLLTESGKPDEAIKLLADAQD--- 153

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEE 187
                + EI   + +  GK  +A+ ++ +
Sbjct: 154 ---HASLEIRADALVVQGKPDEARALYAK 179


>gi|15644443|ref|NP_229495.1| hypothetical protein TM1695 [Thermotoga maritima MSB8]
 gi|4982272|gb|AAD36762.1|AE001810_1 conserved hypothetical protein [Thermotoga maritima MSB8]
          Length = 357

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/137 (21%), Positives = 63/137 (45%), Gaps = 9/137 (6%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           F      +  N+ D A  + E++L  D      L  +    +    G+ + A E+  K+ 
Sbjct: 203 FMITEAYYEMNRKDLAVKTLERLLEIDPDNIPALYQLSQ--LYRELGNEEKAREMEEKIM 260

Query: 117 N-DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
           N     P  +   A +     ++    Y+E+++ L+K+   S+P++  A  +L +  +K 
Sbjct: 261 NCKPKYPTELEPWARV-----MLKHGRYKEVAEELEKI-VESSPLNTLARLLLVVPYVKL 314

Query: 176 GKVQKAKTIFEELAKDN 192
           G++ KA+ I +++ + N
Sbjct: 315 GQIDKAREILDDIGQSN 331


>gi|29654550|ref|NP_820242.1| hypothetical protein CBU_1247 [Coxiella burnetii RSA 493]
 gi|153208853|ref|ZP_01947077.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154706028|ref|YP_001424684.1| hypothetical protein CBUD_1331 [Coxiella burnetii Dugway 5J108-111]
 gi|165921441|ref|ZP_02219629.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|212218661|ref|YP_002305448.1| hypothetical protein CbuK_1107 [Coxiella burnetii CbuK_Q154]
 gi|29541817|gb|AAO90756.1| hypothetical protein CBU_1247 [Coxiella burnetii RSA 493]
 gi|120575704|gb|EAX32328.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154355314|gb|ABS76776.1| hypothetical protein CBUD_1331 [Coxiella burnetii Dugway 5J108-111]
 gi|165916756|gb|EDR35360.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|212012923|gb|ACJ20303.1| hypothetical protein CbuK_1107 [Coxiella burnetii CbuK_Q154]
          Length = 206

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 66/186 (35%), Gaps = 5/186 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E  +D    +   K  +   + IA  +++ +L    W Y      E K       + Q  
Sbjct: 3   ELLSDQEQIEMIKKWWRDYGRAIALAIVIGLLIGFGWRYWHRHQLE-KTERASALYMQLQ 61

Query: 62  ELFNSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            L + N  D  +   ++++       Y  +++   A   V +     A +    V   + 
Sbjct: 62  ILASQNAWDKTKPLTDRLIKDYGKTPYAAMASFLNAKRAVEQNHLPLALDQLQWVMK-NA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  A L+A+ IL+  +  +    +LQ  +          +EI G      G  + 
Sbjct: 121 IVSDLKQLARLRASRILLAENRPKAALNLLQ--TVDDQAYQPLVDEIKGDIYAAMGNRES 178

Query: 181 AKTIFE 186
           AK  +E
Sbjct: 179 AKQFYE 184


>gi|226954469|ref|ZP_03824933.1| tetratricopeptide TPR_4 [Acinetobacter sp. ATCC 27244]
 gi|294651485|ref|ZP_06728798.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|226834818|gb|EEH67201.1| tetratricopeptide TPR_4 [Acinetobacter sp. ATCC 27244]
 gi|292822635|gb|EFF81525.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 232

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 38/191 (19%), Positives = 76/191 (39%), Gaps = 8/191 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGEN---F 57
           M  ++D      K    K     I+ +LI +I +   W Y    +  + +N   +     
Sbjct: 1   MSLSDDEQLDSLKSFAKKYGSAIISGILIALI-AFFGWEYWQKKTQAEAQNQTAKVQKLI 59

Query: 58  AQALELF-NSNKLDDARSSFEKILSQD-NKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
            +A  L    N  +    + +KI+ +D N ++     + +A +   K D   A +   KV
Sbjct: 60  DEAQALAGQPNAFETISEAADKIVKEDANSVHAIQVQLLLAKLAYDKDDYAAAEKALKKV 119

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
            N  +    +     L+ A   +    Y+E  K L K++EP+      A+E+ G   +  
Sbjct: 120 ENSTIKDTGLVQIVKLRLADAQLAQKKYDEALKTLDKVTEPT--FKATADELRGDIYVAK 177

Query: 176 GKVQKAKTIFE 186
            + + A+  ++
Sbjct: 178 QETEAARKAYQ 188


>gi|58582154|ref|YP_201170.1| hypothetical protein XOO2531 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624046|ref|YP_451418.1| hypothetical protein XOO_2389 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188576713|ref|YP_001913642.1| hypothetical protein PXO_01056 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576904|ref|YP_001913833.1| hypothetical protein PXO_06110 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58426748|gb|AAW75785.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84367986|dbj|BAE69144.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188521165|gb|ACD59110.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521356|gb|ACD59301.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 212

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/149 (14%), Positives = 51/149 (34%), Gaps = 10/149 (6%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +      +       +   ++   +  LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQKYTNTELVEANTRYEAVVKSIQAKNLDKAAKDIMALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A +    V  +      V+     + A +L ++   +E  K+L    +   
Sbjct: 101 QVDVGKNAEAIKTLRDVPAEGELKQIVQQ----RLARVLTESGKPDEAIKLLADAQD--- 153

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEE 187
                + EI   + +  GK  +A+ ++ +
Sbjct: 154 ---HASLEIRADALVVQGKPDEARALYAK 179


>gi|238788168|ref|ZP_04631963.1| hypothetical protein yfred0001_36160 [Yersinia frederiksenii ATCC
           33641]
 gi|238723755|gb|EEQ15400.1| hypothetical protein yfred0001_36160 [Yersinia frederiksenii ATCC
           33641]
          Length = 206

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 71/188 (37%), Gaps = 6/188 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y     +          + QA +  ++N   D  +  EK + 
Sbjct: 23  KALAVGVVLGIGALVGWRYWQSHQN-SAMTEASSAYQQASDALSAN-SADGVALAEKFVQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +N  Y  L+ + +A   V + +   AA+   +          +     L+ A + +   
Sbjct: 81  GNNNNYGVLAGLELAHHFVEQNEFDKAAQQLTQALGQTKDENLL-SLINLRLARLQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             +E  K L  +          A ++ G + L  G    A+  + +   ++N+   +   
Sbjct: 140 KPDEALKTLDAVQGDG--WTAMAQDVRGDALLSKGDTAGARAAYSK-GVESNASQALQAL 196

Query: 202 SQMILANI 209
            +M L N+
Sbjct: 197 LRMKLNNL 204


>gi|325524776|gb|EGD02750.1| hypothetical protein B1M_19904 [Burkholderia sp. TJI49]
          Length = 209

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 37/202 (18%), Positives = 77/202 (38%), Gaps = 10/202 (4%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +   +    K    +  +  +   ++L  L +A  F  ++    ++       + Q  + 
Sbjct: 5   DEQESIESLKAWWAR--WGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKA 62

Query: 64  FNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +N     AR++ +      +  Y  ++ +  A +L A GDT  A +  L+ A D    
Sbjct: 63  AAANDKATMARAAADMEDKYGSTAYAQMTALAAAKVLYAAGDTAGA-KTQLQWAADHAKD 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+
Sbjct: 122 DEYKQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGLVADRRGDLLAAQGKTDDAR 179

Query: 183 TIF----EELAKDNNSPFGIST 200
             +    + L+KD+ S   +  
Sbjct: 180 AAYKLALDSLSKDDQSARQLVQ 201


>gi|212634301|ref|YP_002310826.1| putative membrane-associated protein with TPR-like domain
           [Shewanella piezotolerans WP3]
 gi|212555785|gb|ACJ28239.1| putative membrane-associated protein with TPR-like domain
           [Shewanella piezotolerans WP3]
          Length = 206

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 31/194 (15%), Positives = 72/194 (37%), Gaps = 10/194 (5%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  +      K          +    ++ +  L  W Y  D     +     E+F     
Sbjct: 5   STEEQQVDAIKQFWKDYGSSVVIG-AVVGLGGLFGWNYYSDY-QLAQAEAASESFQA--- 59

Query: 63  LFNSNKLDDARSSFEKILSQDNK--LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L + N  D A  S  +  ++++    Y  L  + +A   V  GD + A      V   + 
Sbjct: 60  LSSQNTADAAMLSAAETFAKEHGQQGYQSLLELMVAKSAVETGDLEKAEATLKNVIAVN- 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A  ++   AT++ A +  +   +      L+++ + ++   +   E+ G   ++ G+  K
Sbjct: 119 ADSSIVLIATMRLARVQAEQGQFATAITTLEQIKDVASAAQRD--ELKGDFLVRQGETDK 176

Query: 181 AKTIFEELAKDNNS 194
           A+  ++   ++  +
Sbjct: 177 ARLAYQAAVENGGT 190


>gi|294625015|ref|ZP_06703665.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292600690|gb|EFF44777.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 212

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/149 (14%), Positives = 51/149 (34%), Gaps = 10/149 (6%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +              +   ++   +  LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQTRTNTALVEANGRYEAVVKSIQAKDLDKAAKDIVALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A +       D  A   ++     + A +L ++   +E  K+L +  +   
Sbjct: 101 QVDAGKNAEAIKTL----RDVPAEGELKQIVQQRLARLLTESGKPDEAIKLLAEAQD--- 153

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEE 187
                + EI   + +  GK  +A+ ++ +
Sbjct: 154 ---HASLEIRADALVVQGKPDEARALYTK 179


>gi|157144553|ref|YP_001451872.1| hypothetical protein CKO_00273 [Citrobacter koseri ATCC BAA-895]
 gi|157081758|gb|ABV11436.1| hypothetical protein CKO_00273 [Citrobacter koseri ATCC BAA-895]
          Length = 206

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 70/175 (40%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL + +L  W Y      E  ++     +  A+   ++ K D + S+ EK  +
Sbjct: 23  KALAVGVILGVGALLGWRYWTSHQTESARS-ASLAYQNAVTAVSAGKPD-SISAAEKFAT 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           ++   Y  L++M +A   V + + + AA    +          ++    L+ A + V   
Sbjct: 81  ENKNTYGALASMELAQQFVDQNELEKAAAQLQQGLAATS-DENLKAVINLRLARVQVQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L   +           ++ G + L  G  Q A++ +E   K + SP 
Sbjct: 140 QADTALKTLD--TVKGEGWAAIVADLRGEALLSKGDKQGARSAWEAGVKSDASPA 192


>gi|294666612|ref|ZP_06731851.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603632|gb|EFF47044.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 212

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/149 (14%), Positives = 51/149 (34%), Gaps = 10/149 (6%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +              +   ++   +  LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQTRTNTALVEANGRYEAVVKSIQAKDLDKAAKDIVALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A +    V  +      V+     + A +L ++   +E  K+L +  +   
Sbjct: 101 QVDAGKNAEAIKTLRDVPAEGELKQIVQQ----RLARLLTESGKPDEAIKLLAEAQD--- 153

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEE 187
                + EI   + +  GK  +A+ ++ +
Sbjct: 154 ---HASLEIRADALVVQGKPDEARALYTK 179


>gi|78047626|ref|YP_363801.1| hypothetical protein XCV2070 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78036056|emb|CAJ23747.1| putative membrane protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 212

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/147 (14%), Positives = 50/147 (34%), Gaps = 10/147 (6%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +              +   ++   +  LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQTRTNTALVEANGRYEAVVKSIQAKDLDKAAKDIVALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A +    +  D  A   ++     + A +L ++   +E  K+L    +   
Sbjct: 101 QVDAGKNAEAIK----ILRDVPAEGELKQIVQQRLARVLTESGKPDEAIKLLADAQD--- 153

Query: 159 PMHQFANEILGISALKFGKVQKAKTIF 185
                + EI   + +  GK  +A+ ++
Sbjct: 154 ---HASLEIRADALVAQGKPDEARALY 177


>gi|312884306|ref|ZP_07744015.1| hypothetical protein VIBC2010_11051 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368079|gb|EFP95622.1| hypothetical protein VIBC2010_11051 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 204

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 62/195 (31%), Gaps = 5/195 (2%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + K    +   K I    ++ +  L  W    D     +     +++   +E  
Sbjct: 7   EEQQIERIKELWNEYG-KVIVASAVIGLGGLFGWNQYQDSVIATQ-EATSDSYVAVIEEL 64

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
               +  A      I       Y+ L+ + +A + V  G+   A     + A       A
Sbjct: 65  ADKGVSAANDVQTFIDDNQKTQYSVLAALQLAKLQVEAGNLDEALAQL-EWAKSATQDTA 123

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +      + A + ++  +Y+     L               E+ G   L+ G  + A T 
Sbjct: 124 ISAVILHRLARLKLEQGNYDAALAELNL--VKDQGWAGRVAELKGDIFLRQGNTEAAYTA 181

Query: 185 FEELAKDNNSPFGIS 199
           + E  +D ++   + 
Sbjct: 182 YTEAQQDGDASQTLQ 196


>gi|91203185|emb|CAJ72824.1| hypothetical protein kustd2079 [Candidatus Kuenenia
           stuttgartiensis]
          Length = 319

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 70/172 (40%), Gaps = 15/172 (8%)

Query: 30  LMILSLAIWFYLFDGSHEK-----KKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
            ++L+ A  + L   S  K     + N+  E + Q +E       ++A   F K L+ D 
Sbjct: 17  AILLAGAFQYSLVYASSVKDQMPYRSNMAHEQYLQGVEYAKYGLHNEAIELFRKSLATDP 76

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN-DDLAPLAVRYAATLQAASILVDTSSY 143
              +   ++    +   K     A E+F KV   +   P A     T+       D   Y
Sbjct: 77  DNIDTCISLGE--VYADKRMDSEAIELFQKVLKINPNQPQAYFKIGTV-----YFDMEEY 129

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE-LAKDNNS 194
           E   + L+K +   NP ++ A  +LGIS  K GK  +A  + ++ +  D N 
Sbjct: 130 EPAIEYLKK-TIEMNPDYKVAYSLLGISYAKSGKYDEAVKVLKKRIELDPNL 180


>gi|152979677|ref|YP_001345306.1| hypothetical protein Asuc_2025 [Actinobacillus succinogenes 130Z]
 gi|150841400|gb|ABR75371.1| conserved hypothetical protein [Actinobacillus succinogenes 130Z]
          Length = 202

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 61/169 (36%), Gaps = 5/169 (2%)

Query: 26  PLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNK 85
             + ++ L+  I +  +      K   +   + QA+   +  K      +F  + + +  
Sbjct: 26  IAIFVIALAGVIGWRYWQDYQTVKAQEMSMAYEQAISHQDGAKKQTQIDAF--VQANEKT 83

Query: 86  LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE 145
            Y  L+ +  A   V K D  +AAE+  + A     P  +   A ++ A +      ++ 
Sbjct: 84  GYAALALLEKAKDAVNKQDFASAAEVLKQAAFHAPEP-VLAATANMRLAEVQFQQKDFDG 142

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
               L ++ E           +     L  G    AK  FEE+ K+  +
Sbjct: 143 ALATLAQVKETG--FANPKTLLTAEIQLAKGDKASAKAGFEEVLKNATA 189


>gi|170288929|ref|YP_001739167.1| TPR repeat-containing protein [Thermotoga sp. RQ2]
 gi|170176432|gb|ACB09484.1| Tetratricopeptide TPR_2 repeat protein [Thermotoga sp. RQ2]
          Length = 357

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/137 (21%), Positives = 60/137 (43%), Gaps = 9/137 (6%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           F         N+ D A  + E++L  D      L  +    +    G  + A E+  K+ 
Sbjct: 203 FMITEAYHEMNRKDLAVKALERLLEIDPDNIPALYQLSQ--LYRELGSEEKAREMEEKIM 260

Query: 117 N-DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
           N     P  +   A +     ++    Y+E+ + L+K+   S+P++  A  +L +  +K 
Sbjct: 261 NCKPKYPTELEPWARV-----MLKHGRYKEVVEELEKI-VESSPLNTLARLLLVVPYVKL 314

Query: 176 GKVQKAKTIFEELAKDN 192
           G++ KA+ I +++ + N
Sbjct: 315 GQIDKAREILDDIGQSN 331


>gi|330817165|ref|YP_004360870.1| hypothetical protein bgla_1g22870 [Burkholderia gladioli BSR3]
 gi|327369558|gb|AEA60914.1| hypothetical protein bgla_1g22870 [Burkholderia gladioli BSR3]
          Length = 209

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 38/202 (18%), Positives = 73/202 (36%), Gaps = 13/202 (6%)

Query: 4   NNDANSYKGKCKMGKC--CYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFAQ 59
           +   +    K    +      WI   +++++ +   W +       +     G  E   Q
Sbjct: 5   DEQESIESVKAWWARWGNLTTWILTAVLVVVAAWNGWNFW---QRHQASEASGLYEAVQQ 61

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           A+   +  K+  A +  E         Y  ++ +  A  L   GD+  A +  L+ A D 
Sbjct: 62  AVTSGDKAKIARAAADMED--KYGGTAYAQMTALAAAKGLYMAGDSAGA-KTQLQWAIDH 118

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
                 +  A L+ AS+L+D  SY+    +L   S+              ++A   GK  
Sbjct: 119 AKDDEYKQIAKLRLASLLLDEKSYDAGLALLNGTSDEGFKGLVADRRGDLLAA--QGKRD 176

Query: 180 KAKTIFEELAKDNNSPFGISTR 201
            A++ ++ LA D+        R
Sbjct: 177 DARSAYQ-LALDSLPKEDQRAR 197


>gi|56461132|ref|YP_156413.1| hypothetical protein IL2032 [Idiomarina loihiensis L2TR]
 gi|56180142|gb|AAV82864.1| Uncharacterized conserved membrane protein [Idiomarina loihiensis
           L2TR]
          Length = 204

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 67/194 (34%), Gaps = 5/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M++  +    + K    +     +A   +++   L   +  +D    + +     N+ Q 
Sbjct: 1   MDNTEEQQVERLKEFWKEHGKGIVAG--VVIGFGLFYGWRYYDQHTLETQQRASANYEQL 58

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               +    +    + E +      +Y  L  + +A   V + D   A      V  D  
Sbjct: 59  TAELSEGSENAVLEAQEFVSENPKNVYAQLVALQLAQHSVERADLATAVTALQSVV-DSA 117

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   A+++ A +L+     +    +++K          FA E+ G    + G  ++
Sbjct: 118 EDENMSALASIRLARVLIAQEQLDAALSLVKKPLPE--AYAGFAAELEGDILAEQGNTEE 175

Query: 181 AKTIFEELAKDNNS 194
           A+  +E   +   S
Sbjct: 176 ARAAYERALQAGES 189


>gi|220918792|ref|YP_002494096.1| Tetratricopeptide TPR_2 repeat protein [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219956646|gb|ACL67030.1| Tetratricopeptide TPR_2 repeat protein [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 426

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 57/135 (42%), Gaps = 7/135 (5%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
            A+  EL      D AR++ E+ L    K    L+ +  A     +G   +AA  + ++ 
Sbjct: 19  LARGTELLAQGDADRARAALERALDLGPKDAKVLALLGQACY--RQGQFDDAAIAWQRLV 76

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
           +++    A    A +      +    +EE  + L+ ++   NP H+ A   LG++ L+ G
Sbjct: 77  DENPVEPA----ARVNLGLAFLKAKHHEEARRQLE-IALDLNPDHRKAMGYLGLALLESG 131

Query: 177 KVQKAKTIFEELAKD 191
               A+  F +   D
Sbjct: 132 DPAGAREWFRKAGSD 146


>gi|260062000|ref|YP_003195080.1| hypothetical protein RB2501_10422 [Robiginitalea biformata
           HTCC2501]
 gi|88783562|gb|EAR14733.1| hypothetical protein RB2501_10422 [Robiginitalea biformata
           HTCC2501]
          Length = 1006

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 30/175 (17%), Positives = 54/175 (30%), Gaps = 5/175 (2%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEK-ILSQDNKLYNPLSNMY 94
           A W    D        +   +F  A +         A  + EK +    N      +   
Sbjct: 703 AAWVRGLDFVEVTDSELEAASFEAAEKQLVEGNDAAAARALEKYLEQFPNGANRVAAYFN 762

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL- 153
           +  I  A G    A   F  VA+      A +  A  +   ILV    Y      L++L 
Sbjct: 763 LGQIAYADGQADKALAHFEVVADAGRGERAEQ--ALTRVCEILVSRGDYAAAMPYLERLE 820

Query: 154 -SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
            +        FA   L     +     +     E++    +    I + +++++A
Sbjct: 821 ATADIPQNRTFAQSNLMKGYFEKQAYDRTLAYAEKVLASPSLDDRIRSDARLMIA 875



 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 53/158 (33%), Gaps = 4/158 (2%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
           + A     +        N V   F      +   + D A + FE +           +  
Sbjct: 738 AAARALEKYLEQFPNGANRVAAYFNLGQIAYADGQADKALAHFEVVADAGRGERAEQALT 797

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQK- 152
            +  ILV++GD   A     ++      P   R  A         +  +Y+      +K 
Sbjct: 798 RVCEILVSRGDYAAAMPYLERLEATADIPQN-RTFAQSNLMKGYFEKQAYDRTLAYAEKV 856

Query: 153 LSEP--SNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           L+ P   + +   A  ++  SA   G  +KA+  + E+
Sbjct: 857 LASPSLDDRIRSDARLMIARSAWATGNTEKARQAYAEV 894



 Score = 38.8 bits (89), Expect = 0.53,   Method: Composition-based stats.
 Identities = 32/189 (16%), Positives = 65/189 (34%), Gaps = 34/189 (17%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
           W+   D S   ++     +F     LF+S K ++A    +++   +++ Y   +  Y+  
Sbjct: 124 WYGKVDQSSLSRREKERFDFHMGYSLFSSRKPEEAERYLQRV--SNSQEYGSQAKYYLGY 181

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVR-------------YAATLQAASIL------- 137
           I   + D + A E F ++ + ++    +                A  QA S L       
Sbjct: 182 IAYQQDDYEAANERFDQITDQEVLEEKLSYYQADMNFKLGNFEQAIEQAVSQLPKSDRRE 241

Query: 138 ------------VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                        +   Y E    L+K        +     +LG +  K G  + A   F
Sbjct: 242 VSELNKIIGESYFNLGRYAEAIPYLEKYQGKRGRWNNTDYYLLGYAHYKQGDYENAIRQF 301

Query: 186 EELAKDNNS 194
            ++   ++S
Sbjct: 302 NKIVGGDDS 310


>gi|239997027|ref|ZP_04717551.1| putative membrane-associated protein with TPR-like domain
           [Alteromonas macleodii ATCC 27126]
          Length = 206

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 59/180 (32%), Gaps = 7/180 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  +      K    +     I      + L     +  +  +  + K      +  A+E
Sbjct: 5   ATEEQQVEAIKRFWKEHGTAIIVGAA--LGLGGLWGWRAYSEAQIETKEAASVAYQNAVE 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
            F +   D    +F  I    +  Y  ++++  A   V  GD   AA     V       
Sbjct: 63  TFGTEGSDAKVKAF--IEENKDSGYASIASLLAAKQAVDAGDLDAAASHLNSVV-TFAEN 119

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++  A+L+ + + ++ +  +     L  ++          +E+ G    K GK   A+
Sbjct: 120 DELKVLASLRLSRVQIEMNQLDAALSTLSNVTND--AFAAEVSELKGDVYQKQGKFDDAR 177


>gi|332162634|ref|YP_004299211.1| hypothetical protein YE105_C3014 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325666864|gb|ADZ43508.1| hypothetical protein YE105_C3014 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 206

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 71/188 (37%), Gaps = 6/188 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y     +          + QA +  ++N   D  +  EK + 
Sbjct: 23  KALAVGVVLGIGALVGWRYWQSHQNTVLTEASS-AYQQASDALSAN-SADGVAVAEKFVQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y  L+ + +A   V + +   AA+   +  +       +     L+ A + +   
Sbjct: 81  SNKNNYGVLAGLELAHHFVEQNEFDKAAQQLTQALSQTKDENLL-SLINLRLARLQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             +E  K L  +          A ++ G + L  G    A+  + +   ++N+   +   
Sbjct: 140 KPDEALKTLDAVQGDG--WTAMAQDVRGDALLSKGDTAGARAAYSK-GVESNASQALQAL 196

Query: 202 SQMILANI 209
            +M L N+
Sbjct: 197 LRMKLNNL 204


>gi|71908596|ref|YP_286183.1| putative transmembrane protein [Dechloromonas aromatica RCB]
 gi|71848217|gb|AAZ47713.1| putative transmembrane protein [Dechloromonas aromatica RCB]
          Length = 212

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 54/156 (34%), Gaps = 5/156 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E     ++ K   KM       +   L L ++    W   + GS   K + +     QA
Sbjct: 6   LEEQEQIDTLKTWWKMYGNLVTNVIVALSLAVIGWQGWN-WYQGSQATKASAIYGVLEQA 64

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
             + ++ K+  A              Y  L  M  A      GD K A      VA +  
Sbjct: 65  AAVGDAQKVKAAAGELA--EKFGGTNYAALGAMLAAKQSFEAGDLKTAKTQLSWVAENGK 122

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
               V+  A L+  ++ +D  +Y+E  K L     P
Sbjct: 123 D--EVKDLARLRLVAVQLDDKAYDEAMKQLDAAHAP 156


>gi|318606738|emb|CBY28236.1| mlr7403 protein [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 206

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 70/188 (37%), Gaps = 6/188 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y     +          + QA +  ++N   D  +  EK + 
Sbjct: 23  KALAVGVVLGIGALVGWRYWQSHQNTVLTEASS-AYQQASDALSAN-SADGVAVAEKFVQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y  L+ + +A   V + +   AA    +  +       +     L+ A + +   
Sbjct: 81  SNKNNYGVLAGLELAHHFVEQNEFDKAARQLTQALSQTKDENLL-SLINLRLARLQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             +E  K L  +          A ++ G + L  G    A+  + +   ++N+   +   
Sbjct: 140 KPDEALKTLDAVQGDG--WTAMAQDVRGDALLSKGDTAGARAAYSK-GVESNASQALQAL 196

Query: 202 SQMILANI 209
            +M L N+
Sbjct: 197 LRMKLNNL 204


>gi|291085039|ref|ZP_06570911.1| putative inner membrane protein [Citrobacter youngae ATCC 29220]
 gi|291071732|gb|EFE09841.1| putative inner membrane protein [Citrobacter youngae ATCC 29220]
          Length = 221

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 69/175 (39%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL + +L  W Y      E  ++     +   +   ++ K D   ++ EK  +
Sbjct: 38  KALAVGVILGVGALVGWRYWTSHQTESARS-ASLAYQNTVTAVSAGKPDSIPAA-EKFAA 95

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           ++   Y  L+++ +A   V + + + AA    +      +   ++    L+ A + V   
Sbjct: 96  ENKNTYGALASLELAQQFVDQNELEKAASQLQQ-GLSATSDENLKAVINLRLARVQVQLK 154

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L  +            ++ G + L  G  Q A++ +E   K + SP 
Sbjct: 155 QADTALKTLDAIKGEG--WTAIVADLRGEALLSKGDKQGARSAWEAGVKSDASPA 207


>gi|123441420|ref|YP_001005407.1| hypothetical protein YE1075 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088381|emb|CAL11172.1| putative membrane protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 206

 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 70/188 (37%), Gaps = 6/188 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y     +          + QA +  ++N   D  +  EK + 
Sbjct: 23  KALAVGVVLGIGALVGWRYWQSHQNTVLTEASS-AYQQASDALSAN-SADGVAVAEKFVQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y  L+ + +A   V + +   AA+   +          +     L+ A + +   
Sbjct: 81  SNKNNYGVLAGLELAHHFVEQNEFDKAAQQLTQALGQTKDENLL-SLINLRLARLQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             +E  K L  +          A ++ G + L  G    A+  + +   ++N+   +   
Sbjct: 140 KPDEALKTLDAVQGDG--WTAMAQDVRGDALLSKGDTAGARAAYSK-GVESNASQALQAL 196

Query: 202 SQMILANI 209
            +M L N+
Sbjct: 197 LRMKLNNL 204


>gi|163757156|ref|ZP_02164258.1| hypothetical protein KAOT1_00785 [Kordia algicida OT-1]
 gi|161322884|gb|EDP94231.1| hypothetical protein KAOT1_00785 [Kordia algicida OT-1]
          Length = 1012

 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 38/186 (20%), Positives = 78/186 (41%), Gaps = 6/186 (3%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPL-SNMY 94
           A W    D        +    +  A + F  N  D A   FEK ++Q     N + +N Y
Sbjct: 705 ANWVKDLDFVDVTNVELDKATYESAEKQFIQNNTDKAIEGFEKYINQFPNGLNAVKANFY 764

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE-EISKILQKL 153
           +A    +KG+T+     +  V  ++ +    +  A L    +  D  +    + K L++ 
Sbjct: 765 LAQSYFSKGETQKTIPHYEYVLQNEGSEYTEQALARLSQVFLETDNYTKAIPVLKRLEES 824

Query: 154 SE-PSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA-NIIA 211
           ++ P N    FA   L  ++ +     +A +  E++  ++     I + + +I+A + IA
Sbjct: 825 ADFPQNI--TFAQSNLMKASYELDNYTQAVSYAEKVLANDKVDNRIKSDAHVIIARSAIA 882

Query: 212 SDQRNK 217
           ++  +K
Sbjct: 883 TNDEDK 888



 Score = 35.0 bits (79), Expect = 6.9,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 36/106 (33%), Gaps = 2/106 (1%)

Query: 88  NPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEIS 147
              + + +A      G    A + + K + D     + R     +       +  Y++  
Sbjct: 103 RNSAYIDVADYYFENGKYARALKWYDK-SGDKGLTNSQREDYNFKKGYAYFTSKKYDQAK 161

Query: 148 KILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
              QKL   S      A    G  A +  K  +A   F+ +++++ 
Sbjct: 162 TYFQKLL-DSQKYGSQAKYYTGYIAYQEDKYDEANEYFDGVSEEDE 206


>gi|269140143|ref|YP_003296844.1| hypothetical protein ETAE_2800 [Edwardsiella tarda EIB202]
 gi|267985804|gb|ACY85633.1| hypothetical protein ETAE_2800 [Edwardsiella tarda EIB202]
 gi|304559977|gb|ADM42641.1| putative membrane protein [Edwardsiella tarda FL6-60]
          Length = 206

 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 54/154 (35%), Gaps = 5/154 (3%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
           +L  W Y              +++  A E  +  K D   +  E  + ++   Y  L+ +
Sbjct: 35  ALLGWRYWVGHQQANMAQ-ASQSYQLASEALSGGKQD-GVALSEAFIKENGNNYGVLAAL 92

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
            +A   V K D   A       A        ++  + L+ A + +  +  +   K L  +
Sbjct: 93  QLAQYEVEKSDFAKAQTQL-VWAAGQAKDENLKSLSDLRLARVQLQENQLDAALKTLDGV 151

Query: 154 SEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           +         A ++ G   LK G  + A+  + +
Sbjct: 152 TAKG--WQPLAQDVRGDVLLKKGDAKGAREAYSK 183


>gi|88858478|ref|ZP_01133120.1| putative membrane-associated protein with TPR-like domain
           [Pseudoalteromonas tunicata D2]
 gi|88820095|gb|EAR29908.1| putative membrane-associated protein with TPR-like domain
           [Pseudoalteromonas tunicata D2]
          Length = 211

 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/195 (13%), Positives = 70/195 (35%), Gaps = 6/195 (3%)

Query: 8   NSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKK---KNIVGENFAQALELF 64
           ++ + + +  K  ++     L++ ++      Y +   ++ +        + + + ++  
Sbjct: 5   STEEQQAEAIKRFFRENGTALVIGVVLGLGGLYGWKAYNQNQVESAEAASDAYEKLVKAD 64

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             NK +    + E I +  +  Y  L+    A   V K D   A E    +  ++  P  
Sbjct: 65  AQNKTNALAGADEFIKNNKDSSYAVLAAFVAAKEAVEKADFNLAKEKLTWITQNNKNPE- 123

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +   A  + A I ++  +Y+   K+L               E+ G      G + +A++ 
Sbjct: 124 LNAIANSRIARIELELKNYDAALKVLSVTMPE--AFKASVAELKGDVYRAQGDLGQARSA 181

Query: 185 FEELAKDNNSPFGIS 199
           ++  A         +
Sbjct: 182 YQAAADAGGLTNNAT 196


>gi|237732492|ref|ZP_04562973.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908031|gb|EEH93949.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 206

 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 68/175 (38%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL + +L  W Y      E  ++     +   +   ++ K D   ++ EK  +
Sbjct: 23  KALAVGIILGVGALVGWRYWTSHQTESARS-ASLAYQNTVTAVSAGKPDSIPAA-EKFAA 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           ++   Y  L+++ +A   V + + + AA    +          ++    L+ A + V   
Sbjct: 81  ENKNTYGALASLELAQQFVDQNELEKAASQLQQGLAATS-DENLKAVINLRLARVQVQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L  +            ++ G + L  G  Q A++ +E   K + SP 
Sbjct: 140 QADTALKTLDTIKGEG--WTAIVADLRGEALLSKGDKQGARSAWEAGVKSDASPA 192


>gi|330812018|ref|YP_004356480.1| thioredoxin [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327380126|gb|AEA71476.1| putative thioredoxin [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 290

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 45/124 (36%), Gaps = 2/124 (1%)

Query: 52  IVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEI 111
              + F QA  LF+  +  DA +    +L +DN     L  +  A  L  +G+   A  +
Sbjct: 119 AAADPFEQAQALFDDGRFADAEALLTVLLGEDNTNAKAL--ILYARCLTERGELDEAQTV 176

Query: 112 FLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGIS 171
              V +D+         A +Q   +        ++   L K  +    ++Q A + L   
Sbjct: 177 LDAVKSDEHKAALAGAKAQIQFLGLAKHLPDAADLKARLAKDPQDDEAVYQLAIQQLARQ 236

Query: 172 ALKF 175
             + 
Sbjct: 237 QYEA 240


>gi|283786129|ref|YP_003365994.1| hypothetical protein ROD_24561 [Citrobacter rodentium ICC168]
 gi|282949583|emb|CBG89201.1| putative membrane protein [Citrobacter rodentium ICC168]
          Length = 206

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 34/196 (17%), Positives = 70/196 (35%), Gaps = 6/196 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  N +      K    +   K +A  +IL + +L  W Y      E  ++    ++   
Sbjct: 3   MYENENDQVEAIKRFFAENG-KALAVGVILGVGALIGWRYWTSHQTESARS-ASLSYQNV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   N+ K  +  ++ EK  +++   Y  L++M +A   V +     A     +      
Sbjct: 61  VSSLNAGK-AENLTTAEKFAAENKNTYGALASMELAQQFVERSQLDKAVAQLQQGLAATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++   +L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVISLRLARVQVQLKQADTALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPF 196
           A++ +E       SP 
Sbjct: 177 ARSAWEAGVNSKASPA 192


>gi|251791828|ref|YP_003006548.1| protein 1057 [Aggregatibacter aphrophilus NJ8700]
 gi|247533215|gb|ACS96461.1| protein 1057 [Aggregatibacter aphrophilus NJ8700]
          Length = 204

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 30/187 (16%), Positives = 61/187 (32%), Gaps = 7/187 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E   + ++ K         YK+I    ++    +  W Y       +K +     + QA
Sbjct: 5   IEEEQELSAIKA---WWNENYKFIIVCFVIAFGGVFGWNYWQSH-QIQKIHSASAEYEQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L  +  +    A    + I + +   Y  L+ +  A I V   D   A +   +      
Sbjct: 61  LFNYAKDPKAQAEQFSQFIKNHEKTSYAVLALLDKAKIAVENNDFTLAEDALKQAMAQST 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ AS+      ++     L+             N + G   L  G  + 
Sbjct: 121 DD-ILSSITALRLASVQFQLGQFDPALDSLKL--VKEQAWSGAKNILAGDIQLAKGDKEA 177

Query: 181 AKTIFEE 187
           AK  +++
Sbjct: 178 AKASYQQ 184


>gi|78066580|ref|YP_369349.1| hypothetical protein Bcep18194_A5111 [Burkholderia sp. 383]
 gi|77967325|gb|ABB08705.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 209

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 75/199 (37%), Gaps = 7/199 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +   +    K    +  +  +   ++L  L +A  F  ++    ++       + Q  + 
Sbjct: 5   DEQESIESLKAWWAR--WGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKA 62

Query: 64  FNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +N     AR++ +      +  Y  ++ +  A  L A GD+  A +  L+ A D    
Sbjct: 63  AAANDKATMARAAADMEDKFGSTPYAQMAALSAAKTLYAAGDSAGA-KAQLQWAVDHAKD 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+
Sbjct: 122 DEYKQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGLVADRRGDLLAAQGKTDDAR 179

Query: 183 TIFEELAKDNNSPFGISTR 201
             + +LA D  S    S R
Sbjct: 180 AAY-KLALDGLSKDDQSAR 197


>gi|300724172|ref|YP_003713489.1| hypothetical protein XNC1_3319 [Xenorhabdus nematophila ATCC 19061]
 gi|297630706|emb|CBJ91371.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC 19061]
          Length = 206

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 68/179 (37%), Gaps = 6/179 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K++A  L+L I +L  W Y       +          + L    ++   ++ ++ +K   
Sbjct: 23  KYLAVGLVLGIGALIGWHYWQTHQTNQLHETA--ATFEVLNKSLASGSKESIAAVDKFAD 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           + N +Y  ++ + +    V K D   A +  L +A+       ++  + L+ A + +   
Sbjct: 81  ETNNIYGVMAELELTKRAVEKNDLAQAEKNLL-IASVKAKDEDMKAVSNLRLARVQLAED 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
             +   K L+++            ++ G    K G +  A+  +     +++ P  +  
Sbjct: 140 KTDAALKTLKQVKGKG--WLVLTEDLRGDILAKKGDIAGARAAYSR-GLESDGPQKMKD 195


>gi|254252259|ref|ZP_04945577.1| hypothetical protein BDAG_01479 [Burkholderia dolosa AUO158]
 gi|124894868|gb|EAY68748.1| hypothetical protein BDAG_01479 [Burkholderia dolosa AUO158]
          Length = 209

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 71/185 (38%), Gaps = 6/185 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +   +    K    +  +  +   ++L  L +A  F  ++    ++       + Q  + 
Sbjct: 5   DEQESIESLKAWWAR--WGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKA 62

Query: 64  FNSN-KLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +N K   AR++ +      +  Y  ++ +  A +L A GD+  A +  L+ A D    
Sbjct: 63  AAANDKTTMARAAADMEDKYGSTAYAQMTALAAAKVLYAAGDSAGA-KAQLQWAVDHAKD 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+
Sbjct: 122 DEYKQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGLVADRRGDLLAAQGKTDDAR 179

Query: 183 TIFEE 187
             ++ 
Sbjct: 180 AAYKL 184


>gi|325927623|ref|ZP_08188852.1| hypothetical protein XPE_2879 [Xanthomonas perforans 91-118]
 gi|325541990|gb|EGD13503.1| hypothetical protein XPE_2879 [Xanthomonas perforans 91-118]
          Length = 212

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/147 (14%), Positives = 49/147 (33%), Gaps = 10/147 (6%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +              +   ++   +  LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQTRTNTALVEANGRYEAVVKSIQAKDLDKAAKDIVALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A +       D  A   ++     + A +L ++   +E  K+L    +   
Sbjct: 101 QVDAGKNAEAIKTL----RDVPAEGELKQIVQQRLARVLTESGKPDEAIKLLADAQD--- 153

Query: 159 PMHQFANEILGISALKFGKVQKAKTIF 185
                + EI   + +  GK  +A+ ++
Sbjct: 154 ---HASLEIRADALVAQGKPDEARALY 177


>gi|28897384|ref|NP_796989.1| hypothetical protein VP0610 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838547|ref|ZP_01991214.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|260876343|ref|ZP_05888698.1| tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           AN-5034]
 gi|260898614|ref|ZP_05907110.1| tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           Peru-466]
 gi|260899286|ref|ZP_05907681.1| tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           AQ4037]
 gi|28805596|dbj|BAC58873.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748062|gb|EDM58921.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|308086924|gb|EFO36619.1| tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           Peru-466]
 gi|308092840|gb|EFO42535.1| tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           AN-5034]
 gi|308106655|gb|EFO44195.1| tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           AQ4037]
 gi|328472594|gb|EGF43457.1| hypothetical protein VP10329_12226 [Vibrio parahaemolyticus 10329]
          Length = 204

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 68/196 (34%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + +    +      K   K +    ++ +  L  W Y  D    +      +++  A+  
Sbjct: 5   DTEEQQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQDTV-IQASETASQSYTTAMNT 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
                +D        I S + K Y+ L+ + +A   V   D   A E   K A  +    
Sbjct: 64  LQEKGVDAQSDVQAFIESNEVKEYSVLAALQLAKAQVEAKDFAAALEQL-KWAQSNTKDA 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+    + + A I  +  +++  +  L K++           E+ G  AL+ G    A  
Sbjct: 123 ALSPLISYRIARIETEMGNFDAANTELGKVT--DTAWAGRIAELRGDIALRQGDKDAAYA 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  +  ++   + 
Sbjct: 181 AYTEAQQAADASPTLQ 196


>gi|89095336|ref|ZP_01168254.1| hypothetical protein MED92_00600 [Oceanospirillum sp. MED92]
 gi|89080411|gb|EAR59665.1| hypothetical protein MED92_00600 [Oceanospirillum sp. MED92]
          Length = 218

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/179 (13%), Positives = 58/179 (32%), Gaps = 12/179 (6%)

Query: 27  LLILMILSLAIWFYLFDGSHEKKKNIVG-------ENFAQAL-ELFNSNKLDDARSSFEK 78
           L + + L+  + +  +      +            +    AL    +  KL  A     +
Sbjct: 27  LGVAVALAAVLGWKGWQSQQAAQAENASVLYQNLLDAVVGALGPQLDDAKLATANHLNGQ 86

Query: 79  ILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
           +  + +   Y   + M +A + V + D   A      V  +          ATL+ A I+
Sbjct: 87  LKDEYEGSAYANYAAMIMARVAVDQKDLDKAVAELDYVLANQPTESMF-ILATLRKARIV 145

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
               + ++   ++     P         E+ G   L  G    A+  +++ ++   +  
Sbjct: 146 ASQGNVDQALNLVNG--APVGGYKATIEELKGDLYLAQGNTDAARKAYQQASESAAAGS 202


>gi|213962073|ref|ZP_03390338.1| TPR-domain containing protein [Capnocytophaga sputigena Capno]
 gi|213955426|gb|EEB66743.1| TPR-domain containing protein [Capnocytophaga sputigena Capno]
          Length = 1001

 Score = 49.2 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 29/175 (16%), Positives = 56/175 (32%), Gaps = 5/175 (2%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLY-NPLSNMY 94
           A W             + G ++  A   +  N   +A ++FEK L           +  Y
Sbjct: 703 AAWAKSLGYVEVTDLELEGASYEAAERQYLQNNSKEAIAAFEKYLKDFPNGLRRTNAEFY 762

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL- 153
           +  +    G    A   +  V+            A  +   IL+D  SY +    L++L 
Sbjct: 763 LGQLYFNSGQKAKALTHYENVSKSGS--NEYGEQALTRVCQILLDAGSYLKAKPYLEELE 820

Query: 154 -SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
            +        +A   L           KA     ++ ++ +    I   + ++LA
Sbjct: 821 KTATIAQNRTYAQSNLMRVCYNEKLYDKAIEYANKVLEEKSIDTRIKNDAYIVLA 875



 Score = 36.1 bits (82), Expect = 3.8,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 41/110 (37%), Gaps = 4/110 (3%)

Query: 91  SNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKIL 150
           + + +A++   +G+   A E +  + ++       +     Q    L  T    E     
Sbjct: 105 AYLQMANLYFQQGNYAEALEWYNAI-DELGVSSEEKARFNFQKGYCLFHTGKQAESKPYF 163

Query: 151 QKLSEPSNPMHQ-FANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
           +  S  +NP++   A   LG  A       KA++ F E+  D      +S
Sbjct: 164 E--SVQNNPLYADNAKYYLGYIAYDSDDYAKAESYFREVQDDATLSKNVS 211


>gi|127512224|ref|YP_001093421.1| tetratricopeptide TPR_4 [Shewanella loihica PV-4]
 gi|126637519|gb|ABO23162.1| Tetratricopeptide TPR_4 [Shewanella loihica PV-4]
          Length = 207

 Score = 49.2 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 61/195 (31%), Gaps = 5/195 (2%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  +      K          +    ++ +  L  W Y  D     +     E F     
Sbjct: 5   STEEQQVDAIKQFWKDYGNSIVIG-AVVGLGGLYSWNYYSDYK-VAQAEEASEAFQTISN 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
              ++    A +          + Y  L  + +A   V  G+   A +   ++       
Sbjct: 63  SVKADSSMLAAAESFAKDHDGQQGYQALLQLIVAKAAVEAGELDKAEQALKQILV-SKPE 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   ATL+ A +  +          L++L+ PS       +E+ G   ++ G   KAK
Sbjct: 122 EGLVAVATLRLARVQAEQGQLATALATLEQLNTPS--FAVQRDELKGDFLVRQGDADKAK 179

Query: 183 TIFEELAKDNNSPFG 197
           + ++    +  +   
Sbjct: 180 SAYQSALDNGGATSS 194


>gi|120598180|ref|YP_962754.1| hypothetical protein Sputw3181_1357 [Shewanella sp. W3-18-1]
 gi|120558273|gb|ABM24200.1| conserved hypothetical protein [Shewanella sp. W3-18-1]
          Length = 206

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 38/192 (19%), Positives = 67/192 (34%), Gaps = 6/192 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  +      K          +    ++ +  L  W Y  D     K     + F QAL 
Sbjct: 5   STEEQQVDAIKQFWKDYGTSILIG-AVVGLGGLYGWNYYSD-MKVAKAEEASKAF-QALT 61

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             ++++        E   + D K Y  L ++ +A   V   D   A +   KV       
Sbjct: 62  TKSADEAAMLAGVAEFSKNHDQKGYQALLDLIVAKTAVEAKDYPKAIDALNKVITTKP-G 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
            ++   ATL+ A I  +    +     L+K+S           E+ G   ++ G V+KAK
Sbjct: 121 ASLDTIATLRLARIQAELGQIDAGLATLEKVS--DKAFLAQREELKGDFLVRQGDVEKAK 178

Query: 183 TIFEELAKDNNS 194
           T ++    +   
Sbjct: 179 TAYQTAMDNGGV 190


>gi|307132058|ref|YP_003884074.1| hypothetical protein Dda3937_03707 [Dickeya dadantii 3937]
 gi|306529587|gb|ADM99517.1| conserved protein [Dickeya dadantii 3937]
          Length = 206

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 58/162 (35%), Gaps = 4/162 (2%)

Query: 26  PLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNK 85
            + +++ +   + +  +    E         + Q  E  ++    +  +  EK ++ D+ 
Sbjct: 26  AIGVVLGIGALVGWRFWQNHQESNAMAASAAYQQVTESLSAGTP-EGVAGAEKFVTGDHG 84

Query: 86  LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE 145
            Y  L+++ +A   V K D   A +   +  +       ++    L+ A +L+     +E
Sbjct: 85  NYGALASLALAHQFVEKNDIAKAEQQLRQALSQSKDGD-LQALINLRLARVLLQQKKPDE 143

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
             K L  +            ++ G      G  Q A+  + +
Sbjct: 144 ALKTLDAIKLEG--WTAMVADVRGDVLASKGDNQGARDAYNK 183


>gi|156932944|ref|YP_001436860.1| hypothetical protein ESA_00747 [Cronobacter sakazakii ATCC BAA-894]
 gi|156531198|gb|ABU76024.1| hypothetical protein ESA_00747 [Cronobacter sakazakii ATCC BAA-894]
          Length = 206

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 73/196 (37%), Gaps = 4/196 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   + +  ++GS          ++   
Sbjct: 1   MEIYENENEQLDAVKRFFAENGKALAVGVVLGIGALVGWRFWNGSQVDSAREASLHYQNV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    ++      S+ ++ ++Q+   Y  L+ + +A   V K D  NAA+   K   ++ 
Sbjct: 61  MTDVRADDPKT-LSAAQQFVAQNQNTYGALAALELAQRYVDKNDLTNAAQQLQK-GLENT 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +R    L+ A I +     +   K L+  S           ++ G + L  G  Q 
Sbjct: 119 KDENLRSLINLRLARIQIQQKQADAALKTLE--SVKGENWSAMVADLRGDALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPF 196
           A+  + + A D NSP 
Sbjct: 177 ARDAWSKGADDKNSPA 192


>gi|134295841|ref|YP_001119576.1| hypothetical protein Bcep1808_1737 [Burkholderia vietnamiensis G4]
 gi|134138998|gb|ABO54741.1| conserved hypothetical protein [Burkholderia vietnamiensis G4]
          Length = 209

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 74/199 (37%), Gaps = 7/199 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +   +    K    +  +  +   ++L  L +A  F  ++    ++       + Q  + 
Sbjct: 5   DEQESIESLKAWWAR--WGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKA 62

Query: 64  FNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +N     AR++ +      +  Y  ++ +  A  L A GD   A +  L+ A D    
Sbjct: 63  AAANDKATMARAAADMEDKFGSTAYAQMTALAAAKTLYASGDAAGA-KAQLQWAADHAKD 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+
Sbjct: 122 DEYKQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGLVADRRGDLLAAQGKTDDAR 179

Query: 183 TIFEELAKDNNSPFGISTR 201
             + +LA D  S    S R
Sbjct: 180 AAY-KLALDGLSKDDQSAR 197


>gi|323169043|gb|EFZ54720.1| hypothetical protein SS53G_0584 [Shigella sonnei 53G]
          Length = 178

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 65/168 (38%), Gaps = 5/168 (2%)

Query: 29  ILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYN 88
           IL + +L  W Y      +  ++     +  A+   +  K D   ++ EK  +++   Y 
Sbjct: 2   ILGVGALIGWRYWNSHQVDSARS-ASLAYQNAVTAVSEGKPDSIPAA-EKFAAENKNTYG 59

Query: 89  PLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISK 148
            L+++ +A   V K + + AA    +   D      ++    L+ A + V     +   K
Sbjct: 60  ALASLELAQQFVDKNELEKAAAQLQQGLADTS-DENLKAVINLRLARVQVQLKQADAALK 118

Query: 149 ILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
            L  +            ++ G + L  G  Q A++ +E   K + +P 
Sbjct: 119 TLDTIKGEG--WAAIVADLRGKALLSKGDKQGARSAWEAGVKSDVTPA 164


>gi|74316614|ref|YP_314354.1| hypothetical protein Tbd_0596 [Thiobacillus denitrificans ATCC
           25259]
 gi|74056109|gb|AAZ96549.1| putative membrane protein [Thiobacillus denitrificans ATCC 25259]
          Length = 213

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 29/214 (13%), Positives = 79/214 (36%), Gaps = 6/214 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           + +      + K    +  +  ++ + + ++++ A  +  +      +       + Q  
Sbjct: 5   DLDEQERLDELKAWWKR--WGSVSMIGLAVLIAAAAGWRYWQNRTVTQSLEAAAVYDQLA 62

Query: 62  ELFNSNKLDDARSSFEKI-LSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               +N++  AR +   +     +  Y P + + +A + V   D K+A       A+   
Sbjct: 63  RSVAANEVKGAREAGAMLIDKYKDTAYAPRAALLLARLNVGAKDAKSAQTQLEWAASHSK 122

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
            P A+R  A L+ A++ +D   Y+   K L   +  S+      +++ G   +   K   
Sbjct: 123 EP-AIRDLARLRLAAVQLDQKQYDVALKTLA--ARHSDAFGPRFDDLRGDVLVAQNKPAD 179

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           A+  ++      ++        ++ L  +    +
Sbjct: 180 ARKAYQAALGAMSADNPYRNVVELKLDGVGGEAK 213


>gi|58040396|ref|YP_192360.1| hypothetical protein GOX1968 [Gluconobacter oxydans 621H]
 gi|58002810|gb|AAW61704.1| Hypothetical protein GOX1968 [Gluconobacter oxydans 621H]
          Length = 106

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 4/98 (4%)

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALK 174
           VA+D+ A  A+R  A   + +    T+  + +    + L++        A E L    L+
Sbjct: 4   VADDNAADPALRDMARYMSLNARTATADPKTLRPGYEALAQGGGAWAPLAQEGLAALDLR 63

Query: 175 FGKVQ----KAKTIFEELAKDNNSPFGISTRSQMILAN 208
            G       +A+ I  ++    N+  G+  R+Q +L  
Sbjct: 64  PGATADQQKEARRILTQIVGSENATEGVRARAQALLET 101


>gi|325915369|ref|ZP_08177686.1| hypothetical protein XVE_1577 [Xanthomonas vesicatoria ATCC 35937]
 gi|325538416|gb|EGD10095.1| hypothetical protein XVE_1577 [Xanthomonas vesicatoria ATCC 35937]
          Length = 212

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/149 (14%), Positives = 52/149 (34%), Gaps = 10/149 (6%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +      +       +   ++      LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQKHTNTELVEANARYEAVVKSIQGKDLDKAAKDIVALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A +       D  A   +++    + A +L ++   +E  K+L    + ++
Sbjct: 101 QVDAGKNAEAIKTL----RDVPAEGELKHIVQQRLARVLTESGKPDEAIKLLADAQDNAS 156

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEE 187
                  EI   + +  GK  +A+ ++ +
Sbjct: 157 ------LEIRADALVVQGKTDEARALYAK 179


>gi|239947835|ref|ZP_04699588.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922111|gb|EER22135.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 220

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 24/175 (13%), Positives = 67/175 (38%), Gaps = 6/175 (3%)

Query: 42  FDGSHEKKKNIVGENFAQALELFNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILV 100
           +     K     G+   + + L  +   ++ A ++ E +++  N     ++ +   +I +
Sbjct: 45  YKDKRIKNNQKNGDILIKTVGLETTKDNEELAFNTLENLVTTSNTKIKEIAALEQVAIKI 104

Query: 101 AKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE-----EISKILQKLSE 155
           ++     A ++  K+  +          A +    +++D  + +     +++K L    +
Sbjct: 105 SEKKYSEAKDLLNKIIENKEYSEISTSYARISWCGLVIDDQNLDIQDKEKLTKYLNYFDD 164

Query: 156 PSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
              P    A  I  +  +K     +A+   + L   NN    I  +++ +L N+ 
Sbjct: 165 EKKPFWATATIIKAMWDIKNNMKPQAEKNLKNLLISNNVSDLIKDQAKALLVNLN 219


>gi|212212369|ref|YP_002303305.1| hypothetical protein CbuG_0764 [Coxiella burnetii CbuG_Q212]
 gi|212010779|gb|ACJ18160.1| hypothetical protein CbuG_0764 [Coxiella burnetii CbuG_Q212]
          Length = 206

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 65/186 (34%), Gaps = 5/186 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E  +D    +   K  +   + IA  +++ +L    W Y      E K       + Q  
Sbjct: 3   ELLSDQEQIEMIKKWWRDYGRAIALAIVIGLLIGFGWRYWHRHQLE-KTERASALYMQLQ 61

Query: 62  ELFNSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            L + N  D  +   ++++       Y  +++   A   V +     A +    V   + 
Sbjct: 62  ILASQNAWDKTKPLTDRLIKDYGKTPYAAMASFLNAKRAVEQNHLPLALDQLQWVMK-NA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+A+ IL+  +  +    +LQ  +          +EI G      G  + 
Sbjct: 121 IVSDLKQLERLRASRILLAENRPKAALNLLQ--TVDDQAYQPLVDEIKGDIYAAMGNRES 178

Query: 181 AKTIFE 186
           AK  +E
Sbjct: 179 AKQFYE 184


>gi|161502325|ref|YP_001569437.1| hypothetical protein SARI_00358 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160863672|gb|ABX20295.1| hypothetical protein SARI_00358 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 206

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 33/175 (18%), Positives = 67/175 (38%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL + +L  W Y      E         +  A+   +++K D   ++ EK  +
Sbjct: 23  KALAVGVILGVGALVGWRYWNSHQTES-ARAASLAYQNAVTAISADKPDSIPAA-EKFAA 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           ++   Y  L++M +A   V K + K A     +          ++    L+ A + V   
Sbjct: 81  ENKNTYGALASMELAQQFVDKNELKKAETQLQQGLAATS-DENLKAVINLRLARVQVQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L  +            ++ G + L  G ++ A++ +E     + SP 
Sbjct: 140 QADAALKTLDAIKGEG--WTAIVADLRGEALLSKGDIKGARSAWEAGVNSDASPA 192


>gi|224373433|ref|YP_002607805.1| tetratricopeptide repeat domain protein [Nautilia profundicola AmH]
 gi|223589402|gb|ACM93138.1| tetratricopeptide repeat domain protein [Nautilia profundicola AmH]
          Length = 756

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 58/152 (38%), Gaps = 22/152 (14%)

Query: 55  ENFAQALELFNS----NKLDDARSSFEK-ILSQDNKLYNPLSNMYIASILVAKGDTKNAA 109
           E +   +   +          A   ++K + S  +     L+ + +A   + KGD K A 
Sbjct: 273 EAYLAMIYWADQMYITGDSKKAFELYKKALYSTKDVDIASLAALRLAQRYMDKGDIKTAF 332

Query: 110 EIFLKVANDDLAPLAVRY------AATLQAA----SILVDTSSYEEISKILQKLSEPSNP 159
           E + +V   +     ++        A + A+    S+ +D    E++ K L+KL +   P
Sbjct: 333 EYYKRVYQANK-DFILKDKKKAFELAKMLASHQLYSLAIDIG--EDLIKRLKKLDDLYEP 389

Query: 160 MHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           +  +    L + +   G  +KA     +   +
Sbjct: 390 LEYY----LALWSYDAGDFKKADYWINKYLNE 417


>gi|113460552|ref|YP_718616.1| hypothetical protein HS_0406 [Haemophilus somnus 129PT]
 gi|112822595|gb|ABI24684.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 203

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 66/188 (35%), Gaps = 10/188 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E   + N  K      K  YK I  +++L    +  W Y  D    KK   +   + Q 
Sbjct: 5   IEEEQELNELKT---WWKENYKSIIVIVVLAFSGVFGWRYWQDYQTTKK-QTLSAQYDQL 60

Query: 61  LELFNSNKLDDARSSFEK-ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           +    +  + +A    ++ +       Y   + +  A + V++ +   A E   + A  +
Sbjct: 61  ISSAENQSIYNA--QLDRFVQENGETTYAVFALLDKAKLEVSQQNFVQAEETLKQ-AIVN 117

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
            +   +     ++ A++      ++E    L +              + G   L  G  +
Sbjct: 118 TSDDILMSITAIRLATVQYQLQKFDEALASLNQ--VKGQSWDVSKLLLSGDIQLAKGNKE 175

Query: 180 KAKTIFEE 187
            AK  FE+
Sbjct: 176 IAKDNFEQ 183


>gi|326444940|ref|ZP_08219674.1| hypothetical protein SclaA2_27915 [Streptomyces clavuligerus ATCC
           27064]
          Length = 1103

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 70/176 (39%), Gaps = 23/176 (13%)

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNP------LSNMYIASILVAKGDTKNAAEIFL 113
           A+  + + + D+A +  EK++    +L          +   +AS     G T+ A  I  
Sbjct: 744 AVSYWQAGRTDEAITIEEKVVEDRQRLLGDEHPDTHTARANLASSYWQAGRTEKAITILE 803

Query: 114 KVAND------DLAPLAVRYAATLQAASILVDTSS-----YEEISKILQKLSEPSNPMHQ 162
           +V  D      D  P  +   A L A+      +       E++ +  Q+L    +P   
Sbjct: 804 QVVEDRQRLLGDEHPDTLTARANLAASYQQAGRTEKAITILEQVVEDRQRLLGDEHPDTH 863

Query: 163 FANEILGISALKFGKVQKAKTIFEELAKD------NNSPFGISTRSQMILANIIAS 212
            A   L  S  + G+ +KA TI E++ +D      +  P  ++ R+ + ++   A 
Sbjct: 864 TARANLASSYWQAGRTEKAITILEQVVEDRQRLLGDEHPDTLTARANLAVSYQQAG 919



 Score = 43.4 bits (101), Expect = 0.023,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 66/169 (39%), Gaps = 23/169 (13%)

Query: 60   ALELFNSNKLDDARSSFEKILSQ-----DNKLYNPL-SNMYIASILVAKGDTKNAAEIFL 113
            A+    + + D+A +  E+++        ++    L +   +AS     G T  A  I  
Sbjct: 912  AVSYQQAGRTDEAITILEQVVEDIERLLGDEHPGTLTARANLASSYWQAGRTDEAITIEE 971

Query: 114  KVAND------DLAPLAVRYAATLQAASILVDTSS-----YEEISKILQKLSEPSNPMHQ 162
            KV  D      D  P  +   A L A+      +       E++ +  Q+L    +P   
Sbjct: 972  KVVEDRQRLLGDEHPGTLTARANLAASYQQAGRTEKAITILEQVVEDRQRLLGDEHPGTL 1031

Query: 163  FANEILGISALKFGKVQKAKTIFEELAKD------NNSPFGISTRSQMI 205
             A   L +S  + G+  +A TI E++ +D      +  P  ++ R+ + 
Sbjct: 1032 TARANLAVSYQQAGRTDEAITILEQVVEDRQRLLGDEHPGTLTARANLA 1080



 Score = 41.9 bits (97), Expect = 0.062,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 63/169 (37%), Gaps = 23/169 (13%)

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNP------LSNMYIASILVAKGDTKNAAEIFL 113
           A     + + + A +  E+++    +L          +   +AS     G T+ A  I  
Sbjct: 828 AASYQQAGRTEKAITILEQVVEDRQRLLGDEHPDTHTARANLASSYWQAGRTEKAITILE 887

Query: 114 KVAND------DLAPLAVRYAATLQAASILVDTSS-----YEEISKILQKLSEPSNPMHQ 162
           +V  D      D  P  +   A L  +      +       E++ + +++L    +P   
Sbjct: 888 QVVEDRQRLLGDEHPDTLTARANLAVSYQQAGRTDEAITILEQVVEDIERLLGDEHPGTL 947

Query: 163 FANEILGISALKFGKVQKAKTIFEELAKD------NNSPFGISTRSQMI 205
            A   L  S  + G+  +A TI E++ +D      +  P  ++ R+ + 
Sbjct: 948 TARANLASSYWQAGRTDEAITIEEKVVEDRQRLLGDEHPGTLTARANLA 996



 Score = 38.0 bits (87), Expect = 0.80,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 34/73 (46%), Gaps = 6/73 (8%)

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD------NNSPFGIS 199
           +++  ++L    +P    A   L  S  + G+ +KA TI E++ +D      +  P  ++
Sbjct: 679 MTERAEQLLGDEHPGTLTARANLASSYWQAGRTEKAITILEQVVEDRQRLLGDEHPGTLT 738

Query: 200 TRSQMILANIIAS 212
            R+ + ++   A 
Sbjct: 739 ARANLAVSYWQAG 751


>gi|254363200|ref|ZP_04979249.1| hypothetical protein MHA_2783 [Mannheimia haemolytica PHL213]
 gi|261493282|ref|ZP_05989809.1| hypothetical protein COK_1691 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496474|ref|ZP_05992854.1| hypothetical protein COI_2192 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|153095094|gb|EDN75645.1| hypothetical protein MHA_2783 [Mannheimia haemolytica PHL213]
 gi|261307677|gb|EEY09000.1| hypothetical protein COI_2192 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261311132|gb|EEY12308.1| hypothetical protein COK_1691 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 206

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 30/184 (16%), Positives = 63/184 (34%), Gaps = 9/184 (4%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           +   ++      K     I   +IL   + A W +  +   E        ++   +E + 
Sbjct: 10  EEQQFEDAKNWFKENGTPILVAIILACAATAGWNFWKNHQLET-AQKTSASYQSVMESYL 68

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
            N   +     + I    +  Y   +   +A   V KG+   A      V     +   +
Sbjct: 69  QNPSKNQPLVEKFIADNKDSSYAAFAQFEVAKQAVEKGNFSAAKTALQSVL--TYSDSTL 126

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQ--FANEILGISALKFGKVQKAKT 183
           +  A  + A I     SY+E    L ++ + +  + +     +IL       G +  AK+
Sbjct: 127 QSIARFRLAQIDFQLKSYDEALASLAQIQDKAWELRKQILTGDILAA----KGDIPAAKS 182

Query: 184 IFEE 187
            +E+
Sbjct: 183 AYEQ 186


>gi|59711238|ref|YP_204014.1| hypothetical protein VF_0631 [Vibrio fischeri ES114]
 gi|59479339|gb|AAW85126.1| conserved protein [Vibrio fischeri ES114]
          Length = 203

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 61/150 (40%), Gaps = 3/150 (2%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
            +  +  S    K      + +AL    ++  D   S+   I +  +  Y  L+ + +A 
Sbjct: 38  GWKYYQSSQITAKETASAAYERALTALQASGADAVESTQAFIDANKSSEYASLAALQLAK 97

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
           + V  G  +NA E    VA++     ++   A +++A I  +  +++     L  +   S
Sbjct: 98  VQVEAGQLENALEQLNWVASNSK-DESLTAMAQVRSARIQAEQGNFDAALATLANVKPAS 156

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEE 187
                   E+ G  AL+ G +  A++ + E
Sbjct: 157 WAARVA--ELKGDIALRQGDIATARSSYTE 184


>gi|27363893|ref|NP_759421.1| hypothetical protein VV1_0425 [Vibrio vulnificus CMCP6]
 gi|37678952|ref|NP_933561.1| hypothetical protein VV0768 [Vibrio vulnificus YJ016]
 gi|27360010|gb|AAO08948.1| putative membrane protein [Vibrio vulnificus CMCP6]
 gi|37197694|dbj|BAC93532.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 204

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 36/196 (18%), Positives = 71/196 (36%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +    +      K   K +    ++ +  L  W Y  D S  + +    +N+  A+  
Sbjct: 5   NTEEEQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQD-SVTQAREAASQNYTSAINA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             +   + A      I S D K Y+ L+ + +A   V  GD   A     K A  +    
Sbjct: 64  LQAKGAEAAADVEAFIASNDVKEYSVLAALQLAKAQVTAGDLNAALTQL-KWAQSNSKDA 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+    T + A +  +  +++     L K++           E+ G  AL+ G  + A  
Sbjct: 123 ALIPLTTYRIARVEAELGNFDAAKAELAKVT--DASWTGRVAELRGDIALRQGDKEAAYA 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  +  ++   + 
Sbjct: 181 AYSEAQQAADAGQTLQ 196


>gi|77461244|ref|YP_350751.1| thioredoxin [Pseudomonas fluorescens Pf0-1]
 gi|77385247|gb|ABA76760.1| putative thioredoxin [Pseudomonas fluorescens Pf0-1]
          Length = 290

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 46/126 (36%), Gaps = 2/126 (1%)

Query: 50  KNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAA 109
                + F QA  LF+  +  DA +    +L +DN     L  +  A  L  +G+   A 
Sbjct: 117 APSAADPFEQAQALFDEGRYADAEAKLVVLLGEDNTNAKAL--ILYARCLTERGELGEAQ 174

Query: 110 EIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILG 169
            +   V +D+         A ++   +  D     ++   L +  +    ++Q A + L 
Sbjct: 175 TVLDAVKSDEHKAALAGAKAQIKFLGLARDLPDAADLKSRLAQNPQDDEAVYQLAIQQLA 234

Query: 170 ISALKF 175
               + 
Sbjct: 235 RQQYEA 240


>gi|262374930|ref|ZP_06068164.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262309943|gb|EEY91072.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 232

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 68/188 (36%), Gaps = 14/188 (7%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D      K    K     I  +LI +I      F+ ++   +K       + A+  +L +
Sbjct: 7   DEQFESLKSFTKKYGSSMITGILIALIA-----FFGWEYWQKKNLAESQMHTAKVQQLMD 61

Query: 66  SNK------LDDARSSFEKILSQDNKLYNPL-SNMYIASILVAKGDTKNAAEIFLKVAND 118
             +            + +KI+ +       + + + +A +   K D   A +   KV N 
Sbjct: 62  DAQASKGDGFAKLSEAADKIVKEAPDSAQAIQTQLVMAKLAYDKEDYAAAEKALQKVENS 121

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKV 178
            +    +     L+ A   +    Y+   K L+ ++EP       A+E  G   +    +
Sbjct: 122 KVDDKGLVQVVKLRLAYAQLAQKKYDAALKTLEAVTEP--AFKATADEARGDIYVAKNDI 179

Query: 179 QKAKTIFE 186
           + AK +++
Sbjct: 180 ENAKKVYQ 187


>gi|255321135|ref|ZP_05362301.1| conserved hypothetical protein [Acinetobacter radioresistens SK82]
 gi|262380176|ref|ZP_06073331.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|255301689|gb|EET80940.1| conserved hypothetical protein [Acinetobacter radioresistens SK82]
 gi|262298370|gb|EEY86284.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 234

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 70/202 (34%), Gaps = 12/202 (5%)

Query: 18  KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD-----A 72
           K   K     +I  IL   I F+ ++   +K         A+  +L +  +  +     A
Sbjct: 14  KSFTKKYGSAIISGILIALIAFFGWEYWQKKTLAENQMRTAKVQQLMDEARNVNSQDINA 73

Query: 73  RSSF----EKILSQDNKLYNPL-SNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRY 127
            ++     +KI+ +     + L +   +A     +GD   A +   +V    L    + +
Sbjct: 74  LNALSQSADKIVKEAPDSVHALQAQFVMAKQAYDRGDYAAAEKALKRVEATKLKDEGLVH 133

Query: 128 AATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
              L+ A   +  + Y+   K L  +++P       A E  G   +    +  A+  ++ 
Sbjct: 134 VLKLRLAYAQLAQNKYDAALKTLADVTDP--AFKATAEEARGDVYVAKNDIASARKAYQS 191

Query: 188 LAKDNNSPFGISTRSQMILANI 209
                          Q+ L ++
Sbjct: 192 AWDALAERKKERQILQIKLESV 213


>gi|238794828|ref|ZP_04638429.1| hypothetical protein yinte0001_7860 [Yersinia intermedia ATCC
           29909]
 gi|238725841|gb|EEQ17394.1| hypothetical protein yinte0001_7860 [Yersinia intermedia ATCC
           29909]
          Length = 206

 Score = 48.4 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 69/188 (36%), Gaps = 6/188 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y     +          + QA    ++N  D    + EK + 
Sbjct: 23  KALAVGVVLGIGALVGWRYWQSHQNTVLTEASS-AYQQASNALSANSADGVAFA-EKFVQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +N  Y  L+ + +A   V +     AA+   +          +     L+ A + +   
Sbjct: 81  GNNNNYGVLAGLELAHHFVEQNVFDKAAQQLTQALGQTKDENLL-SLINLRLARLQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             ++  K L  +          A ++ G + L  G    A+  + +   ++N+   +   
Sbjct: 140 KPDDALKTLDAVQGDG--WTAMAQDVRGDALLSKGDTAGARAAYSK-GVESNASQALQAL 196

Query: 202 SQMILANI 209
            +M L N+
Sbjct: 197 LRMKLNNL 204


>gi|145640320|ref|ZP_01795904.1| hypothetical protein CGSHiR3021_09685 [Haemophilus influenzae
           R3021]
 gi|145274906|gb|EDK14768.1| hypothetical protein CGSHiR3021_09685 [Haemophilus influenzae
           22.4-21]
          Length = 204

 Score = 48.4 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 56/194 (28%), Gaps = 11/194 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQ-ASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     N+     +  + + +     Y   + +  A     K D   A     + A    
Sbjct: 61  INSVQQNEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFSAAEANLNQ-ALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFGKV 178
               +     L+ +++       +     L ++   S      A + +  G   +  G  
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVKGES----FNARKAILTGDIQVAKGDK 175

Query: 179 QKAKTIFEELAKDN 192
             AK  FE+  +  
Sbjct: 176 VAAKNSFEQAQQSG 189


>gi|117618106|ref|YP_856297.1| TPR repeat-containing protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559513|gb|ABK36461.1| tetratricopeptide repeat family [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 216

 Score = 48.4 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 34/192 (17%), Positives = 65/192 (33%), Gaps = 6/192 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  +      K    +     IA  +I  ++ L  W Y  +     +     + + +   
Sbjct: 5   TTEEQQVEVIKSWWKENGTSVIAGTVI-GLVGLFGWRYYNEHQQTSQ-ETASQAYNEMAA 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
                       +   I +     Y  L+ + +A+  V  G    A E   +VA      
Sbjct: 63  QLAKGDAAGFEQAQSFISAHKGDSYAELAALQLAAAAVKAGKLDLAVEQLTQVA--TSGD 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
            ++R  A L+ A +L D    +E    L K++           E+ G   LK GK ++A+
Sbjct: 121 ESIRPIAALRLARVLNDQGKADEALAQLGKINND--AFKAQVAEVRGDVLLKQGKAEEAR 178

Query: 183 TIFEELAKDNNS 194
             ++  A     
Sbjct: 179 DAYQAAADAGGL 190


>gi|254786614|ref|YP_003074043.1| tetratricopeptide repeat family protein [Teredinibacter turnerae
           T7901]
 gi|237686657|gb|ACR13921.1| tetratricopeptide repeat family protein [Teredinibacter turnerae
           T7901]
          Length = 234

 Score = 48.4 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 38/213 (17%), Positives = 71/213 (33%), Gaps = 14/213 (6%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----- 59
           ++    +   +     +  +   +IL +     W    D     K     + + Q     
Sbjct: 6   SEEEQVEAIKRWWNENWVSVVLPIILALGGYLGWNSWQDHKQ-GKAEQASDLYQQLAMAA 64

Query: 60  ----ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
                  L    +     S+   I +    LY  ++N+ +A I V  G    AA     V
Sbjct: 65  EVAPGETLSEEQRAAIDESANVIIDAHGGTLYADMANLLLAKIQVEGGQLDAAAARLQAV 124

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
             D+ A  A++  A  + A ++     +     ++ +    S        EI G      
Sbjct: 125 V-DNGADEAIQQVAKARLARVMSAKGDHSAALSMVAQ--TDSQSFKALFAEIRGDVYSAQ 181

Query: 176 GKVQKAKTIFEELAKDNNSPFGISTRSQMILAN 208
           GK+ +A T ++  A D   P   + RS + L  
Sbjct: 182 GKLAEANTEYQA-ALDTLLPSEFNRRSLIQLKL 213


>gi|89901083|ref|YP_523554.1| hypothetical protein Rfer_2305 [Rhodoferax ferrireducens T118]
 gi|89345820|gb|ABD70023.1| conserved hypothetical transmembrane protein [Rhodoferax
           ferrireducens T118]
          Length = 240

 Score = 48.4 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 56/154 (36%), Gaps = 6/154 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           ++        + K          I   LIL++ + A W +       +        +   
Sbjct: 5   LDLEEQEQLDQLKHFWKSYG-NAITWALILVLGAFASWNFYQYWQRNQATQAAAMYDEVE 63

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
           + +   ++ K+D A +  +   +     Y   + + +A    + G+ + A      V  D
Sbjct: 64  RVVTSADTAKIDRAFADMKDRFASTT--YAHQAGLLVAKYYYSVGNAQAAKSALGWVV-D 120

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQK 152
             +    +  A L+ A +L+D+ +++E  + L  
Sbjct: 121 KSSDPGYQAIAKLRLAGLLMDSKAFDEALQQLSG 154


>gi|225024246|ref|ZP_03713438.1| hypothetical protein EIKCOROL_01118 [Eikenella corrodens ATCC
           23834]
 gi|224943271|gb|EEG24480.1| hypothetical protein EIKCOROL_01118 [Eikenella corrodens ATCC
           23834]
          Length = 209

 Score = 48.4 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 54/167 (32%), Gaps = 5/167 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           +W+  LL++  +    W  ++        N     F Q  E   +NK  +A     ++ S
Sbjct: 24  RWLFALLVVAAIGYFGWV-MYSSHQRSVNNEAVAVFDQWAENQQANKPAEAAKLLTQLQS 82

Query: 82  QDNKLY-NPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
           Q         + +  A     +G    A      V      PL +R  A  + A++ +  
Sbjct: 83  QYPTSISAAQATLMQAGAAFDQGKYDEAIGHLNWVLKYHQEPL-IRAMAIQRLATVQLQQ 141

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
             Y++    L               E  G      GK  +A   +++
Sbjct: 142 QKYDDAIATLG--MNTDEAYAGILLETKGDVYAAQGKRSEAAAAYKQ 186


>gi|238797966|ref|ZP_04641456.1| hypothetical protein ymoll0001_28280 [Yersinia mollaretii ATCC
           43969]
 gi|238718171|gb|EEQ09997.1| hypothetical protein ymoll0001_28280 [Yersinia mollaretii ATCC
           43969]
          Length = 206

 Score = 48.4 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 71/188 (37%), Gaps = 6/188 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y     +          + QA +  ++N  D    + EK + 
Sbjct: 23  KALAVGVVLGIGALVGWRYWQSHQNTAMTEASS-AYQQASDALSANSADGVTLA-EKFVQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y  L+ + +A   V + +   AA+   +          +     L+ A + +   
Sbjct: 81  GNKNNYGVLAGLELAHHFVEQNEFDKAAQQLTQALGQTKDENLL-SLINLRLARLQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             +E  K L   +         A ++ G + L  G +  A+  + +   ++N+   +   
Sbjct: 140 KPDEALKTLD--AVQGEGWTAMAQDVRGDALLSKGDISGARAAYSK-GVESNASQALQAL 196

Query: 202 SQMILANI 209
            +M L N+
Sbjct: 197 LRMKLNNL 204


>gi|297568699|ref|YP_003690043.1| hypothetical protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296924614|gb|ADH85424.1| Tetratricopeptide TPR_4 [Desulfurivibrio alkaliphilus AHT2]
          Length = 222

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 80/205 (39%), Gaps = 10/205 (4%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
           ++ N      +     Y+ I   + ++++++  W          +     +  + A+++ 
Sbjct: 24  DELNLPPAAAEFLNVWYRHILAAIGIVVVAILTWSLSQQYV-TSRAEQSSQQLSVAMQIA 82

Query: 65  NSNKLDDARSSFEKILSQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
           +      A    E++ S   +      S + +A +    GD + AA+ + ++        
Sbjct: 83  DPAARAQA---LEEVASSYRRTGAGIWSRIELAHLARDAGDLEGAAQAYQELLGTISRRD 139

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL--KFGKVQKA 181
           A R    L  A +L +    E+  +  ++L+E        A  +LG   +  + G  + A
Sbjct: 140 ARRPMVQLSLAQVLSELGQDEQALRYYRELAETPG---FEAWGLLGTGDVMARRGDTEAA 196

Query: 182 KTIFEELAKDNNSPFGISTRSQMIL 206
           +  + ++ +  N+P  +  +++  L
Sbjct: 197 REKYRQVTEKTNAPLLVLEQAESRL 221


>gi|157828189|ref|YP_001494431.1| hypothetical protein A1G_01785 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932891|ref|YP_001649680.1| hypothetical protein RrIowa_0378 [Rickettsia rickettsii str. Iowa]
 gi|157800670|gb|ABV75923.1| hypothetical protein A1G_01785 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907978|gb|ABY72274.1| hypothetical protein RrIowa_0378 [Rickettsia rickettsii str. Iowa]
          Length = 220

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 27/169 (15%), Positives = 66/169 (39%), Gaps = 6/169 (3%)

Query: 48  KKKNIVGENFAQALELFNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           K     G+   + + L  +   ++ A ++ E +++  N     ++ +   +I ++K    
Sbjct: 51  KNNQKNGDILVKTVGLETTKDNEELAFNTLENLVTTSNTKIKEIAALEQVAIKISKKKYS 110

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDT-----SSYEEISKILQKLSEPSNPMH 161
            A ++  K+  +          A +   S+++D         E+++K L    +   P  
Sbjct: 111 EAKDLLNKIIENKEYSEISTSYARISWCSLVMDDHNLDIQDKEKLTKYLNYFDDEKKPFW 170

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
             A  I  +  +K     +A+   + L   NN    I  +++ +L N+ 
Sbjct: 171 ATATIIKAMWDIKNNMKPQAEKNLKNLLISNNVSDLIKDQAKALLVNLN 219


>gi|301169072|emb|CBW28669.1| conserved protein [Haemophilus influenzae 10810]
          Length = 204

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/159 (13%), Positives = 45/159 (28%), Gaps = 9/159 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVGGMFGWRYWQTHQVEQIAQASAQYDTLI 61

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            +++     K  +     + + +     Y   + +  A     K D   A     + A  
Sbjct: 62  NSVQQDEQAKKANIE---QFVQANSKTAYAVFALLDEAKKATEKQDFSAAEANLNQ-ALT 117

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
                 +     L+ +++       +     L ++   S
Sbjct: 118 QSQDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVKGES 156


>gi|148825347|ref|YP_001290100.1| hypothetical protein CGSHiEE_01155 [Haemophilus influenzae PittEE]
 gi|148827509|ref|YP_001292262.1| hypothetical protein CGSHiGG_04660 [Haemophilus influenzae PittGG]
 gi|260582538|ref|ZP_05850328.1| chaperone HscA [Haemophilus influenzae NT127]
 gi|148715507|gb|ABQ97717.1| chaperone protein HscA [Haemophilus influenzae PittEE]
 gi|148718751|gb|ABQ99878.1| hypothetical protein CGSHiGG_04660 [Haemophilus influenzae PittGG]
 gi|260094349|gb|EEW78247.1| chaperone HscA [Haemophilus influenzae NT127]
          Length = 204

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 27/194 (13%), Positives = 57/194 (29%), Gaps = 11/194 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E   + N  K   +  K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---EWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQ-ASAQYDAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   A     + A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFSAAEANLNQ-ALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFGKV 178
               +     L+ +++       +     L ++   S      A + +  G   +  G  
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALSTLNQVKGES----FNARKAILTGDIQIAKGDK 175

Query: 179 QKAKTIFEELAKDN 192
             AK  FE+  +  
Sbjct: 176 VAAKNSFEQAQQSG 189


>gi|145631823|ref|ZP_01787582.1| hypothetical protein CGSHi22421_06618 [Haemophilus influenzae
           R3021]
 gi|144982542|gb|EDJ90096.1| hypothetical protein CGSHi22421_06618 [Haemophilus influenzae
           R3021]
          Length = 204

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 57/196 (29%), Gaps = 15/196 (7%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVGGMFGWRYWQSHQAEQIAQASAQYDTLI 61

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            +++     K  +     + + +     Y   + +  A     K D   A     + A  
Sbjct: 62  NSVQQDEQAKKANIE---QFVQANSKTAYAVFALLDEAKKATEKQDFSAAEANLNQ-ALT 117

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFG 176
                 +     L+ +++       +     L ++   S      A + +  G   +  G
Sbjct: 118 QSQDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVKGES----FNARKAILTGDIQVAKG 173

Query: 177 KVQKAKTIFEELAKDN 192
               AK  FE+  +  
Sbjct: 174 DKVAAKNSFEQAQQSG 189


>gi|326316282|ref|YP_004233954.1| hypothetical protein Acav_1465 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323373118|gb|ADX45387.1| Protein of unknown function DUF2133 [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 221

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 51/131 (38%), Gaps = 5/131 (3%)

Query: 24  IAPLLILMILSLAIW--FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           I+ +++++   +A W  +  +      +   + +    A+          A  +F+ + S
Sbjct: 27  ISGVMVVIFGGVAAWNGYQYWQNRQSGQAAALSDAVQVAV---QGGDAARATQAFDDLKS 83

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           +            +A+  +      + A+  L+   D+ +    +  A+L+ A +L+D  
Sbjct: 84  RYGGTVQAAQAGLLAAKAMVDSGNPDGAKPILQWLADNASDEGYKAIASLRLAGLLIDQK 143

Query: 142 SYEEISKILQK 152
           +Y++    L  
Sbjct: 144 AYDQALARLSG 154


>gi|255021267|ref|ZP_05293316.1| putative membrane protein [Acidithiobacillus caldus ATCC 51756]
 gi|254969278|gb|EET26791.1| putative membrane protein [Acidithiobacillus caldus ATCC 51756]
          Length = 203

 Score = 48.4 bits (114), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 66/185 (35%), Gaps = 4/185 (2%)

Query: 26  PLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNK 85
            L+  +++  A+ F+ +      +       +++  +   +N+L  A+ S + +L +   
Sbjct: 18  ILVFALVVLGAMGFFGYAKYQRHQMAQAAAVYSELTQSMAANQLAAAQVSAQTLLQKYPD 77

Query: 86  L-YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y  ++  + A + + +     A      +   D  P  +   A    A + +D     
Sbjct: 78  TPYATMARFFTARMAMMQHHEAQAQAQLEAILKKDHLPTGMAGLARFTLAELQLDQG--- 134

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
           +  K L  L  P         E+ G +        KA+  + +  +   +        Q+
Sbjct: 135 QAKKALDTLGAPGTVYAPLYWELRGDAHEYLRAWPKARQDYLKAEQALPATDPYRAYLQL 194

Query: 205 ILANI 209
            LANI
Sbjct: 195 KLANI 199


>gi|68248973|ref|YP_248085.1| hypothetical protein NTHI0490 [Haemophilus influenzae 86-028NP]
 gi|68057172|gb|AAX87425.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
          Length = 204

 Score = 48.4 bits (114), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 57/196 (29%), Gaps = 15/196 (7%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVGGMFGWRYWQSHQAEQIAQASAQYDTLI 61

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            +++     K  +     + + +     Y   + +  A     K D   A     + A  
Sbjct: 62  NSVQQDEQAKKANIE---QFVQANSKTAYAVFALLDEAKKATQKQDFSAAEANLNQ-ALT 117

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFG 176
                 +     L+ +++       +     L ++   S      A + +  G   +  G
Sbjct: 118 QSQDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVKGES----FNARKAILTGDIQVAKG 173

Query: 177 KVQKAKTIFEELAKDN 192
               AK  FE+  +  
Sbjct: 174 DKVAAKNSFEQAQQSG 189


>gi|330830066|ref|YP_004393018.1| tetratricopeptide repeat family protein [Aeromonas veronii B565]
 gi|328805202|gb|AEB50401.1| Tetratricopeptide repeat family [Aeromonas veronii B565]
          Length = 216

 Score = 48.1 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 32/189 (16%), Positives = 62/189 (32%), Gaps = 5/189 (2%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           +    +   +  K     +    ++ ++ L  W Y      E        ++ Q +E   
Sbjct: 7   EEQQVEVIKEWWKENGTSVIAGTVIGLVGLFGWRYYNQHQQET-MEASSHSYNQVIEQLA 65

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
                    + + + +     Y  L+ + +A+  V  G    AAE    VA       ++
Sbjct: 66  KGDAAGFEQAQQFVTANKGDSYGELAALQLAAAAVKAGKLDLAAEQLNLVATTG--DESI 123

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           R  A L+ A +L D    +E    L  +            E  G    K GK ++A+  +
Sbjct: 124 RPIAALRLARVLNDQGKADEALAKLATIQNE--AFKAQVAEARGDVLQKQGKTEEARDAY 181

Query: 186 EELAKDNNS 194
           +  A     
Sbjct: 182 QAAADAGGL 190


>gi|218514897|ref|ZP_03511737.1| hypothetical protein Retl8_14927 [Rhizobium etli 8C-3]
          Length = 83

 Score = 48.1 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 35/75 (46%), Gaps = 2/75 (2%)

Query: 2  ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
          E N +  S + K    +  +     ++ ++I+       L++   + + +  G+ F  A+
Sbjct: 11 EVNEELRSDQMKGVWRR--FGRYIIVVAILIVVGTAGKVLYEYWDDNRSSSAGDQFLAAM 68

Query: 62 ELFNSNKLDDARSSF 76
          +L + NK D+A ++ 
Sbjct: 69 KLADENKNDEALAAL 83


>gi|16272318|ref|NP_438531.1| hypothetical protein HI0370 [Haemophilus influenzae Rd KW20]
 gi|260580567|ref|ZP_05848395.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|1175233|sp|P43989|Y370_HAEIN RecName: Full=UPF0070 protein HI_0370
 gi|1573339|gb|AAC22028.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092909|gb|EEW76844.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
          Length = 204

 Score = 48.1 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 57/196 (29%), Gaps = 15/196 (7%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVGGMFGWRYWQTHQAEQIAQASAQYDTLI 61

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            +++     K  +     + + +     Y   + +  A     K D   A     + A  
Sbjct: 62  NSVQQDEQAKKANIE---QFVQANSKTAYAVFALLDEAKKATEKQDFSAAEANLNQ-ALT 117

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFG 176
                 +     L+ +++       +     L ++   S      A + +  G   +  G
Sbjct: 118 QSQDEVLTSIVALRLSAVQFQLGQLDNALSTLNQVKGES----FNARKAILTGDIQVAKG 173

Query: 177 KVQKAKTIFEELAKDN 192
               AK  FE+  +  
Sbjct: 174 DKVAAKNSFEQAQQSG 189


>gi|146293746|ref|YP_001184170.1| hypothetical protein Sputcn32_2650 [Shewanella putrefaciens CN-32]
 gi|145565436|gb|ABP76371.1| conserved hypothetical protein [Shewanella putrefaciens CN-32]
 gi|319427120|gb|ADV55194.1| Protein of unknown function DUF2133 [Shewanella putrefaciens 200]
          Length = 206

 Score = 48.1 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 38/192 (19%), Positives = 67/192 (34%), Gaps = 6/192 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  +      K          +    ++ +  L  W Y  D     K     + F QAL 
Sbjct: 5   STEEQQVDAIKQFWKDYGTSILIG-AVVGLGGLYGWNYYSD-MKVAKAEEASKAF-QALT 61

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             ++++        E   + D K Y  L ++ +A   V   D   A +   KV       
Sbjct: 62  TKSADEAAMLAGVAEFSKNHDQKGYQALLDLIVAKTAVEAKDYPKAIDALNKVITAKP-G 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
            ++   ATL+ A I  +    +     L+K+S           E+ G   ++ G V+KAK
Sbjct: 121 ASLDTIATLRLARIQAELGQIDAGLATLEKVS--DKAFLAQREELKGDFLVRQGDVEKAK 178

Query: 183 TIFEELAKDNNS 194
           T ++    +   
Sbjct: 179 TAYQTAMDNGGV 190


>gi|237745513|ref|ZP_04575993.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229376864|gb|EEO26955.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 215

 Score = 48.1 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 67/194 (34%), Gaps = 7/194 (3%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
                   K    K    WI  +LI+++   A++ Y      ++      + + +     
Sbjct: 7   EQEQLESIKAWWKKHG-NWITWVLIIVLGCYAVYAYWGYYQRKQTAQ-ASQLYYEMQSAV 64

Query: 65  NSNKLDDARS-SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            S   + A   + +         Y P+  +  A +   + D   A      +  D+    
Sbjct: 65  LSGDSERALRVAKDTQEKFGGTAYAPMVTLVAARMAYEEKDADTAKSQLKWIV-DNGKQD 123

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
             +  A ++ A IL+D  +Y+E  K+L        P    A +  G   +   K+ +A+ 
Sbjct: 124 GYKAIARIRLAGILLDEKAYDEGMKLLS--VSFPEPFASLAEDRKGDFLVAQNKLAEARI 181

Query: 184 IFEELAKDNNSPFG 197
            ++  A +   P  
Sbjct: 182 AYQT-ALEKALPDD 194


>gi|238763552|ref|ZP_04624513.1| hypothetical protein ykris0001_7670 [Yersinia kristensenii ATCC
           33638]
 gi|238698184|gb|EEP90940.1| hypothetical protein ykris0001_7670 [Yersinia kristensenii ATCC
           33638]
          Length = 206

 Score = 48.1 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 70/188 (37%), Gaps = 6/188 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y     +          + QA +   +N   D+ +  EK + 
Sbjct: 23  KALAVGVVLGIGALVGWRYWQSHQNTVLTEASS-AYQQASDALLAN-SADSVALAEKFVQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y  L+ + +A   V + +   AA+   +          +     L+ A + +   
Sbjct: 81  GNKNNYGVLAGLELAHHFVEQNEFDKAAQQLTQALGQTKDENLL-SLINLRLARLQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             +E  K L  +          A ++ G + L  G    A+  + +   ++N+   +   
Sbjct: 140 KPDEALKTLDAVQGDG--WTAMAQDVRGDALLSKGDTAGARAAYSK-GVESNASQALQAL 196

Query: 202 SQMILANI 209
            +M L N+
Sbjct: 197 LRMKLNNL 204


>gi|53802990|ref|YP_115283.1| hypothetical protein MCA2890 [Methylococcus capsulatus str. Bath]
 gi|53756751|gb|AAU91042.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath]
          Length = 211

 Score = 48.1 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 27/166 (16%), Positives = 67/166 (40%), Gaps = 2/166 (1%)

Query: 29  ILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNK-LY 87
           + + +++ + +  +  S E+K  + G  + Q L+   + + + A    E+I  Q     Y
Sbjct: 29  VALGIAVIVGWGAWKRSQEEKALLGGTLYQQLLDAVANKQTEAAVQLGERISQQFPGSAY 88

Query: 88  NPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEIS 147
           +    +++  + V  GD   A     ++         ++  A L+ A I +     EE  
Sbjct: 89  DTYGKLFLVRLKVEAGDLAGAKTQLQQLIATTKDEKILQ-IARLRLAEIQLGLGETEEAL 147

Query: 148 KILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           ++ + L+  +        E+ G   L   + ++A+  + +  +D  
Sbjct: 148 RLAESLTGSTPESAALREELKGDVYLAMNRPEEARAAYLKARRDGQ 193


>gi|148979609|ref|ZP_01815614.1| hypothetical protein VSWAT3_08983 [Vibrionales bacterium SWAT-3]
 gi|145961694|gb|EDK26991.1| hypothetical protein VSWAT3_08983 [Vibrionales bacterium SWAT-3]
          Length = 204

 Score = 48.1 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 31/196 (15%), Positives = 71/196 (36%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +++    +      K   K +    ++ +  L  W Y  D   E +     E++   +  
Sbjct: 5   DSEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVEAR-EAASESYTTVISA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            ++  +D        I +  +  Y+ L+ M +A + V  G+   A E   + A       
Sbjct: 64  LDAKGVDAQSDIQAFIDANKDAEYSVLAAMQLAKVQVQAGELSAALEQL-EWAKAATKDA 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+    T + A I  +   ++     L  +++ S        E+ G  +L+ G    A +
Sbjct: 123 ALSPLLTYRVARIKAEQGEFDAALSDLAAVTDES--WKGRVAELRGDISLRKGDTDAAYS 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  +  ++   + 
Sbjct: 181 AYTEAQQAVDASQTLQ 196


>gi|319896699|ref|YP_004134892.1| hypothetical protein HIBPF03170 [Haemophilus influenzae F3031]
 gi|317432201|emb|CBY80553.1| conserved hypothetical protein [Haemophilus influenzae F3031]
          Length = 204

 Score = 48.1 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 57/196 (29%), Gaps = 15/196 (7%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVGGMFGWRYWQTHQAEQIAQASAQYDTLI 61

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            +++     K  +     + + +     Y   + +  A     K D   A     + A  
Sbjct: 62  NSVQQDEQAKKANIE---QFVQANSKTAYAVFALLDEAKKATEKQDFSAAEANLNQ-ALT 117

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFG 176
                 +     L+ +++       +     L ++   S      A + +  G   +  G
Sbjct: 118 QSQDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVKGES----FNARKAILTGDIQVAKG 173

Query: 177 KVQKAKTIFEELAKDN 192
               AK  FE+  +  
Sbjct: 174 DKVAAKNSFEQAQQSG 189


>gi|197335105|ref|YP_002155388.1| Tetratricopeptide repeat family protein [Vibrio fischeri MJ11]
 gi|197316595|gb|ACH66042.1| Tetratricopeptide repeat family protein [Vibrio fischeri MJ11]
          Length = 203

 Score = 48.1 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 61/150 (40%), Gaps = 3/150 (2%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
            +  +  S    K      + +AL    ++  D   S+   I +  +  Y  L+ + +A 
Sbjct: 38  GWKYYQSSQITAKETASAAYERALTALQASGADAVESTQVFIDANKSSEYASLAALQLAK 97

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
           + V  G  +NA E    VA++     ++   A +++A I  +  +++     L  +   S
Sbjct: 98  VQVEAGQLENALEQLNWVASNSK-DESLTAMAQVRSARIQAEQGNFDAALATLANVKPAS 156

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEE 187
                   E+ G  AL+ G +  A++ + E
Sbjct: 157 WAARVA--ELKGDIALRQGDIATARSAYTE 184


>gi|91225137|ref|ZP_01260359.1| hypothetical protein V12G01_12955 [Vibrio alginolyticus 12G01]
 gi|269965172|ref|ZP_06179306.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|91190080|gb|EAS76351.1| hypothetical protein V12G01_12955 [Vibrio alginolyticus 12G01]
 gi|269830158|gb|EEZ84385.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 204

 Score = 48.1 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 31/196 (15%), Positives = 67/196 (34%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + +    +      K   K +    ++ +  L  W Y  D S  +      +++  A+  
Sbjct: 5   DTEEQQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQD-SVIQASEAASQSYTTAMNA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
                 D        I S + K Y+ L+ + +A   V   D   A E   K A  +    
Sbjct: 64  LQDKGTDAQADVKAFIESNEVKEYSVLAALQLAKAQVEAQDLSAALEQL-KWAQSNTQDA 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+    + + A I  +  +++  +  L  ++           E+ G  A++ G    A  
Sbjct: 123 ALLPLISYRIARIETEMGNFDAATAELSNVT--DTAWTGRIAELRGDIAIRQGDKDAAYA 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  +  ++   + 
Sbjct: 181 AYTEAQQAADASPTLQ 196


>gi|254389236|ref|ZP_05004465.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC
           27064]
 gi|37575532|gb|AAQ93527.1| putative ATP/GTP binding protein [Streptomyces clavuligerus]
 gi|197702952|gb|EDY48764.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC
           27064]
          Length = 1009

 Score = 48.1 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 70/176 (39%), Gaps = 23/176 (13%)

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNP------LSNMYIASILVAKGDTKNAAEIFL 113
           A+  + + + D+A +  EK++    +L          +   +AS     G T+ A  I  
Sbjct: 650 AVSYWQAGRTDEAITIEEKVVEDRQRLLGDEHPDTHTARANLASSYWQAGRTEKAITILE 709

Query: 114 KVAND------DLAPLAVRYAATLQAASILVDTSS-----YEEISKILQKLSEPSNPMHQ 162
           +V  D      D  P  +   A L A+      +       E++ +  Q+L    +P   
Sbjct: 710 QVVEDRQRLLGDEHPDTLTARANLAASYQQAGRTEKAITILEQVVEDRQRLLGDEHPDTH 769

Query: 163 FANEILGISALKFGKVQKAKTIFEELAKD------NNSPFGISTRSQMILANIIAS 212
            A   L  S  + G+ +KA TI E++ +D      +  P  ++ R+ + ++   A 
Sbjct: 770 TARANLASSYWQAGRTEKAITILEQVVEDRQRLLGDEHPDTLTARANLAVSYQQAG 825



 Score = 42.7 bits (99), Expect = 0.040,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 66/169 (39%), Gaps = 23/169 (13%)

Query: 60  ALELFNSNKLDDARSSFEKILSQ-----DNKLYNPL-SNMYIASILVAKGDTKNAAEIFL 113
           A+    + + D+A +  E+++        ++    L +   +AS     G T  A  I  
Sbjct: 818 AVSYQQAGRTDEAITILEQVVEDIERLLGDEHPGTLTARANLASSYWQAGRTDEAITIEE 877

Query: 114 KVAND------DLAPLAVRYAATLQAASILVDTSS-----YEEISKILQKLSEPSNPMHQ 162
           KV  D      D  P  +   A L A+      +       E++ +  Q+L    +P   
Sbjct: 878 KVVEDRQRLLGDEHPGTLTARANLAASYQQAGRTEKAITILEQVVEDRQRLLGDEHPGTL 937

Query: 163 FANEILGISALKFGKVQKAKTIFEELAKD------NNSPFGISTRSQMI 205
            A   L +S  + G+  +A TI E++ +D      +  P  ++ R+ + 
Sbjct: 938 TARANLAVSYQQAGRTDEAITILEQVVEDRQRLLGDEHPGTLTARANLA 986



 Score = 41.1 bits (95), Expect = 0.10,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 63/169 (37%), Gaps = 23/169 (13%)

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNP------LSNMYIASILVAKGDTKNAAEIFL 113
           A     + + + A +  E+++    +L          +   +AS     G T+ A  I  
Sbjct: 734 AASYQQAGRTEKAITILEQVVEDRQRLLGDEHPDTHTARANLASSYWQAGRTEKAITILE 793

Query: 114 KVAND------DLAPLAVRYAATLQAASILVDTSS-----YEEISKILQKLSEPSNPMHQ 162
           +V  D      D  P  +   A L  +      +       E++ + +++L    +P   
Sbjct: 794 QVVEDRQRLLGDEHPDTLTARANLAVSYQQAGRTDEAITILEQVVEDIERLLGDEHPGTL 853

Query: 163 FANEILGISALKFGKVQKAKTIFEELAKD------NNSPFGISTRSQMI 205
            A   L  S  + G+  +A TI E++ +D      +  P  ++ R+ + 
Sbjct: 854 TARANLASSYWQAGRTDEAITIEEKVVEDRQRLLGDEHPGTLTARANLA 902



 Score = 37.7 bits (86), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 34/73 (46%), Gaps = 6/73 (8%)

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD------NNSPFGIS 199
           +++  ++L    +P    A   L  S  + G+ +KA TI E++ +D      +  P  ++
Sbjct: 585 MTERAEQLLGDEHPGTLTARANLASSYWQAGRTEKAITILEQVVEDRQRLLGDEHPGTLT 644

Query: 200 TRSQMILANIIAS 212
            R+ + ++   A 
Sbjct: 645 ARANLAVSYWQAG 657


>gi|145634634|ref|ZP_01790343.1| hypothetical protein CGSHiAA_05396 [Haemophilus influenzae PittAA]
 gi|145268179|gb|EDK08174.1| hypothetical protein CGSHiAA_05396 [Haemophilus influenzae PittAA]
          Length = 204

 Score = 48.1 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/189 (14%), Positives = 56/189 (29%), Gaps = 11/189 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E   + N  K   +  K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---EWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQ-ASAQYDAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   A     + A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFSAAEANLNQ-ALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFGKV 178
               +     L+ +++       +     L ++   S      A + +  G   +  G  
Sbjct: 120 QDEVLTSIIALRLSAVQFQLGQLDNALSTLNQVKGES----FNARKAILTGDIQVAKGDK 175

Query: 179 QKAKTIFEE 187
             AK  FE+
Sbjct: 176 VAAKNSFEQ 184


>gi|283780651|ref|YP_003371406.1| hypothetical protein Psta_2881 [Pirellula staleyi DSM 6068]
 gi|283439104|gb|ADB17546.1| Tetratricopeptide TPR_2 repeat protein [Pirellula staleyi DSM 6068]
          Length = 1076

 Score = 48.1 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 52/129 (40%), Gaps = 5/129 (3%)

Query: 65  NSNKLDDARSSFEKILSQDNKL-YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
              K + A ++FE +L +  +        M  A  L+ KGD   A ++F +VA       
Sbjct: 209 ELGKYEPALATFETLLKEFPESKLATEVTMRKAEALLQKGDLAAAEKLFGEVAAVKGFSQ 268

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA--LKFGKVQKA 181
           A    A L+  + L     + E + +L KL          A+  LG +    +     +A
Sbjct: 269 A--DYALLRQGTALAKQEKFPEAAAVLVKLVTDFGSSAYVADATLGAARYFYRANNDAEA 326

Query: 182 KTIFEELAK 190
           +T  +++ +
Sbjct: 327 ETWLKKVVE 335


>gi|167623301|ref|YP_001673595.1| tetratricopeptide repeat-containing protein [Shewanella
           halifaxensis HAW-EB4]
 gi|167353323|gb|ABZ75936.1| tetratricopeptide TPR_4 [Shewanella halifaxensis HAW-EB4]
          Length = 206

 Score = 48.1 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 29/160 (18%), Positives = 60/160 (37%), Gaps = 8/160 (5%)

Query: 37  IWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDA-RSSFEKILSQ-DNKLYNPLSNMY 94
             +  +      +     E+F     L N N  D A   + E    +   K Y  L  + 
Sbjct: 37  FGWNYYSDYQVAQAEAASESFQA---LSNQNSSDAAMLGAAENFAKEHGQKGYQSLLELL 93

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLS 154
           +A   V  GD   A      V   +    ++   AT++ A +  +   Y      L +++
Sbjct: 94  VAKSAVEAGDLDKAETTLKTVIATN-VDNSIVLIATMRLARVQAEKGQYATAITTLDQIT 152

Query: 155 EPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
           +P++   +   E+ G   ++ G+ +KAK  ++    +  +
Sbjct: 153 DPASVAQRD--ELKGDFLVRQGETEKAKVAYQTAVDNGGT 190


>gi|171913852|ref|ZP_02929322.1| serine/threonine protein kinase [Verrucomicrobium spinosum DSM
           4136]
          Length = 793

 Score = 48.1 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 52/150 (34%), Gaps = 11/150 (7%)

Query: 44  GSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPL--SNMYIASILVA 101
           G+ E     V + F +A       K  +AR  F+ ++S        L  +    A   + 
Sbjct: 367 GTSEASTETVADIFLRARGTLLEGKFAEARKLFDGLISSGRAKQPTLNWARFNAALCAMV 426

Query: 102 KGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMH 161
            G  ++A + F  +  D  A   +      +     +     +++      ++       
Sbjct: 427 DGKRQDAEKYFESIRQDAGAGSEMSGV-EFKEFFGKIGGRMSQDLGL---GMARREVSYE 482

Query: 162 QFANEIL-----GISALKFGKVQKAKTIFE 186
           + + E+L     G++   FGK + A    E
Sbjct: 483 ETSEEVLGYLAHGLAQWHFGKPRAAVEWLE 512


>gi|254228664|ref|ZP_04922088.1| TPR repeat containing protein [Vibrio sp. Ex25]
 gi|262395116|ref|YP_003286970.1| hypothetical protein VEA_004347 [Vibrio sp. Ex25]
 gi|151938843|gb|EDN57677.1| TPR repeat containing protein [Vibrio sp. Ex25]
 gi|262338710|gb|ACY52505.1| putative membrane protein [Vibrio sp. Ex25]
          Length = 204

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 31/196 (15%), Positives = 67/196 (34%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + +    +      K   K +    ++ +  L  W Y  D S  +      +++  A+  
Sbjct: 5   DTEEQQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQD-SVIQASEAASQSYTTAMNA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
                 D        I S + K Y+ L+ + +A   V   D   A E   K A  +    
Sbjct: 64  LQDKGTDAQADVKAFIESNEVKEYSVLAALQLAKAQVEAQDLSAALEQL-KWAQSNTQDA 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+    + + A I  +  +++  +  L  ++           E+ G  A++ G    A  
Sbjct: 123 ALLPLISYRIARIETEMGNFDAATAELSNVT--DAAWTGRIAELRGDIAIRQGDKDAAYA 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  +  ++   + 
Sbjct: 181 AYTEAQQAADASPTLQ 196


>gi|158522429|ref|YP_001530299.1| TPR repeat-containing protein [Desulfococcus oleovorans Hxd3]
 gi|158511255|gb|ABW68222.1| Tetratricopeptide TPR_2 repeat protein [Desulfococcus oleovorans
           Hxd3]
          Length = 827

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 57/145 (39%), Gaps = 8/145 (5%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L    +  +A   FE +L +D    +  + M +A I   +GD +  A +  K    D A 
Sbjct: 536 LLAQRREQEAAVLFEAVLQKDPG--HTEALMNLALIADKQGDREKTAALLEKAIRLDPAS 593

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
                 A      +L  T + +     L++ +    P H  A+  +G   L+ GK  +A 
Sbjct: 594 AE----ARYHLGELLARTGNPDNAMAQLEQ-ALHLKPDHALAHNAMGNLWLQAGKTDRAI 648

Query: 183 TIFEE-LAKDNNSPFGISTRSQMIL 206
             +++ +A D       +  +  ++
Sbjct: 649 DHYQKAIAIDPGFAAAHTNLADALV 673


>gi|16761436|ref|NP_457053.1| hypothetical protein STY2766 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16765841|ref|NP_461456.1| inner membrane protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29140867|ref|NP_804209.1| hypothetical protein t0335 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56412600|ref|YP_149675.1| hypothetical protein SPA0346 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62181088|ref|YP_217505.1| hypothetical protein SC2518 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161612721|ref|YP_001586686.1| hypothetical protein SPAB_00420 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167549459|ref|ZP_02343218.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167991829|ref|ZP_02572928.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168232088|ref|ZP_02657146.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168238258|ref|ZP_02663316.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168243300|ref|ZP_02668232.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168261441|ref|ZP_02683414.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168466729|ref|ZP_02700583.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194445044|ref|YP_002041779.1| hypothetical protein SNSL254_A2715 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194451252|ref|YP_002046579.1| hypothetical protein SeHA_C2778 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194473001|ref|ZP_03078985.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194735489|ref|YP_002115583.1| hypothetical protein SeSA_A2759 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197251319|ref|YP_002147474.1| hypothetical protein SeAg_B2672 [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197265697|ref|ZP_03165771.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197361535|ref|YP_002141171.1| hypothetical protein SSPA0326 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198243484|ref|YP_002216584.1| hypothetical protein SeD_A2889 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200387924|ref|ZP_03214536.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204929435|ref|ZP_03220509.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205353620|ref|YP_002227421.1| hypothetical protein SG2556 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207857929|ref|YP_002244580.1| hypothetical protein SEN2501 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213161950|ref|ZP_03347660.1| hypothetical protein Salmoneentericaenterica_18907 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213425333|ref|ZP_03358083.1| hypothetical protein SentesTyphi_06383 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213581533|ref|ZP_03363359.1| hypothetical protein SentesTyph_10117 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213861386|ref|ZP_03385856.1| hypothetical protein SentesT_27905 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224582942|ref|YP_002636740.1| hypothetical protein SPC_1133 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238912641|ref|ZP_04656478.1| hypothetical protein SentesTe_16122 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289825428|ref|ZP_06544665.1| hypothetical protein Salmonellentericaenterica_08533 [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|25323209|pir||AH0821 probable membrane protein STY2766 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16421065|gb|AAL21415.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16503736|emb|CAD02724.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136492|gb|AAO68058.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56126857|gb|AAV76363.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62128721|gb|AAX66424.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161362085|gb|ABX65853.1| hypothetical protein SPAB_00420 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403707|gb|ACF63929.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194409556|gb|ACF69775.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194459365|gb|EDX48204.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194710991|gb|ACF90212.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195630849|gb|EDX49441.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197093011|emb|CAR58444.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197215022|gb|ACH52419.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197243952|gb|EDY26572.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197288833|gb|EDY28206.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197938000|gb|ACH75333.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199605022|gb|EDZ03567.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204321154|gb|EDZ06354.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205273401|emb|CAR38376.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205325230|gb|EDZ13069.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205329907|gb|EDZ16671.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205333593|gb|EDZ20357.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205337701|gb|EDZ24465.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205349439|gb|EDZ36070.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206709732|emb|CAR34084.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224467469|gb|ACN45299.1| hypothetical protein SPC_1133 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261247717|emb|CBG25545.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267994638|gb|ACY89523.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159070|emb|CBW18584.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913508|dbj|BAJ37482.1| hypothetical protein STMDT12_C25390 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321222778|gb|EFX47849.1| hypothetical protein SEE_04090 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322715575|gb|EFZ07146.1| UPF0070 protein yfgM [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323130849|gb|ADX18279.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|326624340|gb|EGE30685.1| UPF0070 protein yfgM [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326628720|gb|EGE35063.1| Putative membrane protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332989448|gb|AEF08431.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 206

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 66/175 (37%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL + +L  W Y      E         +  A+   +++K D   ++ EK  +
Sbjct: 23  KALAVGVILGVGALVGWRYWSSHQTES-ARAASLAYQNAVTAVSADKPDSIPAA-EKFAA 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           ++   Y  L++M +A   V K + K A     +          ++    L+ A + +   
Sbjct: 81  ENKNTYGALASMELAQQFVDKNELKKAEAQLQQGLAATS-DENLKAVINLRLARVQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L   +           ++ G + L  G  + A++ +E     + SP 
Sbjct: 140 QADAALKTLD--AVKGEGWTAIVADLRGEALLSKGDKKGARSAWEAGVNSDASPA 192


>gi|322613734|gb|EFY10673.1| hypothetical protein SEEM315_21653 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619523|gb|EFY16399.1| hypothetical protein SEEM971_02860 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625028|gb|EFY21857.1| hypothetical protein SEEM973_02612 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629529|gb|EFY26305.1| hypothetical protein SEEM974_03895 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634040|gb|EFY30777.1| hypothetical protein SEEM201_22080 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635522|gb|EFY32233.1| hypothetical protein SEEM202_06950 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322639802|gb|EFY36481.1| hypothetical protein SEEM954_07743 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322648569|gb|EFY45018.1| hypothetical protein SEEM675_20865 [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655211|gb|EFY51520.1| hypothetical protein SEEM965_04201 [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658258|gb|EFY54524.1| hypothetical protein SEEM19N_02597 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664259|gb|EFY60456.1| hypothetical protein SEEM801_05276 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669426|gb|EFY65575.1| hypothetical protein SEEM507_17689 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673153|gb|EFY69259.1| hypothetical protein SEEM877_16601 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676545|gb|EFY72613.1| hypothetical protein SEEM867_11678 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683295|gb|EFY79309.1| hypothetical protein SEEM180_08706 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322685819|gb|EFY81812.1| hypothetical protein SEEM600_02542 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323194762|gb|EFZ79950.1| hypothetical protein SEEM581_11406 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199550|gb|EFZ84641.1| hypothetical protein SEEM501_17794 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204675|gb|EFZ89673.1| hypothetical protein SEEM460_01767 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323208123|gb|EFZ93068.1| hypothetical protein SEEM020_00580 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210153|gb|EFZ95054.1| hypothetical protein SEEM6152_19905 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217021|gb|EGA01743.1| hypothetical protein SEEM0077_09954 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221819|gb|EGA06223.1| hypothetical protein SEEM0047_01578 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225002|gb|EGA09257.1| hypothetical protein SEEM0055_13382 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229291|gb|EGA13415.1| hypothetical protein SEEM0052_10668 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235394|gb|EGA19478.1| hypothetical protein SEEM3312_10711 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237420|gb|EGA21483.1| hypothetical protein SEEM5258_15794 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245174|gb|EGA29175.1| hypothetical protein SEEM1156_08080 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323248877|gb|EGA32803.1| hypothetical protein SEEM9199_11063 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253164|gb|EGA36996.1| hypothetical protein SEEM8282_06350 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255398|gb|EGA39166.1| hypothetical protein SEEM8283_21542 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323263531|gb|EGA47058.1| hypothetical protein SEEM8284_00752 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266354|gb|EGA49842.1| hypothetical protein SEEM8285_17597 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
          Length = 206

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 66/175 (37%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL + +L  W Y      E         +  A+   +++K D   ++ EK  +
Sbjct: 23  KALAVGVILGVGALVGWRYWSSHQTES-ARAASLAYQNAVTAVSADKPDSIPAA-EKFAA 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           ++   Y  L++M +A   V K + K A     +          ++    L+ A + +   
Sbjct: 81  ENKNTYGALASMELAQQFVDKNELKKAEAQLQQGVAATS-DENLKAVINLRLARVQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L   +           ++ G + L  G  + A++ +E     + SP 
Sbjct: 140 QADAALKTLD--AVKGEGWTAIVADLRGEALLSKGDKKGARSAWEAGVNSDASPA 192


>gi|317049134|ref|YP_004116782.1| hypothetical protein Pat9b_2927 [Pantoea sp. At-9b]
 gi|316950751|gb|ADU70226.1| Protein of unknown function DUF2133 [Pantoea sp. At-9b]
          Length = 205

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 63/194 (32%), Gaps = 6/194 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           SN +      +        K +A  +I+ I +L  W +    SHE   +       Q L 
Sbjct: 5   SNENEQVDALRRFFANNG-KALAVGVIIGIAALGGWRFW--ASHEAGNDKAASAEYQKLT 61

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
                       +     S++N  Y  L+++ +A   V       A  +      D    
Sbjct: 62  SAMQADKPQTLEAVASFASENNNTYGALASLDLAKQYVETNQLDKAIALLQSGLKDTK-D 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++    L+ A I +  +  +     L  +            +I G + L  G  Q A+
Sbjct: 121 ANLQAVINLRLARIQLQQNQADAALSTLNNVKGDG--WTAIVADIRGEALLSKGDKQGAR 178

Query: 183 TIFEELAKDNNSPF 196
             + + A+   SP 
Sbjct: 179 DAWSKGAESQASPA 192


>gi|111223302|ref|YP_714096.1| putative serine/threonine-protein kinase [Frankia alni ACN14a]
 gi|111150834|emb|CAJ62538.1| putative serine/threonine-protein kinase [Frankia alni ACN14a]
          Length = 761

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/165 (16%), Positives = 53/165 (32%), Gaps = 9/165 (5%)

Query: 50  KNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAA 109
            +  G     A       + D AR   + + ++D   +    +     +L+ +GDT  A 
Sbjct: 506 ADSAGARLRLADLRTRLGEHDAARELLDAVAAEDPFAWRV--HWQRGLLLLTQGDTAGAV 563

Query: 110 EIFLKVANDDLAPLAVR-YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL 168
             F +V      P  +    A  +AA    +       ++ L  L   ++     A   L
Sbjct: 564 TAFERVY--GEVPGELAPKLALARAA----EAGGNLPRAQELYDLVSRTDDTFTSAAFGL 617

Query: 169 GISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
               L  G    A   +  +   + +      R   +L  + A+ 
Sbjct: 618 ARVRLAAGDRDGAAQAYRRVPAASAAHVEARVRLARVLGTVTAAG 662


>gi|168821505|ref|ZP_02833505.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205342006|gb|EDZ28770.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320087016|emb|CBY96785.1| UPF0070 protein 1057 [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 206

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 66/175 (37%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL + +L  W Y      E         +  A+   +++K D   ++ EK  +
Sbjct: 23  KALAVGVILGVGALVGWRYWSSHQTES-ARAASLAYQNAVTAVSADKPDSIPAA-EKFAA 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           ++   Y  L++M +A   V K + K A     +          ++    L+ A + +   
Sbjct: 81  ENKNTYGALASMELAQQFVDKNELKKAEAQLQQGLAATS-DENLKAVINLRLARVQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L   +           ++ G + L  G  + A++ +E     + SP 
Sbjct: 140 QADAALKTLD--AVKGEGWTAIVADLRGEALLSKGDKKGARSAWEAGVNSDASPA 192


>gi|229196436|ref|ZP_04323183.1| TPR repeat-containing protein [Bacillus cereus m1293]
 gi|228587073|gb|EEK45144.1| TPR repeat-containing protein [Bacillus cereus m1293]
          Length = 891

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 71/184 (38%), Gaps = 11/184 (5%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
            K  K   K I  +   +++ +      +  +   K     E   QA +     K ++A 
Sbjct: 497 SKWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQAYDDKKYTKAEEAV 556

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
                +  +D       + + +A+I VA+G  K A +   K+  D         AA L A
Sbjct: 557 GQAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDREIDKENNEAAYLLA 610

Query: 134 ASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           ++       Y+E  +  ++     ++   P  + A   L +S +K  + +KA+ +  +++
Sbjct: 611 SA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMKEFEKAEDVIVKMS 669

Query: 190 KDNN 193
              N
Sbjct: 670 TKTN 673


>gi|149190088|ref|ZP_01868365.1| hypothetical protein VSAK1_12050 [Vibrio shilonii AK1]
 gi|148836118|gb|EDL53078.1| hypothetical protein VSAK1_12050 [Vibrio shilonii AK1]
          Length = 204

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/161 (17%), Positives = 64/161 (39%), Gaps = 3/161 (1%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +  S    +    E + +A+E   +   D +      I    +  Y+ L+++ +A +
Sbjct: 39  WRYYQDSVTSAQEAASEQYTKAVEAIAAKGTDASGDVQAFIDGSKDTEYSVLASLQLAKV 98

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G+ + A E   + A       A+    T + A ++ +T + +     L K+++   
Sbjct: 99  QVEAGELEKALEQL-QWAQSKTKDAAITPLVTYRIARLMAETGNVDGARAELAKITDD-- 155

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
                  E+ G  A++ G    A T + E  +  ++  G+ 
Sbjct: 156 AWAGRVAELRGDIAIRDGDRDAAYTAYTEAQQAQDASQGLQ 196


>gi|15892236|ref|NP_359950.1| hypothetical protein RC0313 [Rickettsia conorii str. Malish 7]
 gi|15619373|gb|AAL02851.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 220

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/169 (15%), Positives = 66/169 (39%), Gaps = 6/169 (3%)

Query: 48  KKKNIVGENFAQALELFNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           K     G+   + + L  +   ++ A ++ E +++  N     ++ +   +I ++K    
Sbjct: 51  KNNQKNGDILVKTVGLETTKDNEELAFNTLEHLVTTSNTKIKEIAALEQVAIKISKKKYS 110

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDT-----SSYEEISKILQKLSEPSNPMH 161
            A ++  K+  +          A +   S+++D         E+++K L    +   P  
Sbjct: 111 EAKDLLNKIIENKEYSEISTSYARISWCSLVIDDHNLDIQDKEKLTKYLNYFDDEKKPFW 170

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
             A  I  +  +K     +A+   + L   NN    I  +++ +L N+ 
Sbjct: 171 ATATIIKAMWDIKNNMKPQAEKNLKNLLISNNVSDLIKDQAKALLVNLN 219


>gi|238785323|ref|ZP_04629312.1| hypothetical protein yberc0001_29830 [Yersinia bercovieri ATCC
           43970]
 gi|238713776|gb|EEQ05799.1| hypothetical protein yberc0001_29830 [Yersinia bercovieri ATCC
           43970]
          Length = 206

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 71/188 (37%), Gaps = 6/188 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y     +          + QA +  ++N   D  +  EK + 
Sbjct: 23  KALAVGVVLGIAALVGWRYWQSHQN-SAMTEASTAYQQASDALSAN-SADGVALAEKFVQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y  L+ + +A   V + +   AA+   +          +     L+ A + +   
Sbjct: 81  GNKNNYGVLAGLELAHHFVEQNEFDKAAQQLTQALGQTKDENLL-SLINLRLARLQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             +E  K L  +          A ++ G + L  G +  A+  + +   ++N+   +   
Sbjct: 140 KPDEALKTLDAVQGDG--WTAMAQDVRGDALLSKGDISGARAAYSK-GVESNASQALQAL 196

Query: 202 SQMILANI 209
            +M L N+
Sbjct: 197 LRMKLNNL 204


>gi|90021083|ref|YP_526910.1| hypothetical protein Sde_1436 [Saccharophagus degradans 2-40]
 gi|89950683|gb|ABD80698.1| conserved hypothetical protein [Saccharophagus degradans 2-40]
          Length = 238

 Score = 47.7 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 39/176 (22%), Positives = 63/176 (35%), Gaps = 13/176 (7%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK--------LDDA 72
           +  I   ++++I+  A W Y  D   E +       F   LE   +          + DA
Sbjct: 22  WASIVLPVVILIVGYAGWSYWGDYK-EARAQEGSAAFQVLLEKVEAQPGQKLSADAITDA 80

Query: 73  RSSFEKILSQDNKL-YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           +   + I S+ +   Y  +SN+ +A + V  G    A      V     A  +V   A  
Sbjct: 81  QLEAQSIASEFSGSLYADMSNLLLARLAVESGKLDEAEAALNAVIA-SPANESVVGLAKA 139

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           + A +      Y E S ++   S           EI G  AL  G +  A T + E
Sbjct: 140 RLAKVYAAQGKYAEASTLVG--STEQEAYKALYAEIRGDIALAQGDLPTAHTAYNE 193


>gi|332992291|gb|AEF02346.1| putative membrane-associated protein with TPR-like domain
           [Alteromonas sp. SN2]
          Length = 206

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/180 (15%), Positives = 59/180 (32%), Gaps = 7/180 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  D      K    +     I     L +  L  W Y  D     K       +  A+E
Sbjct: 5   ATEDQQVEAIKRFWKEHGTAIIVGAA-LGLGGLWGWRYYSDTQMATK-EAASVEYQNAVE 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
            +      D  ++F  I + ++  Y  ++++  A   V  GD   AA    +V       
Sbjct: 63  TYGEEGSADKITAF--INANEDSGYASVASLLAAKQAVDAGDFDAAASHLNRVV-TFAEN 119

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++  A ++   + ++ +  +     L  ++          +E+ G    +  K   A+
Sbjct: 120 EELKALAAIRLTRVQIEMNQLDAALSTLGNITNE--AFAAEVSELKGDVYQQQSKFDDAR 177


>gi|34580744|ref|ZP_00142224.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262129|gb|EAA25633.1| unknown [Rickettsia sibirica 246]
          Length = 220

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/169 (16%), Positives = 66/169 (39%), Gaps = 6/169 (3%)

Query: 48  KKKNIVGENFAQALELFNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           K     G+   + + L  +   ++ A ++ E +++  N     ++ +   +I ++K    
Sbjct: 51  KNNQKNGDILVKTVGLETTKDNEELAFNTLENLVTTSNTKIQEIAALEQVAIKISKKKYS 110

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDT-----SSYEEISKILQKLSEPSNPMH 161
            A ++  KV  +          A +   S+++D         E+++K L    +   P  
Sbjct: 111 EAKDLLNKVIENKEYSEISTSYARISWCSLVIDDHNLDIQDKEKLTKYLNYFDDEKKPFW 170

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
             A  I  +  +K     +A+   + L   NN    I  +++ +L N+ 
Sbjct: 171 ATATIIKAMWDIKNNMKPQAEKNLKNLLISNNVSDLIKDQAKALLVNLN 219


>gi|307245519|ref|ZP_07527606.1| UDP-N-acetylglucosamine-peptide-n- acetylglucosaminyltransferase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306853578|gb|EFM85796.1| UDP-N-acetylglucosamine-peptide-n- acetylglucosaminyltransferase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
          Length = 718

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 67/172 (38%), Gaps = 10/172 (5%)

Query: 44  GSHEKKKNIVGENFAQA-----LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
                 +    E + +A     + L    K+D+A   +  +  + +     ++ + +   
Sbjct: 170 AYRNVNREDSAEAYVRAQLNVGITLEKKGKVDEAIVVYRNVTREGSAEQYAIAQVNLGIA 229

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
           L  +G    A   +  V  +D A + VR  A +     L +   ++E       +S   +
Sbjct: 230 LGKQGKVDEAIVAYRNVNREDSAEVYVR--AQINLGITLGEQGKFDEAIAAFNNVSREDS 287

Query: 159 P-MHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
             ++  A   LGI+  K G+  +A   +  + +++++   +  + Q +L  I
Sbjct: 288 TELYAIAQVNLGITLRKQGRGDEAIVAYRNVNREDSA--KLYVKVQFLLGLI 337



 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 62/161 (38%), Gaps = 5/161 (3%)

Query: 45  SHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
             +  K          + L    K+D+A  ++  +  +D+      + + I   L  +G 
Sbjct: 32  QEDDVKQYARAQLNIGIILGKQGKVDEAIVAYRNVNREDSVESYARAQLNIGITLGEQGK 91

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE-EISKILQKLSEPSNPMHQF 163
              A   +  V  +D A    +  A L    IL +    + EI        E S   +  
Sbjct: 92  VDEALVAYRNVNREDSAEQYAK--AQLNIGIILGEQGKIDEEIEAYYNVTREDSAEQYAI 149

Query: 164 ANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
           A   LGI+  K GKV +A   +  + +++++   +  R+Q+
Sbjct: 150 AQVNLGIALGKQGKVDQALVAYRNVNREDSAEAYV--RAQL 188



 Score = 43.4 bits (101), Expect = 0.023,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 64/175 (36%), Gaps = 10/175 (5%)

Query: 49  KKNIVGENFAQA-----LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKG 103
            +    E +A A     + L    K+D+A  ++  +  +D+      + + +   L  +G
Sbjct: 211 TREGSAEQYAIAQVNLGIALGKQGKVDEAIVAYRNVNREDSAEVYVRAQINLGITLGEQG 270

Query: 104 DTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE-ISKILQKLSEPSNPMHQ 162
               A   F  V+ +D     +   A +     L      +E I        E S  ++ 
Sbjct: 271 KFDEAIAAFNNVSREDS--TELYAIAQVNLGITLRKQGRGDEAIVAYRNVNREDSAKLYV 328

Query: 163 FANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
               +LG+      K+ +A+  F  +   ++    + T++Q+ L  +    +  +
Sbjct: 329 KVQFLLGLIFESQDKLDEARDAFNNIRLSDSV--ELYTKAQVYLKVLNIGKKEIR 381



 Score = 40.7 bits (94), Expect = 0.13,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 59/160 (36%), Gaps = 3/160 (1%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYI 95
           AI  Y      +  ++         + L    K+D+A  ++  +  +D+      + + I
Sbjct: 59  AIVAYRNVNREDSVESYARAQLNIGITLGEQGKVDEALVAYRNVNREDSAEQYAKAQLNI 118

Query: 96  ASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE-ISKILQKLS 154
             IL  +G      E +  V  +D A       A +     L      ++ +        
Sbjct: 119 GIILGEQGKIDEEIEAYYNVTREDSAEQY--AIAQVNLGIALGKQGKVDQALVAYRNVNR 176

Query: 155 EPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
           E S   +  A   +GI+  K GKV +A  ++  + ++ ++
Sbjct: 177 EDSAEAYVRAQLNVGITLEKKGKVDEAIVVYRNVTREGSA 216


>gi|170718898|ref|YP_001784069.1| hypothetical protein HSM_0731 [Haemophilus somnus 2336]
 gi|168827027|gb|ACA32398.1| conserved hypothetical protein [Haemophilus somnus 2336]
          Length = 203

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 66/188 (35%), Gaps = 10/188 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E   + N  K      K  YK I  +++L    +  W Y  D    KK   +   + + 
Sbjct: 5   IEEEQELNELKT---WWKENYKSIIVIVLLAFSGVFGWRYWQDYQTTKK-QTLSAQYDEL 60

Query: 61  LELFNSNKLDDARSSFEK-ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           +    +  + +A    ++ +       Y   + +  A + V++ +   A E   + A  +
Sbjct: 61  ISSAENQSIYNA--QLDRFVQENGETTYAVFALLDKAKLEVSQQNFVQAEETLKQ-AIVN 117

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
            +   +     ++ A++      ++E    L +              + G   L  G  +
Sbjct: 118 TSDDILMSITAIRLATVQYQLQKFDEALASLNQ--VKGQSWDVSKLLLSGDIQLAKGNKE 175

Query: 180 KAKTIFEE 187
            AK  FE+
Sbjct: 176 IAKDNFEQ 183


>gi|262371082|ref|ZP_06064404.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262313968|gb|EEY95013.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 232

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 64/177 (36%), Gaps = 6/177 (3%)

Query: 13  KCKMGKCCYKWIAPLLILMILSLAIWFYLFDGS-HEKKKNIVGENFAQALELFNSNKLDD 71
           K    K     I+ +LI +I +   W Y    +  E + N                    
Sbjct: 14  KSFTKKYGSAIISGILIALI-AFFGWQYWQKKTLAENQMNTAKVQQLMDEARATQGDAFT 72

Query: 72  ARSS-FEKILSQDNKLYNPL-SNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
           A S+  +KI+ +       + + + +A +   K D  +A +   KV N  +    +    
Sbjct: 73  ALSATADKIVKEAPDSAQAIQTQLLMAKLAYDKADYASAEKALKKVENSKVDDDGLVQIV 132

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
            L+ A   +    +++  K L  + +P       A+E LG   +    ++ AK  ++
Sbjct: 133 KLRLAYAQLAQKKFDDAIKNLALVKDP--AFKATADEALGDVYVAKNDIENAKKAYQ 187


>gi|229846457|ref|ZP_04466565.1| hypothetical protein CGSHi7P49H1_07290 [Haemophilus influenzae
           7P49H1]
 gi|229810550|gb|EEP46268.1| hypothetical protein CGSHi7P49H1_07290 [Haemophilus influenzae
           7P49H1]
          Length = 204

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 57/196 (29%), Gaps = 15/196 (7%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTLI 61

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            +++     K  +     + + +     Y   + +  A     K D   A     + A  
Sbjct: 62  NSVKQDEQAKKANIE---QFVQANSKTAYAVFALLDEAKKATEKQDFSAAEANLNQ-ALT 117

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFG 176
                 +     L+ +++       +     L ++   S      A + +  G   +  G
Sbjct: 118 QSQDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVKGES----FNARKAILTGDIQVAKG 173

Query: 177 KVQKAKTIFEELAKDN 192
               AK  FE+  +  
Sbjct: 174 DKVAAKNSFEQAQQSG 189


>gi|261340817|ref|ZP_05968675.1| putative inner membrane protein [Enterobacter cancerogenus ATCC
           35316]
 gi|288317243|gb|EFC56181.1| putative inner membrane protein [Enterobacter cancerogenus ATCC
           35316]
          Length = 206

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/175 (15%), Positives = 62/175 (35%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +   +IL + +L  W Y      +         +   +    +++     ++ EK ++
Sbjct: 23  KALVVGVILGVGALMGWRYWNSHQADS-ARGASLAYENTVSDIRADQPQT-LAAAEKFVA 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y  L+ + +A   V K +   AA    +      +   ++    L+ A I V   
Sbjct: 81  DNKNTYGALAALEVAQQYVDKNELDKAAAQLSQSLA-AASDENLKAVINLRLARIQVQQK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             ++  K L  +            ++ G + L  G  + A+  ++   +   SP 
Sbjct: 140 KADDALKTLDTIKGEG--FAAIVADLRGEALLSKGDKEGARKAWQAGVESKASPA 192


>gi|32455225|gb|AAP83327.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Enteritidis]
          Length = 206

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 67/175 (38%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL + +L  W Y      E         +  A+   +++K D   ++ EK  +
Sbjct: 23  KALAVGVILGVGALVGWRYWSSHQTES-ARAASLAYQNAVTAVSADKPDSIPAA-EKFAA 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           ++   Y  L++M +A   V K + K A     +      +   ++    L+ A + +   
Sbjct: 81  ENKNTYGALASMELAQQFVDKNELKKAEAQLQQ-GLVATSDENLKAVINLRLARVQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L   +           ++ G + L  G  + A++ +E     + SP 
Sbjct: 140 QADAALKTLD--AVKGEGWTAIVADLRGEALLSKGDKKGARSAWEAGVNSDASPA 192


>gi|33602150|ref|NP_889710.1| hypothetical protein BB3174 [Bordetella bronchiseptica RB50]
 gi|33576588|emb|CAE33666.1| putative membrane protein [Bordetella bronchiseptica RB50]
          Length = 212

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 71/204 (34%), Gaps = 8/204 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFAQALELFNSNKL 69
            +    +     I  L  L++L+   W       + +    +G  E    A  L  ++  
Sbjct: 14  IRAWWARYGTL-ILTLATLVVLAWGGWSGWKAYQNYRANQAMGYFEALEDAARLGGADAA 72

Query: 70  DDARSSFEKILSQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
              +++   + +      Y     +  A  L ++ D   A E    +A     P A++  
Sbjct: 73  TRIKAAAATLRTDYPATGYAGRGALIAAQALQSQQDVDGAREQLEWLAAQAKQP-ALQPV 131

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+ A IL+D   Y+     L +L+ P         +  G      GK  +A+  ++  
Sbjct: 132 ARLRLAGILLDQKQYD---AALAQLNNPPASFAALFADRRGDVLAAQGKRDEARAAWQSA 188

Query: 189 AKDNNSPFGISTRSQMILANIIAS 212
                +   ++   Q+ L  +  +
Sbjct: 189 IDGLGTSNPLTQVVQLKLDALSGA 212


>gi|145628726|ref|ZP_01784526.1| hypothetical protein CGSHi22121_06910 [Haemophilus influenzae
           22.1-21]
 gi|319775763|ref|YP_004138251.1| hypothetical protein HICON_11070 [Haemophilus influenzae F3047]
 gi|144979196|gb|EDJ88882.1| hypothetical protein CGSHi22121_06910 [Haemophilus influenzae
           22.1-21]
 gi|317450354|emb|CBY86570.1| conserved hypothetical protein [Haemophilus influenzae F3047]
          Length = 204

 Score = 47.3 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 57/196 (29%), Gaps = 15/196 (7%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTLI 61

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            +++     K  +     + + +     Y   + +  A     K D   A     + A  
Sbjct: 62  NSVQQDEQAKKANIE---QFVQANSKTAYAVFALLDEAKKATEKQDFSAAEANLNQ-ALT 117

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFG 176
                 +     L+ +++       +     L ++   S      A + +  G   +  G
Sbjct: 118 QSQDEVLTSIVALRLSAVQFQLGQLDNALSTLNQVKGES----FNARKAILTGDIQVAKG 173

Query: 177 KVQKAKTIFEELAKDN 192
               AK  FE+  +  
Sbjct: 174 DKVAAKNSFEQAQQSG 189


>gi|67459384|ref|YP_247008.1| hypothetical protein RF_0992 [Rickettsia felis URRWXCal2]
 gi|67004917|gb|AAY61843.1| unknown [Rickettsia felis URRWXCal2]
          Length = 220

 Score = 47.3 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/169 (14%), Positives = 66/169 (39%), Gaps = 6/169 (3%)

Query: 48  KKKNIVGENFAQALELFNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           K     G+   + + L  +   ++ A ++ E +++  N     ++ +   +I +++    
Sbjct: 51  KNNQKNGDILVKTVGLEATKDNEELAFNTLENLVTTSNTKIKEIAALEQVAIKISEKKYS 110

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE-----EISKILQKLSEPSNPMH 161
            A ++  K+  +          A +    +++D  + +     +++K L    +   P  
Sbjct: 111 EAKDLLNKIIENKEYSEISTSYARISWCGLVIDDQNLDIQDKEKLTKYLNYFDDEKKPFW 170

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
             A  I  +  +K     +A+   + L   NN    I  +++ +L N+ 
Sbjct: 171 ATATIIKAMWDIKNNMKPQAEKNLKNLLISNNVSDLIKDQAKALLVNLN 219


>gi|308271574|emb|CBX28182.1| hypothetical protein N47_G35060 [uncultured Desulfobacterium sp.]
          Length = 490

 Score = 47.3 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 48/133 (36%), Gaps = 17/133 (12%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL-A 121
           L      ++    F++ ++   K Y  +S    A +L   GD  +A   F K   ++   
Sbjct: 293 LAMYGNKENVLKMFKEDVTDKPKDY--MSQYKYALVLSESGDRSDAIAYFKKALEENPFD 350

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLS--EPSNPMHQFANEILGISALKF--GK 177
           P  +R    +           Y E  K L+      P +P       +L +  +K   GK
Sbjct: 351 PDILRDLGKV-----YFQDGQYPEAQKTLEGAVSLAPDDP-----ETLLFLGRIKAETGK 400

Query: 178 VQKAKTIFEELAK 190
              A+ +F  + +
Sbjct: 401 FNDARKLFLTITE 413



 Score = 41.5 bits (96), Expect = 0.086,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 51/139 (36%), Gaps = 9/139 (6%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL-K 114
            +  AL L  S    DA + F+K L ++    + L ++    +    G    A +     
Sbjct: 320 QYKYALVLSESGDRSDAIAYFKKALEENPFDPDILRDL--GKVYFQDGQYPEAQKTLEGA 377

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALK 174
           V+     P  + +   ++A     +T  + +  K+   ++    P ++ A  +LG +  K
Sbjct: 378 VSLAPDDPETLLFLGRIKA-----ETGKFNDARKLFLTIT-EKYPYYKRALYLLGETCGK 431

Query: 175 FGKVQKAKTIFEELAKDNN 193
              +  A        KD  
Sbjct: 432 MNNMADAHYYLGLFYKDKE 450


>gi|30248177|ref|NP_840247.1| hypothetical protein NE0151 [Nitrosomonas europaea ATCC 19718]
 gi|30180062|emb|CAD84062.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 214

 Score = 47.3 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/184 (16%), Positives = 68/184 (36%), Gaps = 5/184 (2%)

Query: 28  LILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKL- 86
            I +  +      L++    ++     + +A   +           +    +L++     
Sbjct: 29  AIAVFAATVAGNRLWNHYKAEQAQQAADLYAVLQQQVEKGSELVKITDAAHLLTEGFPGS 88

Query: 87  -YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE 145
            Y   + +  A      G+ + A    L+ A D      ++  A L+ AS+LVD S Y++
Sbjct: 89  GYASRAALIAARAAGQAGNDQVA-RDMLQWALDHAEEPEIKDMARLRLASVLVDESKYDQ 147

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
             K+L   ++ +        ++ G +    GK  +A+  +++     N+        QM 
Sbjct: 148 ALKLLD--AQHAASFTGLYADLRGDALAAAGKTDEARAAYQKALDSLNAQGAYRNVVQMK 205

Query: 206 LANI 209
           L  +
Sbjct: 206 LDVL 209


>gi|87118475|ref|ZP_01074374.1| hypothetical protein MED121_15649 [Marinomonas sp. MED121]
 gi|86166109|gb|EAQ67375.1| hypothetical protein MED121_15649 [Marinomonas sp. MED121]
          Length = 213

 Score = 47.3 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 71/190 (37%), Gaps = 11/190 (5%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENF-------A 58
           +  + + + +  K  +K     L+L +      ++ F    + ++N + E          
Sbjct: 3   ELKTEEEQIEAFKTWWKKNGTSLVLAVSLGVAGYFGFQAWQQNQENHLAEASSLFESMSQ 62

Query: 59  QALELFNSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
            A +L     L       +++++  D+  Y   +++  A + V   D   A     + A 
Sbjct: 63  AATDLSQDENLKTVSFIADQLVNDFDDTGYATFAHLLQAKVDVIGEDYDAAIARLNE-AK 121

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
           +    + ++  + L+ + +LV     ++    L  +S           E+ G   L  GK
Sbjct: 122 ESTDDVTLKAISDLRISKVLVHQGELDKALTQLANIS--LTEFDSLKLELKGDVLLAQGK 179

Query: 178 VQKAKTIFEE 187
            ++A+  ++ 
Sbjct: 180 EKEARDAYQA 189


>gi|295132712|ref|YP_003583388.1| tetratricopeptide repeat protein [Zunongwangia profunda SM-A87]
 gi|294980727|gb|ADF51192.1| tetratricopeptide repeat protein [Zunongwangia profunda SM-A87]
          Length = 1007

 Score = 47.3 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 69/176 (39%), Gaps = 7/176 (3%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPL-SNMY 94
           A W    D       ++    +  A   + +N    A+S+FEK L       + + +N Y
Sbjct: 705 AGWVKNIDFVEVSDADLDNTTYEAAENQYLANNTSQAKSNFEKYLKSFPNGIHAINANFY 764

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE---ISKILQ 151
           +A +    GD + +   +  V          +  A L    +  + S Y+E   + + L+
Sbjct: 765 LAQLQYRDGDKEGSVPHYKYVIAKPNNEFTEQALARLSQIYL--EKSQYQEALPLLQRLE 822

Query: 152 KLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
           +++  +     +A   L  S  +  +  +A    +++  +  +     T +Q+I+A
Sbjct: 823 QVAGDTQN-KIYAQSNLMKSYDEMNQPGQAAAYADKVLANPEADKQARTDAQLIVA 877


>gi|303252415|ref|ZP_07338581.1| hypothetical protein APP2_1391 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302648874|gb|EFL79064.1| hypothetical protein APP2_1391 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
          Length = 718

 Score = 47.3 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 61/157 (38%), Gaps = 8/157 (5%)

Query: 44  GSHEKKKNIVGENFAQA-----LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
                 +    E + +A     + L    K+D+A   +  +  + +     ++ + +   
Sbjct: 170 AYRNVNREDSAEAYVRAQLNVGITLEKKGKVDEAIVVYRNVTREGSAEQYAIAQVNLGIA 229

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
           L  +G    A   +  V  +D A + VR  A +     L +   ++E       +S   +
Sbjct: 230 LGKQGKVDEAIVAYRNVNREDSAEVYVR--AQINLGITLGEQGKFDEAIAAFNNVSREDS 287

Query: 159 P-MHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
             ++  A   LGI+  K G+  +A   +  + +++++
Sbjct: 288 TELYAIAQVNLGITLRKQGRGDEAIVAYRNVNREDSA 324



 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 62/161 (38%), Gaps = 5/161 (3%)

Query: 45  SHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
             +  K          + L    K+D+A  ++  +  +D+      + + I   L  +G 
Sbjct: 32  QEDDVKQYARAQLNIGIILGKQGKVDEAIVAYRNVNREDSVESYARAQLNIGITLGEQGK 91

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE-EISKILQKLSEPSNPMHQF 163
              A   +  V  +D A    +  A L    IL +    + EI        E S   +  
Sbjct: 92  VDEALVAYRNVNREDSAEQYAK--AQLNIGIILGEQGKIDEEIEAYYNVTREDSAEQYAI 149

Query: 164 ANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
           A   LGI+  K GKV +A   +  + +++++   +  R+Q+
Sbjct: 150 AQVNLGIALGKQGKVDQALVAYRNVNREDSAEAYV--RAQL 188



 Score = 40.7 bits (94), Expect = 0.14,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 59/160 (36%), Gaps = 3/160 (1%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYI 95
           AI  Y      +  ++         + L    K+D+A  ++  +  +D+      + + I
Sbjct: 59  AIVAYRNVNREDSVESYARAQLNIGITLGEQGKVDEALVAYRNVNREDSAEQYAKAQLNI 118

Query: 96  ASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE-ISKILQKLS 154
             IL  +G      E +  V  +D A       A +     L      ++ +        
Sbjct: 119 GIILGEQGKIDEEIEAYYNVTREDSAEQY--AIAQVNLGIALGKQGKVDQALVAYRNVNR 176

Query: 155 EPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
           E S   +  A   +GI+  K GKV +A  ++  + ++ ++
Sbjct: 177 EDSAEAYVRAQLNVGITLEKKGKVDEAIVVYRNVTREGSA 216


>gi|330859277|emb|CBX69627.1| UPF0070 protein yfgM [Yersinia enterocolitica W22703]
          Length = 125

 Score = 47.3 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 39/99 (39%), Gaps = 2/99 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y     +          + QA +  ++N   D  +  EK + 
Sbjct: 23  KALAVGVVLGIGALVGWRYWQSHQNTVLTEASS-AYQQASDALSAN-SADGVAVAEKFVQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +   Y  L+ + +A   V + +   AA+   +  +   
Sbjct: 81  SNKNNYGVLAGLELAHHFVEQNEFDKAAQQLTQALSQTK 119


>gi|241764497|ref|ZP_04762518.1| conserved hypothetical protein [Acidovorax delafieldii 2AN]
 gi|241366081|gb|EER60678.1| conserved hypothetical protein [Acidovorax delafieldii 2AN]
          Length = 240

 Score = 47.3 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/133 (11%), Positives = 42/133 (31%), Gaps = 2/133 (1%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKI- 79
           +  +   +++++      +  +     ++       F        +        +F  + 
Sbjct: 38  WGTLISTVVVLVFGSVAVWNGYQYWQNRQAIQASALFDAVDVAARAGDQGRMEQAFADLR 97

Query: 80  LSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
                      + + +A  ++  G+ K A E    VA         +  A L+ +S+L+D
Sbjct: 98  SKYAGTTQAAQAGLTLAKSMLDAGNAKGAKEALTWVAEKAGDD-GYKALARLRLSSVLMD 156

Query: 140 TSSYEEISKILQK 152
               +E    +  
Sbjct: 157 QKELDEALAQVSG 169


>gi|17545936|ref|NP_519338.1| hypothetical protein RSc1217 [Ralstonia solanacearum GMI1000]
 gi|17428231|emb|CAD14919.1| putative transmembrane protein [Ralstonia solanacearum GMI1000]
 gi|299067268|emb|CBJ38465.1| conserved protein of unknown function [Ralstonia solanacearum
           CMR15]
          Length = 211

 Score = 47.3 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 74/189 (39%), Gaps = 8/189 (4%)

Query: 27  LLILMILSLAIWFYL--FDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
           ++I+++L+LA WF    +      + +++ E   +A++  ++ K+  A +  E       
Sbjct: 28  IVIVVLLALAGWFGWKNWQRKQAGEASVLYEQVQKAVDAKDAEKIKRAAADMED--KFGR 85

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y  +  +  A  L    D   A +  L+   D       +  A L+ A +L+D  +Y+
Sbjct: 86  TAYAQMGALSAAKALYEANDAAGA-KAQLQWTIDHAGDDEYKAVAKLRLAGLLLDEKAYD 144

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE-ELAKDNNSPFGISTRSQ 203
           +   ++     P+            ++A    K  +A+T ++  L K   +        Q
Sbjct: 145 QGLALVSGDVAPAFAALYADRRGDLLAA--QNKKDEARTAYKLALEKFGQADASARQIVQ 202

Query: 204 MILANIIAS 212
             L  +  +
Sbjct: 203 FKLDALGGA 211


>gi|33597410|ref|NP_885053.1| hypothetical protein BPP2853 [Bordetella parapertussis 12822]
 gi|33573837|emb|CAE38145.1| putative membrane protein [Bordetella parapertussis]
          Length = 212

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 70/204 (34%), Gaps = 8/204 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFAQALELFNSNKL 69
            +    +     I  L  L++L+   W       + +    +G  E    A  L  ++  
Sbjct: 14  IRAWWARYGTL-ILTLATLVVLAWGGWSGWKAYQNYRANQAMGYFEALEDAARLGGADAA 72

Query: 70  DDARSSFEKILSQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
              +++   + +      Y     +  A  L ++ D   A E    +A     P A++  
Sbjct: 73  TRIKAAAATLRTDYPATGYAGRGALIAAQALQSQQDVDGAREQLEWLAAQAKQP-ALQPV 131

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+ A IL+D   Y+     L +L+ P         +  G      GK   A+  ++  
Sbjct: 132 ARLRLAGILLDQKQYD---AALAQLNNPPASFAALFADRRGDVLAAQGKRDDARAAWQSA 188

Query: 189 AKDNNSPFGISTRSQMILANIIAS 212
                +   ++   Q+ L  +  +
Sbjct: 189 IDGLGTSNPLTQVVQLKLDALSGA 212


>gi|329297580|ref|ZP_08254916.1| hypothetical protein Pstas_15361 [Plautia stali symbiont]
          Length = 205

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/194 (17%), Positives = 62/194 (31%), Gaps = 6/194 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           SN +      +        K +A  +I+ I +L  W +      E         + Q   
Sbjct: 5   SNENEQVDALRRFFANNG-KALAVAVIVGIAALGGWRFWSSH-QEGADKAASAQYQQLTS 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
               +K      +     S++N  Y  L+ + +A   VA      A  +      D    
Sbjct: 63  AMQVDKPQT-LEAVASFASENNNTYGALAALDLAKQYVAANQLDKAITLLQSGLTDTK-D 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++    L+ A I +  +  +     L  +            +I G + L  G  Q A+
Sbjct: 121 ANLQAVINLRLARIQLQQNQADAALTTLNNVKGDG--WTAIVADIRGEALLSKGDKQGAR 178

Query: 183 TIFEELAKDNNSPF 196
             + + A+   SP 
Sbjct: 179 DAWSKGAESQASPA 192


>gi|54294414|ref|YP_126829.1| hypothetical protein lpl1483 [Legionella pneumophila str. Lens]
 gi|53754246|emb|CAH15723.1| hypothetical protein lpl1483 [Legionella pneumophila str. Lens]
          Length = 224

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 67/178 (37%), Gaps = 6/178 (3%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      K    +  Y  +  + + ++L +   +   +  ++K K      +   +  F
Sbjct: 7   EEEQLEIIKKWWKR--YGNMITIFLSIVLLIIAGYRYMNWHNDKIKQQASIAYENMMIAF 64

Query: 65  NSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
           ++  +   RS   +++   ++ +Y  +++M +A I V+K   + A      VA  +    
Sbjct: 65  SNQNIKSVRSYANELIKNYNHTVYADIAHMTLAKIYVSKNKLEQARNELKAVAA-ESQMT 123

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
            +R  A ++ A +L    +Y      L   +          NE+ G      G+ Q A
Sbjct: 124 PLRQIAKIRIARLLAADKAYTNALNELS--TVEDEAYLPVINELKGDIYSAKGQYQDA 179


>gi|153001516|ref|YP_001367197.1| hypothetical protein Shew185_3003 [Shewanella baltica OS185]
 gi|151366134|gb|ABS09134.1| conserved hypothetical protein [Shewanella baltica OS185]
          Length = 206

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 68/190 (35%), Gaps = 7/190 (3%)

Query: 8   NSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSN 67
           ++ + +    K  +K     + +         Y ++   + K     E  ++A     +N
Sbjct: 5   STEEQQVDAIKQFWKDYGTSIFIGAFVGLGGLYAWNYYSDVKVAQAEEA-SKAFHQLTTN 63

Query: 68  KLDDA--RSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             D+    +   +     D K Y  L  + +A   V   D   A E   KV         
Sbjct: 64  SADETAMLAGVAEFSKSHDQKGYQALLELIVAKTAVEAKDYPKAIEALNKVIAAKP-GAG 122

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +   ATL+ A I  +    +     L++++          +E+ G   ++ G+V+KAKT 
Sbjct: 123 LDVIATLRVARIQAEQGQIDAALATLEQVT--DKAFFAQRDELKGDFLVRQGEVEKAKTA 180

Query: 185 FEELAKDNNS 194
           ++    +   
Sbjct: 181 YQAAMDNGGV 190


>gi|324326239|gb|ADY21499.1| TPR domain protein [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 891

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 71/184 (38%), Gaps = 11/184 (5%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
               K   K I  +   +++ +      +  +   K     E   QA +     K ++A 
Sbjct: 497 STWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQAYDDKKYTKAEEAV 556

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
                + S+D       + + +A+I VA+G  K A +   K+  D         AA L A
Sbjct: 557 GQAIAVKSKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDREIDKENNEAAYLLA 610

Query: 134 ASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           ++       Y+E  +  ++     ++   P  + A   L +S +K  + +KA+ +  +++
Sbjct: 611 SA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMKEFEKAEDVIVKMS 669

Query: 190 KDNN 193
              N
Sbjct: 670 TKTN 673


>gi|229017513|ref|ZP_04174414.1| TPR repeat-containing protein [Bacillus cereus AH1273]
 gi|229023732|ref|ZP_04180221.1| TPR repeat-containing protein [Bacillus cereus AH1272]
 gi|228737529|gb|EEL88036.1| TPR repeat-containing protein [Bacillus cereus AH1272]
 gi|228743837|gb|EEL93938.1| TPR repeat-containing protein [Bacillus cereus AH1273]
          Length = 891

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 71/184 (38%), Gaps = 11/184 (5%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
            K  K   K I  +   +++ +      +  +   K     E   QA +     K ++A 
Sbjct: 497 SKWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQAYDDKKYTKAEEAV 556

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
                +  +D       + + +A+I VA+G  K A +   K+  D         AA L A
Sbjct: 557 GHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDREIDKENNEAAYLLA 610

Query: 134 ASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           ++       Y+E  +  ++     ++   P  + A   L +S +K  + +KA+ +  +++
Sbjct: 611 SA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMEEFEKAEDVIVKMS 669

Query: 190 KDNN 193
              N
Sbjct: 670 TKTN 673


>gi|213649665|ref|ZP_03379718.1| hypothetical protein SentesTy_21640 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
          Length = 202

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 66/175 (37%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL + +L  W Y      E         +  A+   +++K D   ++ EK  +
Sbjct: 23  KALAVGVILGVGALVGWRYWSSHQTES-ARAASLAYQNAVTAVSADKPDSIPAA-EKFAA 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           ++   Y  L++M +A   V K + K A     +          ++    L+ A + +   
Sbjct: 81  ENKNTYGALASMELAQQFVDKNELKKAEAQLQQGLAATS-DENLKAVINLRLARVQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L   +           ++ G + L  G  + A++ +E     + SP 
Sbjct: 140 QADAALKTLD--AVKGEGWTAIVADLRGEALLSKGDKKGARSAWEAGVNSDASPA 192


>gi|223939519|ref|ZP_03631395.1| Tetratricopeptide TPR_2 repeat protein [bacterium Ellin514]
 gi|223891791|gb|EEF58276.1| Tetratricopeptide TPR_2 repeat protein [bacterium Ellin514]
          Length = 254

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 29/171 (16%), Positives = 55/171 (32%), Gaps = 4/171 (2%)

Query: 26  PLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNK 85
            L I +I     ++       E K          +     +        ++ K+ ++   
Sbjct: 29  VLAIAVIGGGIAFYVANKNRQEVKAGEALSELRPSRATPGTQAPSVPPDAYLKVANEHPG 88

Query: 86  -LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
                 + +     L   G  K A   F +   +     A+   A +  A+ L       
Sbjct: 89  TSAGGQALLLAGGALFEAGKFKEAQAQFDRFLGEHG-DSALASQARIGVAASLEAQGEDA 147

Query: 145 EISKILQKL--SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           + +   Q L  S+P++ +   A   L     K GK   A  +++EL K  N
Sbjct: 148 QAAAKYQALISSQPNDSVIPQAKSALARLYEKQGKYADALRLYQELTKQGN 198


>gi|146312648|ref|YP_001177722.1| hypothetical protein Ent638_3007 [Enterobacter sp. 638]
 gi|145319524|gb|ABP61671.1| conserved hypothetical protein [Enterobacter sp. 638]
          Length = 206

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 72/196 (36%), Gaps = 6/196 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  N +      K    +   K +A  +IL + +L  W Y      +        ++   
Sbjct: 3   MYENENDQVDAVKRFFAENG-KALAVGVILGVGALMGWRYWNSHQADS-ARGASLSYENT 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    +++     ++ EK  + +  +Y  L+++ +A   V K +   AA    +  +   
Sbjct: 61  VSAIRADQPQT-LAAAEKFAADNKNIYGALASLEVAQQFVDKNELDKAAAQLQQGLSATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I V     ++  K L  +            ++ G + L  G  Q 
Sbjct: 120 DDN-LKAVINLRLARIQVQQKKADDALKTLDTIKGEG--FAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPF 196
           A++ +E   K N SP 
Sbjct: 177 ARSAWESGVKSNASPA 192


>gi|119897220|ref|YP_932433.1| hypothetical protein azo0929 [Azoarcus sp. BH72]
 gi|119669633|emb|CAL93546.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 214

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 67/178 (37%), Gaps = 8/178 (4%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIAS 97
           +  +     ++    G  +    +         AR    +++ Q    +Y  L  +  A 
Sbjct: 40  WQGWRWYQNRQAAEAGGLYFAVQQAVTQQDAQKARELTGRLIDQFGGTVYAQLGALVSAG 99

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
           +  +KGD  NA       A       ++R  A L+ A++L+   ++++    LQ+  EP 
Sbjct: 100 LQFSKGDLDNARAPLEWAAGQGK-DESLRDLARLRLAAVLLQQGAHDQALAQLQR--EPG 156

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFE----ELAKDNNSPFGISTRSQMILANIIA 211
                   ++ G +    GK   A+T ++     L  + +    +    ++ L ++ A
Sbjct: 157 KAYRARFADLRGDALAAQGKAADARTAYQAAITALEAEGDEAAMLREVVRVKLESLEA 214


>gi|119357636|ref|YP_912280.1| TPR repeat-containing protein [Chlorobium phaeobacteroides DSM 266]
 gi|119354985|gb|ABL65856.1| TPR repeat-containing protein [Chlorobium phaeobacteroides DSM 266]
          Length = 3560

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 51   NIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
            N       +AL+L    +LD+A + + +ILS   + ++ L     A+I   + D++ A  
Sbjct: 2901 NEESVKLQRALKLHQEGRLDEAEALYREILSSSPEHFDAL--RLSATIAAQRHDSEKALA 2958

Query: 111  IFLKVAN 117
            +F +   
Sbjct: 2959 LFDQALA 2965



 Score = 43.8 bits (102), Expect = 0.015,   Method: Composition-based stats.
 Identities = 15/68 (22%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 48  KKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKN 107
              N       +AL+     +LD+A + + +ILS   + ++ L     A+I   + + + 
Sbjct: 10  GSTNEESVKLQRALKFHQEGRLDEAEALYREILSSSPEHFDAL--QLSATIAAQRHEFEK 67

Query: 108 AAEIFLKV 115
           A  +F +V
Sbjct: 68  AVTLFDQV 75



 Score = 41.5 bits (96), Expect = 0.074,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 48/130 (36%), Gaps = 19/130 (14%)

Query: 56   NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
               +AL+L    +LD+A + + +ILS   + ++ L     A+I   + D++ A  +F + 
Sbjct: 1479 KLQRALKLHQEGRLDEAEALYREILSFSPEHFDAL--QLSATIAAQRHDSEKALVLFDQA 1536

Query: 116  ANDDLA--------PLAVRYAATLQAASILVDTSSYEEISKI----LQKLSEPSNPMHQF 163
                           +A++       A       SYE    +    ++  S   N + + 
Sbjct: 1537 LAIKPDHARSLNNRGIALQELKRYDEAL-----ESYERAIAVKPDFIEPYSNRGNTLQEL 1591

Query: 164  ANEILGISAL 173
                  ++  
Sbjct: 1592 KRYEEALACY 1601



 Score = 36.5 bits (83), Expect = 2.7,   Method: Composition-based stats.
 Identities = 13/62 (20%), Positives = 26/62 (41%), Gaps = 2/62 (3%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
              +AL+L    +LD+A     +IL      +  L     A+I + +  ++ A  +F + 
Sbjct: 800 KLQRALKLHQEGRLDEAELFCTEILRFKPGYFEVL--QLSATIALQRKASEKAVALFDQA 857

Query: 116 AN 117
             
Sbjct: 858 LA 859



 Score = 35.0 bits (79), Expect = 8.3,   Method: Composition-based stats.
 Identities = 25/145 (17%), Positives = 50/145 (34%), Gaps = 22/145 (15%)

Query: 56   NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
               +AL+L    +LD+A   +++ILS        L  +  AS+   +    +A  +F + 
Sbjct: 2227 KLQRALKLHQEGRLDEAEVIYQEILSIQPLHIEALQFL--ASMATRRKKYTDAVSLFERA 2284

Query: 116  AN-DDLAPL-------AVRYAATLQAASILVDTSSYEEIS----KILQKLSEPSNPMHQF 163
               D   P+       A+      + A      +SYE+        ++  S   N     
Sbjct: 2285 LEIDPDHPVSWCTLGIALHELGRYEEAL-----ASYEKAIVLYPGFVEVYSNRGNTFLIL 2339

Query: 164  ANEILGISALK---FGKVQKAKTIF 185
                  +S+ +       +  +  F
Sbjct: 2340 KRYQEALSSYEKALAINPEYTRAYF 2364


>gi|241761936|ref|ZP_04760021.1| cellulose synthase operon C domain protein [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373616|gb|EER63188.1| cellulose synthase operon C domain protein [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 1334

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 32/169 (18%), Positives = 61/169 (36%), Gaps = 20/169 (11%)

Query: 40  YLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASIL 99
             +  ++          F +A     +N+LD A+S  E++ +Q       +SN  +A I 
Sbjct: 203 EGYHWANALSSARFYGRFEEAQAASRANQLDKAQSILEQLQNQ-QGGDANVSNALLADIY 261

Query: 100 VAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA------ASILVDTSSYEEISK--ILQ 151
             +G    A  ++ K+ N   A       A L++      A   +    Y    +     
Sbjct: 262 ARQGQFDKAMALYDKLGNSADAVT----VARLRSQENSIKARRALSQGDYAHAEQYFRTA 317

Query: 152 KLSEPSNPMHQF--ANEILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
             ++ +NP  +   A  +L     K G   +A ++   L    +S   I
Sbjct: 318 IANDIANPWLRLDYARLLL-----KEGHRPEAVSLIRPLEDQASSEEAI 361


>gi|157961135|ref|YP_001501169.1| tetratricopeptide repeat-containing protein [Shewanella pealeana
           ATCC 700345]
 gi|157846135|gb|ABV86634.1| tetratricopeptide TPR_4 [Shewanella pealeana ATCC 700345]
          Length = 206

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 61/160 (38%), Gaps = 8/160 (5%)

Query: 37  IWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDA-RSSFEKILSQ-DNKLYNPLSNMY 94
             +  +      +     E+F     L + N  D A  ++ E    Q   K Y  L  + 
Sbjct: 37  FGWNYYSDYQVAQAEAASESFQA---LSSQNTADTAMLTAAENFAKQHGQKGYQSLLELL 93

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLS 154
           +A   V  GD          V   +    ++   AT++ A +  +   Y      L++++
Sbjct: 94  VAKSAVESGDLAKGEVTLKNVIATN-VDNSIVLIATMRLARVQAELGQYATAITTLEQIT 152

Query: 155 EPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
           +P++      +E+ G   ++ G+ +KAK  ++    +  +
Sbjct: 153 DPAS--KAQRDELKGDFLVRQGETEKAKVAYQTAVDNGGT 190


>gi|90410875|ref|ZP_01218889.1| hypothetical protein P3TCK_14620 [Photobacterium profundum 3TCK]
 gi|90328088|gb|EAS44399.1| hypothetical protein P3TCK_14620 [Photobacterium profundum 3TCK]
          Length = 203

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 61/172 (35%), Gaps = 3/172 (1%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
             L  ++ L     +  + G  +  K +  + ++Q +   +S   +        I + ++
Sbjct: 25  VVLGAVIGLGGLYGWRYYQGEVQTTKELTSDAYSQVMTTLDSGSENAVADVQAFISANES 84

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y+ L+ + +A   V  GD   A +      +      A+   A  + A I  +   ++
Sbjct: 85  SQYSVLAALQLAKTQVELGDLDGAIKQLTWAISQTK-DQAILPLAQTRLARIYAEQQKFD 143

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           E    L K++           E+ G   L  G +  A+  +    +   SP 
Sbjct: 144 EALAELDKVTA--TSWQSKIAELRGDILLLKGDIIAARNAYISAQQLGASPA 193


>gi|307610242|emb|CBW99803.1| hypothetical protein LPW_15661 [Legionella pneumophila 130b]
          Length = 224

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 67/178 (37%), Gaps = 6/178 (3%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      K    +  Y  +  + + ++L +   +   +  ++K K      +   +  F
Sbjct: 7   EEEQLEIIKKWWKR--YGNMITIFLSIVLLIIAGYRYMNWHNDKIKQQASIAYENMMIAF 64

Query: 65  NSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
           ++  +   RS   +++   ++ +Y  +++M +A I V+K   + A      VA  +    
Sbjct: 65  SNQNIKSVRSYANELIKNYNHTVYADIAHMTLAKIYVSKNKLEQARNELKAVAA-ESQMT 123

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
            +R  A ++ A +L    +Y      L   +          NE+ G      G+ Q A
Sbjct: 124 PLRQIAKIRIARLLAADKAYTNALNELS--AVEDEAYLPVINELKGDIYSAKGQYQDA 179


>gi|160876252|ref|YP_001555568.1| hypothetical protein Sbal195_3146 [Shewanella baltica OS195]
 gi|160861774|gb|ABX50308.1| conserved hypothetical protein [Shewanella baltica OS195]
 gi|315268441|gb|ADT95294.1| Protein of unknown function DUF2133 [Shewanella baltica OS678]
          Length = 206

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 34/192 (17%), Positives = 62/192 (32%), Gaps = 6/192 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  +      K               +  +  L  W Y  D    + +           +
Sbjct: 5   STEEQQVDAIKQFWKDYGTSIFIGAFV-GLGGLYAWNYYSDVKVAQAEEASKAFHELTTK 63

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +   +    + F K  S D K Y  L  + +A   V   D   A E   KV       
Sbjct: 64  SADETAMLAGVAEFSK--SHDQKGYQALLELIVAKTAVEAKDYPKAIEALNKVIAAKP-G 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   ATL+ A I  +    +     L++++          +E+ G   ++ G+V+KAK
Sbjct: 121 AGLDVIATLRVARIQAEQGQIDAALATLEQVT--DKAFFAQRDELKGDFLVRQGEVEKAK 178

Query: 183 TIFEELAKDNNS 194
           T ++    +   
Sbjct: 179 TAYQAAMDNGGV 190


>gi|328952453|ref|YP_004369787.1| hypothetical protein Desac_0726 [Desulfobacca acetoxidans DSM
           11109]
 gi|328452777|gb|AEB08606.1| hypothetical protein Desac_0726 [Desulfobacca acetoxidans DSM
           11109]
          Length = 224

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 69/177 (38%), Gaps = 7/177 (3%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            +   + I     ++I++ A W Y+     ++++      F QA     S+ + D     
Sbjct: 31  ARKNLRTIVIGFAVIIVAGAAWGYIQKRQMDRQERAA--EFYQASVGRASSHVPDLLKEL 88

Query: 77  EKILSQDNKLYNPL-SNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAAS 135
           E I+         L + +Y+A++L  +   + AA  F  +     A   +R       + 
Sbjct: 89  EIIIQDYPDTGGALQARLYLANVLFGERRYQEAAAAFTALGE---AAPELRVLVAENLSY 145

Query: 136 ILVDTSSYEEISKILQKLSEPSN-PMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
                  Y++ S +L+ L +  N P  Q       +     G+  KA  +F+++ ++
Sbjct: 146 CYEAQKEYQKASAVLEPLVQDKNLPYRQELQRRQALLYELGGEPAKALKVFKQMLEE 202


>gi|238650407|ref|YP_002916259.1| hypothetical protein RPR_01670 [Rickettsia peacockii str. Rustic]
 gi|238624505|gb|ACR47211.1| hypothetical protein RPR_01670 [Rickettsia peacockii str. Rustic]
          Length = 220

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/169 (16%), Positives = 67/169 (39%), Gaps = 6/169 (3%)

Query: 48  KKKNIVGENFAQALELFNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           K     G+   + + L  +   ++ A ++ E +++  N     ++ +   +I ++K    
Sbjct: 51  KNNQKNGDILVKTVGLETTKDNEELAFNTLENLVTTSNTKIKEIAALEQVAIKISKKKYS 110

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDT-----SSYEEISKILQKLSEPSNPMH 161
            A ++  K+  +          A +   S+++D         E+++K L    +   P  
Sbjct: 111 EAKDLLNKIIENKEYSEISTSYARISWCSLVIDDHNLDIQDKEKLTKYLNYFDDEKKPFW 170

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
             A  I  +  +K     +A+T  + L   NN    I  +++ +L N+ 
Sbjct: 171 ATATIIKAMWDIKNNMKPQAETNLKNLLISNNISDLIKDQAKALLVNLN 219


>gi|294637687|ref|ZP_06715965.1| putative membrane protein [Edwardsiella tarda ATCC 23685]
 gi|291089163|gb|EFE21724.1| putative membrane protein [Edwardsiella tarda ATCC 23685]
          Length = 206

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 57/161 (35%), Gaps = 5/161 (3%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
           +L  W Y  +           + + QA E  +  K D   +  E  + ++   Y  L+ +
Sbjct: 35  ALFGWRYWANHQQAGMAQ-ASQTYQQASEALSGGKQD-GVALSEAFIKENANNYGVLAAL 92

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
            +A   V K +   A       A        ++  + L+ A + +  +  +   K L  +
Sbjct: 93  QLAQHEVDKAEFSKAQSQL-AWAAGQAKDENLKALSDLRLARVQLQDNQLDAALKTLDGV 151

Query: 154 SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
           +         A ++ G   LK G  + A+  + +   +  S
Sbjct: 152 TAKG--WQALAQDVRGDVLLKKGDAKGAREAYSKGLAEGAS 190


>gi|229586479|ref|YP_002844980.1| hypothetical protein RAF_ORF0291 [Rickettsia africae ESF-5]
 gi|228021529|gb|ACP53237.1| Unknown [Rickettsia africae ESF-5]
          Length = 220

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 27/169 (15%), Positives = 66/169 (39%), Gaps = 6/169 (3%)

Query: 48  KKKNIVGENFAQALELFNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           K     G+   + + L  +   ++ A ++ E +++  N     ++ +   +I ++K    
Sbjct: 51  KNNQKNGDILVKTVGLETTKDNEELAFNTLENLVTTSNTKIKEIAALEQVAIKISKKQYS 110

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDT-----SSYEEISKILQKLSEPSNPMH 161
            A ++  K+  +          A +   S+++D         E+++K L    +   P  
Sbjct: 111 EAKDLLNKIIENKEYSEISTSYARISWCSLVIDDHNLDIQDKEKLTKYLNYFDDEKKPFW 170

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
             A  I  +  +K     +A+   + L   NN    I  +++ +L N+ 
Sbjct: 171 ATATIIKAMWNIKNNMKSQAEKNLKNLLISNNVSDLIKDQAKALLVNLN 219


>gi|221133870|ref|ZP_03560175.1| putative membrane-associated protein with TPR-like domain
           [Glaciecola sp. HTCC2999]
          Length = 212

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 42/215 (19%), Positives = 67/215 (31%), Gaps = 10/215 (4%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  +      K          I    +L + +L  W Y  D     K+    E       
Sbjct: 5   ATEEQQVEAIKKFWKDNGSAIIIG-AVLGLGALWGWRYYTDTQIMTKETASTEYQTLVTS 63

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L     LD+A +    I +Q    Y PL+    A   V K D   A      +       
Sbjct: 64  LSEDAALDEATAF---ITAQGETGYAPLAGFIAAQAAVEKADFPAAISQLQNITTLTN-D 119

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL-GISALKFGKVQKA 181
             +   A L+ A +   T  Y   +  L  L+  +N       E L G   +  G   +A
Sbjct: 120 AVLLNVANLRLARVQFATVDY---TAALTSLNNVTNEAFIADKEALRGDILVAQGDFAQA 176

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           ++ +   +   N    +  R   I A I A+    
Sbjct: 177 QSAYTA-SLAANDDRSVQIRLDNIGAMIDAAADAT 210


>gi|258545536|ref|ZP_05705770.1| UDP-N-acetylglucosamine-peptide-n-acetylglucosaminyltransferase
           [Cardiobacterium hominis ATCC 15826]
 gi|258519236|gb|EEV88095.1| UDP-N-acetylglucosamine-peptide-n-acetylglucosaminyltransferase
           [Cardiobacterium hominis ATCC 15826]
          Length = 925

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/145 (17%), Positives = 55/145 (37%), Gaps = 4/145 (2%)

Query: 53  VGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
               F   + L    K ++A + +  I   D+      +   +  IL A+ D+  A   +
Sbjct: 43  AKAQFNLGVALRKQGKTEEAIAVYRSIKRTDSPELYADARFNLGFILRAQNDSAGAIAAY 102

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNP-MHQFANEILGIS 171
             +  +      +   A L  +  L +     +     + +    +P ++  A   LG++
Sbjct: 103 RSI--ERADSPELYAKAQLYLSITLEEQGDSADAIAAYRNIERTDSPELYAEAQFNLGVA 160

Query: 172 ALKFGKVQKAKTIFEELAKDNNSPF 196
             K GK ++A  ++  + K  +SP 
Sbjct: 161 LRKQGKTEEAIAVYRSI-KRTDSPE 184



 Score = 45.4 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 28/157 (17%), Positives = 56/157 (35%), Gaps = 3/157 (1%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
            F   + L    K ++A + +  I   D+      +   +   L  +G T+ A   +  +
Sbjct: 154 QFNLGVALRKQGKTEEAIAVYRSIKRTDSPELYAEARFNLGVALQEQGKTEEAIAAYRSI 213

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
              D  P     A       +       E I+         S+  +  +   LGI   K 
Sbjct: 214 ERTDS-PELYAKAQFNLGVVLQKQDKIKEAIAAYRNTERTDSSEQYAKSQLNLGIVLQKQ 272

Query: 176 GKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           GK++ A   F  + +  +SP  +  R+++ L   + +
Sbjct: 273 GKIKGAIAAFRSI-ERTDSPE-LYARARIYLGITLGA 307



 Score = 40.4 bits (93), Expect = 0.18,   Method: Composition-based stats.
 Identities = 28/162 (17%), Positives = 52/162 (32%), Gaps = 4/162 (2%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYI 95
           AI  Y      +  +          + L    K+  A ++F  I   D+      + +Y+
Sbjct: 242 AIAAYRNTERTDSSEQYAKSQLNLGIVLQKQGKIKGAIAAFRSIERTDSPELYARARIYL 301

Query: 96  ASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSE 155
              L A+GD+  A   +  +     +P      A       L +    E+     + +  
Sbjct: 302 GITLGAQGDSAGAIAAYRSI-EHTDSPDLYAE-ARFNLGVTLREQDKIEDAIAAYRSIER 359

Query: 156 PSNPMHQF-ANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +P     A   LGI     G    A   +  + +  +SP 
Sbjct: 360 TDSPEQYAKAQVNLGIDLGAQGDNAGAIAAYRSI-ERTDSPE 400



 Score = 39.2 bits (90), Expect = 0.44,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 54/145 (37%), Gaps = 4/145 (2%)

Query: 53  VGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
               F     L   N    A +++  I   D+      + +Y++  L  +GD+ +A   +
Sbjct: 79  ADARFNLGFILRAQNDSAGAIAAYRSIERADSPELYAKAQLYLSITLEEQGDSADAIAAY 138

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNP-MHQFANEILGIS 171
             +   D  P      A       L      EE   + + +    +P ++  A   LG++
Sbjct: 139 RNIERTDS-PELYAE-AQFNLGVALRKQGKTEEAIAVYRSIKRTDSPELYAEARFNLGVA 196

Query: 172 ALKFGKVQKAKTIFEELAKDNNSPF 196
             + GK ++A   +  + +  +SP 
Sbjct: 197 LQEQGKTEEAIAAYRSI-ERTDSPE 220



 Score = 38.4 bits (88), Expect = 0.64,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 51/149 (34%), Gaps = 3/149 (2%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
           + AI  Y      +  +         ++ L       DA +++  I   D+      +  
Sbjct: 96  AGAIAAYRSIERADSPELYAKAQLYLSITLEEQGDSADAIAAYRNIERTDSPELYAEAQF 155

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
            +   L  +G T+ A  ++  +   D  P      A       L +    EE     + +
Sbjct: 156 NLGVALRKQGKTEEAIAVYRSIKRTDS-PELYAE-ARFNLGVALQEQGKTEEAIAAYRSI 213

Query: 154 SEPSNP-MHQFANEILGISALKFGKVQKA 181
               +P ++  A   LG+   K  K+++A
Sbjct: 214 ERTDSPELYAKAQFNLGVVLQKQDKIKEA 242



 Score = 38.4 bits (88), Expect = 0.74,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 26/82 (31%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
           +  I  Y      + K+      F   + L        A +++  I   D+  +   +  
Sbjct: 420 AGEIVAYRSIRRKDSKEAYAKARFNLGITLRVQGDSAGAIAAYRSIKRTDSPEWYAKARF 479

Query: 94  YIASILVAKGDTKNAAEIFLKV 115
            +   L  +G  K A   +  +
Sbjct: 480 NLGVALQKQGKAKEAVAAYRSI 501



 Score = 38.0 bits (87), Expect = 0.79,   Method: Composition-based stats.
 Identities = 21/154 (13%), Positives = 47/154 (30%), Gaps = 3/154 (1%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYI 95
           AI  Y      +  +          ++L        A +++  I   D+      + + +
Sbjct: 350 AIAAYRSIERTDSPEQYAKAQVNLGIDLGAQGDNAGAIAAYRSIERTDSPEQYAKAQLCL 409

Query: 96  ASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSE 155
              L  +GD+      +  +   D      +  A       L             + +  
Sbjct: 410 GITLGTQGDSAGEIVAYRSIRRKDSKEAYAK--ARFNLGITLRVQGDSAGAIAAYRSIKR 467

Query: 156 PSNP-MHQFANEILGISALKFGKVQKAKTIFEEL 188
             +P  +  A   LG++  K GK ++A   +  +
Sbjct: 468 TDSPEWYAKARFNLGVALQKQGKAKEAVAAYRSI 501


>gi|145636362|ref|ZP_01792031.1| co-chaperone HscB [Haemophilus influenzae PittHH]
 gi|145270527|gb|EDK10461.1| co-chaperone HscB [Haemophilus influenzae PittHH]
          Length = 204

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 57/196 (29%), Gaps = 15/196 (7%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVSGMFGWRYWQAHQAEQIAQASAQYDTLI 61

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            +++     K  +     + + +     Y   + +  A     K D   A     + A  
Sbjct: 62  NSVQQDEQAKKANIE---QFVQANSKTAYAVFALLDEAKKATEKQDFSAAEANLNQ-ALT 117

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFG 176
                 +     L+ +++       +     L ++   S      A + +  G   +  G
Sbjct: 118 QSQDEVLTSIVALRLSAVQFQLGQLDNALSTLNQVKGES----FNARKAILTGDIQVAKG 173

Query: 177 KVQKAKTIFEELAKDN 192
               AK  FE+  +  
Sbjct: 174 DKVAAKNSFEQAQQSG 189


>gi|311113427|ref|YP_003984649.1| hypothetical protein HMPREF0733_11758 [Rothia dentocariosa ATCC
           17931]
 gi|310944921|gb|ADP41215.1| conserved hypothetical protein [Rothia dentocariosa ATCC 17931]
          Length = 792

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 60/164 (36%), Gaps = 7/164 (4%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
           ++  W  +    + +       N   A    +  KLD+A +++ K+   D+      + +
Sbjct: 176 AITTWSNIHHNDNPQAYAGAQRNLGNAYH--DQGKLDEAIAAWSKVRHSDDPQAYASAQL 233

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
            + +    +G    A   +  + ++D  P A    A L       D    E+      K+
Sbjct: 234 GLGNAYKDQGKLDEAITTWSNIHHNDN-PQAY-AWAQLGLGVAYHDQGEPEQAIAAWSKV 291

Query: 154 SEPSNPMHQF-ANEILGISALKFGKVQKAKTIFEEL--AKDNNS 194
               +P     A   LG++    G+ ++A   + ++  + D  +
Sbjct: 292 RHSDDPKAYAWAQYSLGVAYHDQGEPEQAIAAWSKVRHSDDPKA 335



 Score = 40.0 bits (92), Expect = 0.27,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 49/133 (36%), Gaps = 5/133 (3%)

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +  KLD+A +++  I   D+      + + + +    +G    A   +  + + +  P A
Sbjct: 97  DQGKLDEAITTWSNIHHNDDPQAYAWAQLGLGNAYKDQGKLDEAITTWSNI-HHNDDPQA 155

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF-ANEILGISALKFGKVQKAKT 183
               A L   +   D    +E       +    NP     A   LG +    GK+ +A  
Sbjct: 156 YAS-AQLGLGNAYHDQGKLDEAITTWSNIHHNDNPQAYAGAQRNLGNAYHDQGKLDEAIA 214

Query: 184 IFEEL--AKDNNS 194
            + ++  + D  +
Sbjct: 215 AWSKVRHSDDPQA 227



 Score = 39.6 bits (91), Expect = 0.27,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 55/164 (33%), Gaps = 7/164 (4%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
           ++  W  +    ++  +              +  KLD+A +++  I   DN      +  
Sbjct: 140 AITTWSNIHH--NDDPQAYASAQLGLGNAYHDQGKLDEAITTWSNIHHNDNPQAYAGAQR 197

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
            + +    +G    A   + KV      P A    A L   +   D    +E       +
Sbjct: 198 NLGNAYHDQGKLDEAIAAWSKV-RHSDDPQAYAS-AQLGLGNAYKDQGKLDEAITTWSNI 255

Query: 154 SEPSNPMHQF-ANEILGISALKFGKVQKAKTIFEEL--AKDNNS 194
               NP     A   LG++    G+ ++A   + ++  + D  +
Sbjct: 256 HHNDNPQAYAWAQLGLGVAYHDQGEPEQAIAAWSKVRHSDDPKA 299



 Score = 36.5 bits (83), Expect = 2.4,   Method: Composition-based stats.
 Identities = 22/145 (15%), Positives = 49/145 (33%), Gaps = 3/145 (2%)

Query: 45  SHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
             +  K          L   +  +LD   +++ K+   D+      + + + +    +G 
Sbjct: 41  RDDNPKAYAWAQLNLGLAYESPGELDQVIAAWSKVRHSDDPKAYAWAQLGLGNAYKDQGK 100

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNP-MHQF 163
              A   +  + + +  P A    A L   +   D    +E       +    +P  +  
Sbjct: 101 LDEAITTWSNI-HHNDDPQAY-AWAQLGLGNAYKDQGKLDEAITTWSNIHHNDDPQAYAS 158

Query: 164 ANEILGISALKFGKVQKAKTIFEEL 188
           A   LG +    GK+ +A T +  +
Sbjct: 159 AQLGLGNAYHDQGKLDEAITTWSNI 183


>gi|303250431|ref|ZP_07336629.1| hypothetical protein APP6_1846 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307252216|ref|ZP_07534113.1| UDP-N-acetylglucosamine-peptide-n- acetylglucosaminyltransferase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|302650757|gb|EFL80915.1| hypothetical protein APP6_1846 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306860138|gb|EFM92154.1| UDP-N-acetylglucosamine-peptide-n- acetylglucosaminyltransferase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
          Length = 457

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 64/169 (37%), Gaps = 5/169 (2%)

Query: 45  SHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
             +  K          + L    K+D+A  ++  +  +D+      + + I   L  +G 
Sbjct: 32  QEDDVKQYARAQLNIGIILGKQGKVDEAIVAYRNVNREDSVESYARAQLNIGITLGEQGK 91

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE-EISKILQKLSEPSNPMHQF 163
              A   +  V  +D A    +  A L    IL +    + EI        E S   +  
Sbjct: 92  VDEALVAYRNVNREDSAEQYAK--AQLNIGIILGEQGKIDEEIEAYYNVTREDSAEQYAI 149

Query: 164 ANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           A   LGI+  K GKV +A   +  + +++++   +  R+Q+ L   +  
Sbjct: 150 AQVNLGIALGKQGKVDQALVAYRNVNREDSA--EVYVRAQINLGITLGE 196



 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 60/160 (37%), Gaps = 3/160 (1%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYI 95
           AI  Y      +  ++         + L    K+D+A  ++  +  +D+      + + I
Sbjct: 59  AIVAYRNVNREDSVESYARAQLNIGITLGEQGKVDEALVAYRNVNREDSAEQYAKAQLNI 118

Query: 96  ASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE-ISKILQKLS 154
             IL  +G      E +  V  +D A       A +     L      ++ +        
Sbjct: 119 GIILGEQGKIDEEIEAYYNVTREDSAEQY--AIAQVNLGIALGKQGKVDQALVAYRNVNR 176

Query: 155 EPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
           E S  ++  A   LGI+  + GK  +A   F  +++++++
Sbjct: 177 EDSAEVYVRAQINLGITLGEQGKFDEAIAAFNNVSREDST 216



 Score = 42.7 bits (99), Expect = 0.036,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 65/181 (35%), Gaps = 10/181 (5%)

Query: 43  DGSHEKKKNIVGENFAQA-----LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
           +  +   +    E +A A     + L    K+D A  ++  +  +D+      + + +  
Sbjct: 133 EAYYNVTREDSAEQYAIAQVNLGIALGKQGKVDQALVAYRNVNREDSAEVYVRAQINLGI 192

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE-ISKILQKLSEP 156
            L  +G    A   F  V+ +D     +   A +     L      +E I        E 
Sbjct: 193 TLGEQGKFDEAIAAFNNVSREDS--TELYAIAQVNLGITLRKQGRGDEAIVAYRNVNRED 250

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           S  ++     +LG+      K+ +A+  F  +   ++    + T++Q+ L  +    +  
Sbjct: 251 SAKLYVKVQFLLGLIFESQDKLDEARDAFNNIRLSDSV--ELYTKAQVYLKVLNIGKKEI 308

Query: 217 K 217
           +
Sbjct: 309 R 309


>gi|238752473|ref|ZP_04613949.1| hypothetical protein yrohd0001_22450 [Yersinia rohdei ATCC 43380]
 gi|238709322|gb|EEQ01564.1| hypothetical protein yrohd0001_22450 [Yersinia rohdei ATCC 43380]
          Length = 206

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 69/188 (36%), Gaps = 6/188 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y     +          + QA +  ++N   D  +  EK + 
Sbjct: 23  KALAVGVVLGIGALVGWRYWQSNQNTAMTEASS-AYQQASDALSAN-SADGVALAEKFVQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y  L+ + +A   V + +   AA+   +          +     L+ A + +   
Sbjct: 81  GNKNNYGVLAGLELAHHFVEQNEFDKAAQQLTQALGQTKDENLL-SLINLRLARLQLQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             +E  K L   +         A ++ G   L  G    A+  + +   ++N+   +   
Sbjct: 140 KPDEALKTLD--AVQGEGWTAMAQDVRGDVLLSKGDTAGARAAYSK-GIESNASQALQAL 196

Query: 202 SQMILANI 209
            +M L N+
Sbjct: 197 LRMKLNNL 204


>gi|261856342|ref|YP_003263625.1| thioredoxin [Halothiobacillus neapolitanus c2]
 gi|261836811|gb|ACX96578.1| thioredoxin [Halothiobacillus neapolitanus c2]
          Length = 287

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 56/159 (35%), Gaps = 9/159 (5%)

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
           QA E  ++  +++A    ++  + +    + L ++  A I+   GD   A +I   +  D
Sbjct: 122 QAREQADAGAIEEAIDLLKQANAIEPNNADVLIDL--AEIISKTGDHDQAMQIIDALPID 179

Query: 119 DLAPLAVRYA-ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
                 V+   A +  A    D  S E++   ++      +     A E L         
Sbjct: 180 VATRKDVKELKARIHLAQHAGDGPSVEDLKARIEADDNDLD-----AREQLASRCAMMQD 234

Query: 178 VQKA-KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
            + A    F  + +D         R  + +  ++ SD  
Sbjct: 235 YECALAQFFAIMQRDRQFKDDAGRRGLLDIFELLGSDHA 273


>gi|260752475|ref|YP_003225368.1| cellulase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258551838|gb|ACV74784.1| Cellulase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 1667

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 58/153 (37%), Gaps = 20/153 (13%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
            F +A     +N+LD A+S  E++ +Q       +SN  +A I   +G    A  ++ K+
Sbjct: 219 RFEEAQAASRANQLDKAQSILEQLQNQ-QGGDANVSNALLADIYARQGQFDKAMALYDKL 277

Query: 116 ANDDLAPLAVRYAATLQA------ASILVDTSSYEEISK--ILQKLSEPSNPMHQF--AN 165
            N   A       A L++      A   +    Y    +       ++ +NP  +   A 
Sbjct: 278 GNSADAVT----VARLRSQENSIKARRALSQGDYAHAEQYFRTAIANDIANPWLRLDYAR 333

Query: 166 EILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
            +L     K G   +A ++   L    +S   I
Sbjct: 334 LLL-----KEGHRPEAVSLIRPLEDQASSEEAI 361


>gi|218548050|ref|YP_002381841.1| hypothetical protein EFER_0659 [Escherichia fergusonii ATCC 35469]
 gi|218355591|emb|CAQ88202.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
 gi|324113007|gb|EGC06983.1| yfgM [Escherichia fergusonii B253]
 gi|325496454|gb|EGC94313.1| hypothetical protein ECD227_0551 [Escherichia fergusonii ECD227]
          Length = 206

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 68/175 (38%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL + +L  W Y      E  ++     +  A+   ++ K  +     EK ++
Sbjct: 23  KALAVGVILGVGALIGWRYWNSHQVETARS-ASLAYQNAVTEASAGKP-EGIVVAEKFVT 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           ++   Y  L+++ +A   V K + + A     +      +   ++    L+ A + V   
Sbjct: 81  ENKNTYGALASLELAQQFVDKNELQKAEAQLQQ-GLTATSDENLKAVINLRLARVQVQLK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L  +            ++ G + L  G  Q A++ +E   K + SP 
Sbjct: 140 QADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQGARSAWEAGVKSDASPA 192


>gi|301060387|ref|ZP_07201250.1| tetratricopeptide repeat protein [delta proteobacterium NaphS2]
 gi|300445583|gb|EFK09485.1| tetratricopeptide repeat protein [delta proteobacterium NaphS2]
          Length = 785

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 58/173 (33%), Gaps = 16/173 (9%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ---------ALELFNSNKLDDARS 74
            + +  L++L    W+     S  +     G              A  L    + D+A  
Sbjct: 381 FSGMACLIVLGGLAWWQAGYWSDSETLFRHGLQVVPNNYVAHNGLARALEAQGETDEAIR 440

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
            FE  L               A IL A G  + A E +L V   +  P  V+  A +  A
Sbjct: 441 HFETALRICPGF--TDGRYNFARILAANGKKREATEQYLSVL--ESDPGFVQ--AHVNLA 494

Query: 135 SILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           +IL D     E  K  +K +   N  +  A   L  +  + G+   A   + +
Sbjct: 495 NILADQGYLNEAVKHYEK-ALTLNRENANARYNLANTFFRAGRTDDAIAQYRK 546



 Score = 40.4 bits (93), Expect = 0.17,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 48/132 (36%), Gaps = 7/132 (5%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
            +  A  L  + K  +A   +  +L  D       +++ +A+IL  +G    A + + K 
Sbjct: 456 RYNFARILAANGKKREATEQYLSVLESDPGF--VQAHVNLANILADQGYLNEAVKHYEKA 513

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
              +         A    A+        ++     +K +    P     +  LG + ++ 
Sbjct: 514 LTLNRENAN----ARYNLANTFFRAGRTDDAIAQYRK-ALDIRPNDPSIHYNLGNAYMRN 568

Query: 176 GKVQKAKTIFEE 187
           G  ++A + + E
Sbjct: 569 GNFEQAVSQYSE 580



 Score = 38.8 bits (89), Expect = 0.58,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 34/96 (35%), Gaps = 4/96 (4%)

Query: 49  KKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNA 108
           +       F   L L NS +  +    F  I  Q    +   + + +A  L  +G T  A
Sbjct: 653 QPEDATARFQLGLILSNSGRHSEGEEQF-SIALQIKPNF-VEARIALADELAVQGKTSEA 710

Query: 109 AEIFLKVANDDLA--PLAVRYAATLQAASILVDTSS 142
              + +    + A  P+     A L A    V+ S+
Sbjct: 711 VAHYNEAMKMNPAVKPMVYYNLACLYALQHKVEEST 746


>gi|261345332|ref|ZP_05972976.1| putative membrane protein [Providencia rustigianii DSM 4541]
 gi|282566666|gb|EFB72201.1| putative membrane protein [Providencia rustigianii DSM 4541]
          Length = 207

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 61/186 (32%), Gaps = 8/186 (4%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +N +      K          +  L+I  +  +  W Y                +     
Sbjct: 5   TNENDQVDAVKRFFANNGVALVIGLVI-GVGGVFGWNYWQSHKSNV-LQESAAKYESVST 62

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF-LKVANDDLA 121
             ++        + +K  ++ + +Y+ +  + +A + V KGD  +A +     +A     
Sbjct: 63  QLHTG-SAQGIEAAKKFAAETDDVYSAMMGLELAQVSVDKGDLASADKALTDALAKAKTV 121

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              ++    L+ A + +   + +     + K+          A ++ G + L  G    A
Sbjct: 122 D--MQDVINLRLARVQLAQGNADAALASIAKI--QGKSWQAAAQDVRGDALLHKGDKSGA 177

Query: 182 KTIFEE 187
           K  + +
Sbjct: 178 KAAYTQ 183


>gi|197120109|ref|YP_002140536.1| TPR domain-containing protein [Geobacter bemidjiensis Bem]
 gi|197089469|gb|ACH40740.1| TPR domain protein [Geobacter bemidjiensis Bem]
          Length = 1450

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 29/144 (20%), Positives = 59/144 (40%), Gaps = 8/144 (5%)

Query: 47  EKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           + + +   E FA AL+L  S + D+A   +  + +     +   + + + ++L   G  +
Sbjct: 4   DSRADSPTETFAAALDLQKSGRRDEAERLYRALAASG-GKFAADACINLGALLDESGRAE 62

Query: 107 NAAEIF-LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFAN 165
            A E +   +A  +  PLA+       A S L     + E ++   + +    P    A 
Sbjct: 63  EALEKYREALALREGDPLALNN-----AGSTLFKLGRFHEAAEQF-RHALERAPDSLEAQ 116

Query: 166 EILGISALKFGKVQKAKTIFEELA 189
             LG +  + G +  A  +F +L 
Sbjct: 117 VALGAALQREGDLPAALAVFRDLV 140


>gi|300691804|ref|YP_003752799.1| hypothetical protein RPSI07_2160 [Ralstonia solanacearum PSI07]
 gi|299078864|emb|CBJ51525.1| conserved protein of unknown function [Ralstonia solanacearum
           PSI07]
          Length = 211

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/163 (15%), Positives = 63/163 (38%), Gaps = 5/163 (3%)

Query: 27  LLILMILSLAIWFYL--FDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
           + I+++L++A WF    +      + +++ E   +A++  ++ K+  A +  E       
Sbjct: 28  IAIVVLLAVAAWFGWKNWQRKQAGEASVLYEQVQKAVDAKDAEKIKRAAADMED--KFGR 85

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y  ++ +  A  L    D   A +  L+   D  +    +  A L+ A +L+D  +Y+
Sbjct: 86  TAYAQMAALSAAKALYEANDAAGA-KAQLQWTLDHASDDEYKAVAKLRLAGLLLDEKAYD 144

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           +   ++     P+            ++A       +A      
Sbjct: 145 QGLALVSGDVAPAFAALYADRRGDLLAAQNKKDEARAAYKLAL 187


>gi|229844542|ref|ZP_04464682.1| hypothetical protein CGSHi6P18H1_09510 [Haemophilus influenzae
           6P18H1]
 gi|229812791|gb|EEP48480.1| hypothetical protein CGSHi6P18H1_09510 [Haemophilus influenzae
           6P18H1]
          Length = 204

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 57/196 (29%), Gaps = 15/196 (7%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTLI 61

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            +++     K  +     + + +     Y   + +  A     K D   A     + A  
Sbjct: 62  NSVQQDEQTKKANIE---QFVQANSKTAYAVFALLDEAKKATEKQDFSAAEVNLNQ-ALT 117

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFG 176
                 +     L+ +++       +     L ++   S      A + +  G   +  G
Sbjct: 118 QSQDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVKGES----FNARKAILTGDIQVAKG 173

Query: 177 KVQKAKTIFEELAKDN 192
               AK  FE+  +  
Sbjct: 174 DKVAAKNSFEQAQQSG 189


>gi|241662757|ref|YP_002981117.1| hypothetical protein Rpic12D_1153 [Ralstonia pickettii 12D]
 gi|240864784|gb|ACS62445.1| conserved hypothetical protein [Ralstonia pickettii 12D]
          Length = 211

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 74/177 (41%), Gaps = 8/177 (4%)

Query: 27  LLILMILSLAIWFYL--FDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
           + I+++L++A WF    +      + +++ E   +A++  ++ K+  A +  E       
Sbjct: 28  VAIVVLLAVAGWFGWKNWQRKQAGEASVLYEQVQKAVDGKDAEKIKRAATDMED--KFGG 85

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y  ++ +  A  L    D  +A +  L+   D       +  A L+ A +L+D  +Y+
Sbjct: 86  TAYAQMTALAAAKALYEANDVASA-KAQLQWTVDHARDDEYKALAKLRLAGLLLDEKAYD 144

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
           +   ++     P+            ++A    K ++A+  + +LA +   P   S R
Sbjct: 145 QGIALVSGDVAPAFAGLYADRRGDLLAA--QNKNEEARAAY-KLALEKFGPADASAR 198


>gi|91792616|ref|YP_562267.1| tetratricopeptide TPR_2 [Shewanella denitrificans OS217]
 gi|91714618|gb|ABE54544.1| Tetratricopeptide TPR_2 [Shewanella denitrificans OS217]
          Length = 206

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 71/184 (38%), Gaps = 9/184 (4%)

Query: 8   NSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKK---KNIVGENFAQ-ALEL 63
           ++ + +    K  +K     + L  +      Y ++   E K     +  E+F   AL+ 
Sbjct: 5   STEEQQVDAIKQFWKDYGVSIALGAVVGLGGLYGWNTYSEHKVASAELASESFQSIALDA 64

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            NS  +  A   FEK  + D + Y  L    +A   V  GD + A + + KV     A  
Sbjct: 65  ENSPNVMMAAVEFEK--NHDQQGYQALLQFMLAKSAVEAGDLEKAEQAYTKVIAAKPA-A 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            +   A L+ + +  +  +       L+ ++   +      +E+ G    + G+  KAK 
Sbjct: 122 GLDMIAALRLSRVQAEQGNLGMALATLEHVT--DSAYAAQRDELKGDFYARQGEFDKAKN 179

Query: 184 IFEE 187
            ++ 
Sbjct: 180 AYQA 183


>gi|300741345|ref|ZP_07071366.1| putative UDP-N-acetylglucosamine-peptide-n-
           acetylglucosaminyltransferase [Rothia dentocariosa M567]
 gi|300380530|gb|EFJ77092.1| putative UDP-N-acetylglucosamine-peptide-n-
           acetylglucosaminyltransferase [Rothia dentocariosa M567]
          Length = 718

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 57/156 (36%), Gaps = 9/156 (5%)

Query: 45  SHEKKKNIVGENFAQAL-----ELFNSNKLDDARSSFEKIL-SQDNKLYNPLSNMYIASI 98
           S  +++    E +AQAL           KL  A  ++ K+    D K Y   + + +   
Sbjct: 37  SSIRREEAAPEIYAQALLGIGAAYQALGKLKKAIKAWSKVRHGDDPKAYAG-AQLGLGLA 95

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
              +G   +A   +  +  + +AP      A L       D    ++       +    N
Sbjct: 96  YYTRGKLDDAIAAWSNIHREKIAPETYAK-AQLNLGVAYKDQGKLDDAIAAWSNIHREDN 154

Query: 159 P-MHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           P  +  A   LG++    GK+  A   +  + +D+N
Sbjct: 155 PETYAKAQLGLGLAYRTQGKLDDAIAAWSNIHRDDN 190



 Score = 38.8 bits (89), Expect = 0.47,   Method: Composition-based stats.
 Identities = 32/156 (20%), Positives = 63/156 (40%), Gaps = 8/156 (5%)

Query: 44  GSHEKKKNIVGENFAQA-----LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
            S+  ++ I  E +A+A     +   +  KLDDA +++  I  +DN      + + +   
Sbjct: 109 WSNIHREKIAPETYAKAQLNLGVAYKDQGKLDDAIAAWSNIHREDNPETYAKAQLGLGLA 168

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
              +G   +A   +  +  DD      +    L AA        +++  K    +    N
Sbjct: 169 YRTQGKLDDAIAAWSNIHRDDNPETYAQAQLGLGAAYYA--QEDWKQTIKTWSNIHRDDN 226

Query: 159 P-MHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           P  +  A   LGI+   +G + KA   +  + +D+N
Sbjct: 227 PETYAQAQLNLGITYYTWGMLYKAIEAWSNIHRDDN 262


>gi|206578036|ref|YP_002237137.1| hypothetical protein KPK_1277 [Klebsiella pneumoniae 342]
 gi|206567094|gb|ACI08870.1| conserved hypothetical protein [Klebsiella pneumoniae 342]
          Length = 206

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 64/175 (36%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL I +L  W Y      +  ++     + QA     SN   +  S  EK  S
Sbjct: 23  KALAVGVILGIGALVGWRYWTSHQQDTARD-ASLAYEQATSALKSNTP-EVLSGAEKFAS 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y   +++ +A   V + D  NA +   +          ++   +++ A + +   
Sbjct: 81  DNKNTYGAFASLELAQHFVEQNDLPNAEKQLQQGLAAASDDN-LKSVISMRLARVQLQMK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L  +            ++ G   L  G  Q A+  +E   K + SP 
Sbjct: 140 QADAALKTLDSIKGEG--WTAIVADLRGEILLSKGDKQGARAAWEAGVKSDASPA 192


>gi|24374821|ref|NP_718864.1| hypothetical protein SO_3310 [Shewanella oneidensis MR-1]
 gi|24349507|gb|AAN56308.1|AE015769_4 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 206

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 35/192 (18%), Positives = 66/192 (34%), Gaps = 6/192 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  +      K       Y     +  ++ L     +  +     +K     + F QAL 
Sbjct: 5   STEEQQVDAIKQFWKD--YGISIGIGAVVGLGGLYGWNTYSDMKIEKAEEASQAF-QALT 61

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +S+++       E   + D K Y  L ++ +A   V   D   A E   KV       
Sbjct: 62  TKSSDEVAMLAGVAEFSKNYDQKGYQALLDLIVAKTAVEAKDFPKAEEALKKVIAAKP-G 120

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   ATL+ A I  +    +     L++++           E+ G   ++ G+  KAK
Sbjct: 121 AGLDTIATLRLARIQAEQGQVDTALATLEQVT--DKAFLAQREELKGDFFVRQGQADKAK 178

Query: 183 TIFEELAKDNNS 194
           T ++    +   
Sbjct: 179 TAYQAAMDNGGV 190


>gi|303257592|ref|ZP_07343604.1| tetratricopeptide repeat protein [Burkholderiales bacterium 1_1_47]
 gi|330999633|ref|ZP_08323342.1| tetratricopeptide repeat protein [Parasutterella excrementihominis
           YIT 11859]
 gi|302859562|gb|EFL82641.1| tetratricopeptide repeat protein [Burkholderiales bacterium 1_1_47]
 gi|329574139|gb|EGG55715.1| tetratricopeptide repeat protein [Parasutterella excrementihominis
           YIT 11859]
          Length = 211

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/167 (14%), Positives = 61/167 (36%), Gaps = 9/167 (5%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKI- 79
           +  +   ++ +    A  F  +     K+    G  +AQ ++  N       ++   ++ 
Sbjct: 21  WGNLILTVVTVACLCAAGFQGWRWYQMKESTDAGVLYAQMIQASNMKDEARVQAIAGRLH 80

Query: 80  LSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
            S  +  Y  +  +  A      G    A +    + + D  P  ++  A+++ A + +D
Sbjct: 81  ESYASTTYAGMGALLAAHNAETAGKYAEAEKALKWIVDSDKYPE-LKPLASVRLAGVYLD 139

Query: 140 TSSYEE---ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
              Y++   +   ++       P++    + +G   L  G V  A+ 
Sbjct: 140 EGKYDQGLTVLNAVKDAKGEEVPVY----DRMGDLYLAKGDVAAARK 182


>gi|288934096|ref|YP_003438155.1| hypothetical protein Kvar_1215 [Klebsiella variicola At-22]
 gi|290508294|ref|ZP_06547665.1| hypothetical protein HMPREF0485_00065 [Klebsiella sp. 1_1_55]
 gi|288888825|gb|ADC57143.1| Protein of unknown function DUF2133 [Klebsiella variicola At-22]
 gi|289777688|gb|EFD85685.1| hypothetical protein HMPREF0485_00065 [Klebsiella sp. 1_1_55]
          Length = 206

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 33/175 (18%), Positives = 64/175 (36%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL I +L  W Y      +  ++     + QA     SN   +  S  EK  +
Sbjct: 23  KALAVGVILGIGALVGWRYWTSHQQDTARD-ASLAYEQATSALKSNTP-EVLSGAEKFAA 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y   +++ +A   V + D  NA +   +          ++   +++ A + +   
Sbjct: 81  DNKNTYGAFASLELAQHFVEQNDLPNAEKQLQQGLAAASDDN-LKSVISMRLARVQLQMK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L  +            ++ G   L  G  Q A+  +E   K + SP 
Sbjct: 140 QADAALKTLDSIKGEG--WTAIVADLRGEILLSKGDKQGARAAWEAGVKSDASPA 192


>gi|145632617|ref|ZP_01788351.1| hypothetical protein CGSHi3655_02344 [Haemophilus influenzae 3655]
 gi|144986812|gb|EDJ93364.1| hypothetical protein CGSHi3655_02344 [Haemophilus influenzae 3655]
          Length = 204

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 57/196 (29%), Gaps = 15/196 (7%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTLI 61

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            +++     K  +     + + +     Y   + +  A     K D   A     + A  
Sbjct: 62  NSVQQDEQAKKANIE---QFVQANSKTAYAVFALLDEAKKATEKQDFSAAEVNLNQ-ALT 117

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFG 176
                 +     L+ +++       +     L ++   S      A + +  G   +  G
Sbjct: 118 QSQDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVKGES----FNARKAILTGDIQVAKG 173

Query: 177 KVQKAKTIFEELAKDN 192
               AK  FE+  +  
Sbjct: 174 DKVAAKNSFEQAQQSG 189


>gi|54297455|ref|YP_123824.1| hypothetical protein lpp1500 [Legionella pneumophila str. Paris]
 gi|53751240|emb|CAH12651.1| hypothetical protein lpp1500 [Legionella pneumophila str. Paris]
          Length = 224

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 68/178 (38%), Gaps = 6/178 (3%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      K    +  Y  +  + + ++L +   +   +  ++K K      +   +  F
Sbjct: 7   EEEQLEIIKKWWKR--YGNMITIFLSIVLLIIAGYRYMNWHNDKIKQQASIAYENMMIAF 64

Query: 65  NSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
           ++  +   RS   +++   ++ +Y  +++M +A I V+K   + A      VA+ +    
Sbjct: 65  SNQNIKSVRSYANELIKNYNHTVYADIAHMTLAKIYVSKNKLEQARNELKAVAS-ESQMT 123

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
            +R  A ++ A +L    +Y      L   +          NE+ G      G+ Q A
Sbjct: 124 PLRQIAKIRIARLLAADKAYTNALNELS--AVEDEAYLPVINELKGDIYSAKGQYQDA 179


>gi|56551981|ref|YP_162820.1| cellulose synthase operon C domain-containing protein [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|56543555|gb|AAV89709.1| cellulose synthase operon C domain protein [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 1336

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 58/153 (37%), Gaps = 20/153 (13%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
            F +A     +N+LD A+S  E++ +Q       +SN  +A I   +G    A  ++ K+
Sbjct: 219 RFEEAQAASRANQLDKAQSILEQLQNQ-QGGDANVSNALLADIYARQGQFDKAMALYDKL 277

Query: 116 ANDDLAPLAVRYAATLQA------ASILVDTSSYEEISK--ILQKLSEPSNPMHQF--AN 165
            N   A       A L++      A   +    Y    +       ++ +NP  +   A 
Sbjct: 278 GNSADAVT----VARLRSQENSIKARRALSQGDYAHAEQYFRTAIANDIANPWLRLDYAR 333

Query: 166 EILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
            +L     K G   +A ++   L    +S   I
Sbjct: 334 LLL-----KEGHRPEAVSLIRPLEDQASSEEAI 361


>gi|145638721|ref|ZP_01794330.1| co-chaperone HscB [Haemophilus influenzae PittII]
 gi|145272316|gb|EDK12224.1| co-chaperone HscB [Haemophilus influenzae PittII]
 gi|309750211|gb|ADO80195.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
          Length = 204

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 57/196 (29%), Gaps = 15/196 (7%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIIAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTLI 61

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            +++     K  +     + + +     Y   + +  A     K D   A     + A  
Sbjct: 62  NSVQQDEQAKKANIE---QFVQANSKTAYAVFALLDEAKKATEKQDFSVAEANLNQ-ALT 117

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFG 176
                 +     L+ +++       +     L ++   S      A + +  G   +  G
Sbjct: 118 QSQDEVLTSIVALRLSAVQFQLGQLDNALSTLNQVKGES----FNARKAILTGDIQVAKG 173

Query: 177 KVQKAKTIFEELAKDN 192
               AK  FE+  +  
Sbjct: 174 DKVAAKNSFEQAQQSG 189


>gi|320539278|ref|ZP_08038948.1| putative conserved protein [Serratia symbiotica str. Tucson]
 gi|320030670|gb|EFW12679.1| putative conserved protein [Serratia symbiotica str. Tucson]
          Length = 206

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/124 (18%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  ++L I +L  W Y  +           +++ +  +   + K DD  ++ EK + 
Sbjct: 23  KALAVGVVLGIAALVGWRYWQNHQSVDLM-AASQSYQEVSDRLAAGKPDDVAAA-EKFVQ 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNA----AEIFLKVANDDLAPLAVRYAATLQAASIL 137
            ++  Y+ L+ + +A   V + D   A     +   +  +D+L        A +Q     
Sbjct: 81  ANSNSYSVLAALQLAKHFVEQNDVAKAEQQLVQAQSQTRDDNLLSQINLRLARVQLQEKK 140

Query: 138 VDTS 141
            D +
Sbjct: 141 WDHA 144


>gi|152971374|ref|YP_001336483.1| hypothetical protein KPN_02843 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238895968|ref|YP_002920704.1| hypothetical protein KP1_4093 [Klebsiella pneumoniae NTUH-K2044]
 gi|262040250|ref|ZP_06013501.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330007781|ref|ZP_08306078.1| tetratricopeptide repeat protein [Klebsiella sp. MS 92-3]
 gi|150956223|gb|ABR78253.1| hypothetical protein KPN_02843 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238548286|dbj|BAH64637.1| hypothetical protein KP1_4093 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259042359|gb|EEW43379.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328535325|gb|EGF61810.1| tetratricopeptide repeat protein [Klebsiella sp. MS 92-3]
          Length = 206

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 64/175 (36%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +A  +IL I +L  W Y      +  ++     + +A     SN   +  S  EK  +
Sbjct: 23  KALAVGVILGIGALVGWRYWTSHQQDTARD-ASLAYEKATSALKSNTP-EVLSGAEKFAA 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y   +++ +A   V + D  NA +   +          ++   +++ A + +   
Sbjct: 81  DNKNTYGAFASLELAQHFVEQNDLPNAEKQLQQGLAAASDDN-LKSVISMRLARVQLQMK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +   K L  +            ++ G   L  G  Q A+  +E   K + SP 
Sbjct: 140 QADAALKTLDSIKGEG--WTAIVADLRGEILLSKGDKQGARAAWEAGVKSDASPA 192


>gi|187928154|ref|YP_001898641.1| hypothetical protein Rpic_1061 [Ralstonia pickettii 12J]
 gi|309782319|ref|ZP_07677046.1| tetratricopeptide repeat protein [Ralstonia sp. 5_7_47FAA]
 gi|187725044|gb|ACD26209.1| conserved hypothetical protein [Ralstonia pickettii 12J]
 gi|308918937|gb|EFP64607.1| tetratricopeptide repeat protein [Ralstonia sp. 5_7_47FAA]
          Length = 211

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 73/177 (41%), Gaps = 8/177 (4%)

Query: 27  LLILMILSLAIWFYL--FDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
           + I+++L++A WF    +      + +++ E   +A++  ++ K+  A +  E       
Sbjct: 28  VAIVVLLAVAGWFGWKNWQRKQAGEASVLYEQVQKAVDGKDAEKIKRAATDMED--KFGG 85

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y  ++ +  A  L    D  +A +  L+   D       +  A L+ A +L+D  +Y+
Sbjct: 86  TAYAQMTALAAAKALYEANDVASA-KAQLQWTVDHARDDEYKALAKLRLAGLLLDEKAYD 144

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
           +   ++     P+            ++A    K + A+  + +LA +   P   S R
Sbjct: 145 QGIALVSGDVAPAFAGLYADRRGDLLAA--QNKNEDARAAY-KLALEKFGPADASAR 198


>gi|332288523|ref|YP_004419375.1| hypothetical protein UMN179_00442 [Gallibacterium anatis UMN179]
 gi|330431419|gb|AEC16478.1| hypothetical protein UMN179_00442 [Gallibacterium anatis UMN179]
          Length = 206

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 66/186 (35%), Gaps = 5/186 (2%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           ++++    +   +  K   K I   +IL I+ +  W Y + G  + K +     F+Q + 
Sbjct: 5   TSDEQLQIEEIKQWWKENGKVIIAAVILAIVGVFGWRY-WQGYQQGKIHQSSAEFSQIMA 63

Query: 63  LFNSNKLDDARSSFEKILSQDN-KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
                    A +   + +  +    Y+    +  A   +     ++AA+   K A ++  
Sbjct: 64  ATEQADAGKANAQLTQFVETNPSSAYSAFLLLEQAKKQIDANQWQHAADTLQK-ALNNAK 122

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
             A+     L+ AS+      +E     L K++            + G      G   +A
Sbjct: 123 DAALISLIALRLASVQTQLKQFEPALATLGKVT--DQAWQGRKAMLSGEIYNAMGNKAEA 180

Query: 182 KTIFEE 187
           K  FE 
Sbjct: 181 KKSFEA 186


>gi|260598899|ref|YP_003211470.1| hypothetical protein CTU_31070 [Cronobacter turicensis z3032]
 gi|260218076|emb|CBA32823.1| UPF0070 protein yfgM [Cronobacter turicensis z3032]
          Length = 206

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 73/196 (37%), Gaps = 4/196 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   + +  ++GS          ++   
Sbjct: 1   MEIYENENEQLDAVKRFFAENGKALAVGVVLGIGALVGWRFWNGSQVDSARESSLHYQNV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    ++      S+ ++ ++Q+   Y  L+ + +A   V K D   A +  L+   ++ 
Sbjct: 61  MTDARADDPKT-LSAAQQFVAQNQNSYGALAALELAQRYVDKNDLAQAVQQ-LQQGIENT 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +R    L+ A I +     +   K L+ +   +        ++ G + L  G  Q 
Sbjct: 119 KDENLRSLINLRLARIQIQQKQADAALKTLENVKGEN--WSAMVADLRGDALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPF 196
           A+  + + A D NSP 
Sbjct: 177 ARDAWSKGADDKNSPA 192


>gi|327402025|ref|YP_004342863.1| TPR domain-containing protein [Fluviicola taffensis DSM 16823]
 gi|327317533|gb|AEA42025.1| TPR domain-containing protein [Fluviicola taffensis DSM 16823]
          Length = 210

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 34/182 (18%), Positives = 71/182 (39%), Gaps = 24/182 (13%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           + I  ++I +I+ +  +       +  K     E + + L L   + +D A +  E  + 
Sbjct: 21  RLITAVVIGLIVGILGYILYKQFIYAPKNLKANEGYYKGLNLAAKDSVDAAITELEPFVK 80

Query: 82  QDNKLY--NPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV---------RYAAT 130
           + N  Y    ++   +A   +AKGD K A ++   V+ +D    ++              
Sbjct: 81  K-NSGYQGGEVAKFTLARQYMAKGDFKKALKLLEDVSLEDTYGPSLVLGLQGDCNSEMGK 139

Query: 131 LQAAS-ILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            + A  + VD +  +E        + P+      A ++    A +     KAK ++E + 
Sbjct: 140 YKEALDLYVDAADSDE-----NDWTTPT--YLFKAGQV----AEEIKDFAKAKELYERIN 188

Query: 190 KD 191
           KD
Sbjct: 189 KD 190


>gi|300741344|ref|ZP_07071365.1| TPR repeat protein [Rothia dentocariosa M567]
 gi|300380529|gb|EFJ77091.1| TPR repeat protein [Rothia dentocariosa M567]
          Length = 446

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 62/155 (40%), Gaps = 12/155 (7%)

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
             KL+ A +++E++     + Y   +   I +  V +G    A E + ++      P A 
Sbjct: 276 QGKLEQAIAAWERVPESLPERYAS-AQYNIGTSYVEQGKPTKAVEAWERIPASASEPYA- 333

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
              A      I  +  + ++     +++ + ++     A   +G +  K G+  +A  ++
Sbjct: 334 --VAQYNTGLIYEEQGNIDDALVAWERVPKDASEHFYKAQFNIGGAYYKLGETDEAVAVW 391

Query: 186 EELAKDNNSPFGISTRSQMILAN--IIASDQRNKK 218
           + +      P   S + +M   N  IIA +Q   K
Sbjct: 392 KNI------PESASEQYEMAQTNLSIIAENQEKAK 420



 Score = 39.2 bits (90), Expect = 0.36,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 56/155 (36%), Gaps = 12/155 (7%)

Query: 41  LFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILV 100
             +      K      F   +     N +D+A  +++++      LY   +   + +   
Sbjct: 111 WKNIPSAAPKQYAMAQFNLGVTYAQQNNVDEAIEAYQRVPKDVTNLYAH-AQYNLGATYT 169

Query: 101 AKGDTKNAAEIFLKV--ANDDLAPLAVRYAATLQAASILVDTSS--YEEISKILQKLSEP 156
            +G    AAE +  V  A       A+     L       + +S  Y+++       + P
Sbjct: 170 QQGKMDEAAEAYKNVPDAAPAKYAKALNNLGVLYEGQGKAEQASEAYQQV-----PSTVP 224

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
               +  A   LG++    GK ++A  ++E ++ D
Sbjct: 225 DQ--YAMALNNLGVTYYNQGKTEQALELWETVSAD 257


>gi|95929845|ref|ZP_01312586.1| hypothetical protein Dace_2499 [Desulfuromonas acetoxidans DSM 684]
 gi|95134141|gb|EAT15799.1| hypothetical protein Dace_2499 [Desulfuromonas acetoxidans DSM 684]
          Length = 786

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/175 (14%), Positives = 57/175 (32%), Gaps = 4/175 (2%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           +  +  + +IA         L     L     E+ +  V      A     +N +  A+ 
Sbjct: 261 EYARLLHMYIAARQFADPYQLMAALELDAQRQEEAQFSVYSELLHAEVALATNDMRSAQI 320

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND-DLAPLAVRYAATLQA 133
             +  + Q             A +   +GD   A E +  +AN     P ++   A    
Sbjct: 321 VLDAQMKQGKAGLESRYQQRQADVWFDQGDYAAAVERYQSLANQLADFPSSLANFAMSLY 380

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
                D  +  ++ + L+ + +P +     A  +L +S +  G       +  ++
Sbjct: 381 RQKDYD-GAIVQLKRFLEGVDDPES--RDMARYLLAMSMIHRGDKDAGYDLLHQI 432


>gi|309972471|gb|ADO95672.1| Conserved hypothetical protein [Haemophilus influenzae R2846]
          Length = 204

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 57/196 (29%), Gaps = 15/196 (7%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFA 58
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTLI 61

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            +++     K  +     + + +     Y   + +  A     K D   A     + A  
Sbjct: 62  NSVQQDEQAKKANIE---QFVQANSKTAYAVFALLDEAKKATEKQDFSAAEVNLNQ-ALT 117

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFG 176
                 +     L+ +++       +     L ++   S      A + +  G   +  G
Sbjct: 118 QSQDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVKGES----FNARKAILTGDIQVAKG 173

Query: 177 KVQKAKTIFEELAKDN 192
               AK  FE+  +  
Sbjct: 174 DKVAAKNSFEQAQQSG 189


>gi|311278556|ref|YP_003940787.1| hypothetical protein Entcl_1236 [Enterobacter cloacae SCF1]
 gi|308747751|gb|ADO47503.1| Protein of unknown function DUF2133 [Enterobacter cloacae SCF1]
          Length = 206

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 65/173 (37%), Gaps = 5/173 (2%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           +A  +IL + +L  W Y      E         + Q++   +S K D A S+ EK  + +
Sbjct: 25  LAVGVILGVGALVGWRYWTSH-QENNARDASLAYEQSVSSLSSGKPD-ALSAAEKFAAAE 82

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y   +++ +A   V K   +NA +   +          ++    ++ A + +     
Sbjct: 83  KNTYGAFASLELAQQFVDKNQLENAEKQLQQGLAAASDDN-LKSVINMRLARVQLQMKQP 141

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           +   K L+ +            ++ G   L  G  Q A+  +E   K + SP 
Sbjct: 142 DAALKTLEGIKGEG--WTAIVADLRGEILLSKGDKQGARAAWEAGVKSDASPA 192


>gi|167587052|ref|ZP_02379440.1| hypothetical protein BuboB_17042 [Burkholderia ubonensis Bu]
          Length = 209

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 75/199 (37%), Gaps = 7/199 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +   +    K    +  +  +   ++L  L +A  F  ++    ++       + Q  + 
Sbjct: 5   DEQESIESLKAWWAR--WGNLTTWIVLAALVVAAGFNGWNFWQRRQAAQASGLYEQVQKA 62

Query: 64  FNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             SN     AR++ +         Y  ++ +  A +L A GD   A +  L+ A D    
Sbjct: 63  AASNDKATMARAAADMEDKYSGTPYAQMTALAAAKVLYAAGDAAGA-KTQLQWAVDHAKD 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+
Sbjct: 122 DEYKQIAKLRLASLLLDEKAYDAGLALLSG--TPIDAFKGLVADRRGDLLAAQGKADDAR 179

Query: 183 TIFEELAKDNNSPFGISTR 201
             + +LA D+     +S R
Sbjct: 180 AAY-KLALDSLPKEDMSAR 197


>gi|301053723|ref|YP_003791934.1| TPR repeat-containing protein [Bacillus anthracis CI]
 gi|300375892|gb|ADK04796.1| TPR repeat-containing protein [Bacillus cereus biovar anthracis
           str. CI]
          Length = 891

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 74/197 (37%), Gaps = 11/197 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +   ++ +         K   K I  +   +++ +      +  +   K     E   QA
Sbjct: 484 LTVAHEQSEPSAFSTWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQA 543

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +     K ++A      +  +D       + + +A+I VA+G  K A +   K+  D  
Sbjct: 544 YDNKKYTKAEEAVGHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDRE 597

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFG 176
                  AA L A++       Y+E  +  ++     ++   P  + A   L +S +K  
Sbjct: 598 IDKENNEAAYLLASA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMK 656

Query: 177 KVQKAKTIFEELAKDNN 193
           + +KA+ +  +++   N
Sbjct: 657 EFEKAEDVIVKMSTKTN 673


>gi|196046066|ref|ZP_03113294.1| TPR domain protein [Bacillus cereus 03BB108]
 gi|229091187|ref|ZP_04222410.1| TPR repeat-containing protein [Bacillus cereus Rock3-42]
 gi|196023121|gb|EDX61800.1| TPR domain protein [Bacillus cereus 03BB108]
 gi|228692318|gb|EEL46054.1| TPR repeat-containing protein [Bacillus cereus Rock3-42]
          Length = 891

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 74/197 (37%), Gaps = 11/197 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +   ++ +         K   K I  +   +++ +      +  +   K     E   QA
Sbjct: 484 LTVAHEQSEPSAFSTWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQA 543

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +     K ++A      +  +D       + + +A+I VA+G  K A +   K+  D  
Sbjct: 544 YDNKKYTKAEEAVGHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDRE 597

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFG 176
                  AA L A++       Y+E  +  ++     ++   P  + A   L +S +K  
Sbjct: 598 IDKENNEAAYLLASA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMK 656

Query: 177 KVQKAKTIFEELAKDNN 193
           + +KA+ +  +++   N
Sbjct: 657 EFEKAEDVIVKMSTKTN 673


>gi|255292048|dbj|BAH90529.1| putative transmembrane protein [uncultured bacterium]
 gi|255292516|dbj|BAH89631.1| hypothetical protein [uncultured bacterium]
 gi|255293028|dbj|BAH90123.1| hypothetical protein [uncultured bacterium]
          Length = 205

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 70/188 (37%), Gaps = 10/188 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M + +D    + +    +     +  ++ + +  L   FY   G+++ ++          
Sbjct: 1   MTTVDDDQIEQLRRLWERYGRATVVVVVAVAVGILGGRFY---GTYQTRQAQQAAALYAT 57

Query: 61  LELFNSNKLDDARSSFEKILSQDNKL-YNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
            +   + +   A    EK+  +     Y   +    A+  V  GD + A +    VA   
Sbjct: 58  YQQPPAGQT--AAELAEKLRGEHPASSYATFAVFDQAAQAVQAGDPQQAVQQLRWVAEHA 115

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
                 R  A L+ A +L+      E +  L+  +   +P      E+ G  AL  G+ Q
Sbjct: 116 GQ-QTDRGLARLRLARVLLAQGKVAEAASALEHEAVGPSPAR---EELKGDIALAEGRPQ 171

Query: 180 KAKTIFEE 187
           +A+  +++
Sbjct: 172 QAREHYQQ 179


>gi|300118063|ref|ZP_07055811.1| TPR domain protein [Bacillus cereus SJ1]
 gi|298724374|gb|EFI65068.1| TPR domain protein [Bacillus cereus SJ1]
          Length = 891

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 74/197 (37%), Gaps = 11/197 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +   ++ +         K   K I  +   +++ +      +  +   K     E   QA
Sbjct: 484 LTVAHEQSEPSAFSTWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQA 543

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +     K ++A      +  +D       + + +A+I VA+G  K A +   K+  D  
Sbjct: 544 YDNKKYTKAEEAVGHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDRE 597

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFG 176
                  AA L A++       Y+E  +  ++     ++   P  + A   L +S +K  
Sbjct: 598 IDKENNEAAYLLASA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMK 656

Query: 177 KVQKAKTIFEELAKDNN 193
           + +KA+ +  +++   N
Sbjct: 657 EFEKAEDVIVKMSTKTN 673


>gi|218903327|ref|YP_002451161.1| TPR domain protein [Bacillus cereus AH820]
 gi|228927271|ref|ZP_04090333.1| TPR repeat-containing protein [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229121758|ref|ZP_04250979.1| TPR repeat-containing protein [Bacillus cereus 95/8201]
 gi|254722186|ref|ZP_05183974.1| TPR domain protein [Bacillus anthracis str. A1055]
 gi|218535541|gb|ACK87939.1| TPR domain protein [Bacillus cereus AH820]
 gi|228661674|gb|EEL17293.1| TPR repeat-containing protein [Bacillus cereus 95/8201]
 gi|228832418|gb|EEM77993.1| TPR repeat-containing protein [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 891

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 74/197 (37%), Gaps = 11/197 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +   ++ +         K   K I  +   +++ +      +  +   K     E   QA
Sbjct: 484 LTVAHEQSEPSAFSTWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQA 543

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +     K ++A      +  +D       + + +A+I VA+G  K A +   K+  D  
Sbjct: 544 YDNKKYTKAEEAVGHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDRE 597

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFG 176
                  AA L A++       Y+E  +  ++     ++   P  + A   L +S +K  
Sbjct: 598 IDKENNEAAYLLASA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMK 656

Query: 177 KVQKAKTIFEELAKDNN 193
           + +KA+ +  +++   N
Sbjct: 657 EFEKAEDVIVKMSTKTN 673


>gi|167632739|ref|ZP_02391065.1| TPR domain protein [Bacillus anthracis str. A0442]
 gi|170686617|ref|ZP_02877838.1| TPR domain protein [Bacillus anthracis str. A0465]
 gi|254684775|ref|ZP_05148635.1| TPR domain protein [Bacillus anthracis str. CNEVA-9066]
 gi|254743593|ref|ZP_05201278.1| TPR domain protein [Bacillus anthracis str. Kruger B]
 gi|167531551|gb|EDR94216.1| TPR domain protein [Bacillus anthracis str. A0442]
 gi|170669693|gb|EDT20435.1| TPR domain protein [Bacillus anthracis str. A0465]
          Length = 891

 Score = 45.4 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 74/197 (37%), Gaps = 11/197 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +   ++ +         K   K I  +   +++ +      +  +   K     E   QA
Sbjct: 484 LTVAHEQSEPSAFSTWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQA 543

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +     K ++A      +  +D       + + +A+I VA+G  K A +   K+  D  
Sbjct: 544 YDNKKYTKAEEAVGHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDRE 597

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFG 176
                  AA L A++       Y+E  +  ++     ++   P  + A   L +S +K  
Sbjct: 598 IDKENNEAAYLLASA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMK 656

Query: 177 KVQKAKTIFEELAKDNN 193
           + +KA+ +  +++   N
Sbjct: 657 EFEKAEDVIVKMSTKTN 673


>gi|262371652|ref|ZP_06064931.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262311677|gb|EEY92762.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 232

 Score = 45.4 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 34/195 (17%), Positives = 69/195 (35%), Gaps = 16/195 (8%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  +++      K    K     I+ +LI +I      F+ ++   +K         A+ 
Sbjct: 1   MSLSDEEQLDSLKSFAKKYGSAMISGILIALIA-----FFGWEYWQKKNLAESQNQTAKV 55

Query: 61  LELFNSNK--------LDDARSSFEKILSQDNKLYNPL-SNMYIASILVAKGDTKNAAEI 111
            +L +  K              + +KI+  D      + +   +A +   K D   A + 
Sbjct: 56  QKLMDEAKAVAGQPNAFATVSEAADKIVKDDADSVQAIQTQFILAKLAYEKQDYAAAEKA 115

Query: 112 FLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGIS 171
             KV N  +    +     ++ A   +    Y+E  K L  +SEP        +E+ G  
Sbjct: 116 LKKVENSKVKDAGLMQIVKIRLADSQLAQKKYDEALKTLSNVSEP--AFKATVDELRGDI 173

Query: 172 ALKFGKVQKAKTIFE 186
            +    V+ A+  ++
Sbjct: 174 YVAKKDVESARKAYQ 188


>gi|296104192|ref|YP_003614338.1| hypothetical protein ECL_03855 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295058651|gb|ADF63389.1| hypothetical protein ECL_03855 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 206

 Score = 45.4 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 61/175 (34%), Gaps = 5/175 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K +   +IL + +L  W Y  +   +        ++   +    +++     ++ EK  +
Sbjct: 23  KALVVGVILGVGALIGWRYWNNHQADS-ARGASLSYENTVSAIRADQPQT-LTAAEKFAA 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            +   Y  L+ + +A   + K +   AA    +          ++    L+ A I V   
Sbjct: 81  DNKNTYGALAALEVAQQYIDKNELDKAAAQLSQGLAAASDDN-LKAVINLRLARIQVQQK 139

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             +E  K L  +            ++ G + L  G    A+  ++     N SP 
Sbjct: 140 KADEALKTLDTIKGEG--FAAIVADLRGEALLSKGDKAGARKAWQAGVDSNASPA 192


>gi|229133038|ref|ZP_04261879.1| TPR repeat-containing protein [Bacillus cereus BDRD-ST196]
 gi|228650456|gb|EEL06450.1| TPR repeat-containing protein [Bacillus cereus BDRD-ST196]
          Length = 891

 Score = 45.4 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 73/197 (37%), Gaps = 11/197 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +   ++        K  K   K    +   +++ +      +  +   K     E   QA
Sbjct: 484 LTVTHEQREPSAFSKWWKKNKKRTLIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQA 543

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +     K ++A      +  +D       + + +A+I VA+G  K A +   K+  D  
Sbjct: 544 YDDKKYTKAEEAVGHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDRE 597

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFG 176
                  AA L A++       Y+E  +  ++     ++   P  + A   L +S +K  
Sbjct: 598 IDKENNEAAYLLASA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMK 656

Query: 177 KVQKAKTIFEELAKDNN 193
           + +KA+ +  +++   N
Sbjct: 657 EFEKAEDVIVKMSTKTN 673


>gi|311113426|ref|YP_003984648.1| hypothetical protein HMPREF0733_11757 [Rothia dentocariosa ATCC
           17931]
 gi|310944920|gb|ADP41214.1| conserved hypothetical protein [Rothia dentocariosa ATCC 17931]
          Length = 447

 Score = 45.4 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 62/155 (40%), Gaps = 12/155 (7%)

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
             KL+ A +++E++     + Y   +   I +  V +G    A E + ++      P A 
Sbjct: 276 QGKLEQAITAWERVPESLPERYAS-AQYNIGTSYVEQGKPTKAVEAWERIPASASEPYA- 333

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
              A      I  +  + ++     +++ + ++     A   +G +  K G+  +A  ++
Sbjct: 334 --VAQYNTGLIYEEQGNIDDALVAWERVPKDASEHFYKAQFNIGGAYYKLGETDEAVAVW 391

Query: 186 EELAKDNNSPFGISTRSQMILAN--IIASDQRNKK 218
           + +      P   S + +M   N  IIA +Q   K
Sbjct: 392 KNI------PESASEQYEMAQTNLSIIAENQEKAK 420



 Score = 39.6 bits (91), Expect = 0.28,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 56/155 (36%), Gaps = 12/155 (7%)

Query: 41  LFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILV 100
             +      K      F   +     N +D+A  +++++      LY   +   + +   
Sbjct: 111 WKNIPSAAPKQYAMAQFNLGVTYAQQNNVDEAIEAYQRVPKDVTNLYAH-AQYNLGATYT 169

Query: 101 AKGDTKNAAEIFLKV--ANDDLAPLAVRYAATLQAASILVDTSS--YEEISKILQKLSEP 156
            +G    AAE +  V  A       A+     L       + +S  Y+++       + P
Sbjct: 170 QQGKMDEAAEAYKNVPDAAPAKYAKALNNLGVLYEGQGKAEQASEAYQQV-----PSTVP 224

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
               +  A   LG++    GK ++A  ++E ++ D
Sbjct: 225 DQ--YAMALNNLGVTYYNQGKTEQALELWETVSAD 257


>gi|228914800|ref|ZP_04078409.1| TPR repeat-containing protein [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228845119|gb|EEM90161.1| TPR repeat-containing protein [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 891

 Score = 45.4 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 74/197 (37%), Gaps = 11/197 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +   ++ +         K   K I  +   +++ +      +  +   K     E   QA
Sbjct: 484 LTVAHEQSEPSAFSTWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQA 543

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +     K ++A      +  +D       + + +A+I VA+G  K A +   K+  D  
Sbjct: 544 YDNKKYTKAEEAVGHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDRE 597

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFG 176
                  AA L A++       Y+E  +  ++     ++   P  + A   L +S +K  
Sbjct: 598 IDKENNEAAYLLASA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMK 656

Query: 177 KVQKAKTIFEELAKDNN 193
           + +KA+ +  +++   N
Sbjct: 657 EFEKAEDVIVKMSTKTN 673


>gi|297617492|ref|YP_003702651.1| hypothetical protein Slip_1319 [Syntrophothermus lipocalidus DSM
           12680]
 gi|297145329|gb|ADI02086.1| Tetratricopeptide TPR_4 [Syntrophothermus lipocalidus DSM 12680]
          Length = 722

 Score = 45.4 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 68/177 (38%), Gaps = 15/177 (8%)

Query: 11  KGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLD 70
           +GKC+ G+     +A L   +I                 +  V +    A++  + NK D
Sbjct: 4   QGKCQGGRVALLAVAVLFTSLISGCFG----------STEAKVNKQLELAVKYVSENKFD 53

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT 130
           +A  +++++++ D +     +   +  +   +G    A E + +          +R    
Sbjct: 54  EAVLAYQEVINIDKREVR--AYQGLGKVYTLQGKFDKAQETYDQGIEAVKEEDVMR--LK 109

Query: 131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           L  A + +D     +  K  +++ +        A + L +   + G+ ++A  + E+
Sbjct: 110 LSLAGMYMDKGDPVQAEKAYKEIIDEDKT-AVEAYQGLAMIYERNGEGEQALAVLEQ 165


>gi|226939616|ref|YP_002794689.1| hypothetical protein LHK_00687 [Laribacter hongkongensis HLHK9]
 gi|226714542|gb|ACO73680.1| Putative membrane protein [Laribacter hongkongensis HLHK9]
          Length = 211

 Score = 45.4 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 34/185 (18%), Positives = 68/185 (36%), Gaps = 11/185 (5%)

Query: 9   SYKGKCKMGKCCY----KWIAPLLILMILSLAIWFYLFDGSHEKKKNIV--GENFAQALE 62
             + +    K  +    KWI+  +I++ L    +         + +           A+ 
Sbjct: 6   QEQEQIDAAKAFWQQWGKWISLAVIVVALGYLGYQGWKYYRSHQAEQAALLYAPVETAVT 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             ++ KL  +  + +   +     Y   +++  A +   KGDTK A +    VA +   P
Sbjct: 66  EGDAGKLVASAKALQD--AYPKSGYAARASLLAARVAFDKGDTKTAEQELRWVAGNAAEP 123

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
            AV+  A L+ A + +D    +     L +             E+ G + L  G  Q A+
Sbjct: 124 -AVKAVAQLRLAGLQLDAGQTDAALAELARPI--DATFLPQQLELKGDALLVKGDRQGAR 180

Query: 183 TIFEE 187
             ++E
Sbjct: 181 VAYQE 185


>gi|258619959|ref|ZP_05714999.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|262172168|ref|ZP_06039846.1| membrane protein [Vibrio mimicus MB-451]
 gi|258587692|gb|EEW12401.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|261893244|gb|EEY39230.1| membrane protein [Vibrio mimicus MB-451]
          Length = 204

 Score = 45.4 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 30/196 (15%), Positives = 68/196 (34%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + +    +      K   K +    ++ +  L  W Y  D S    +     +++QA++ 
Sbjct: 5   DTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQD-SVVSAQEAASHSYSQAIDA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             +   +   S    I +     Y  L+ M +A + V  G    A     + A      +
Sbjct: 64  LVAKGTEAESSIQTFIDANKETEYAVLAAMQLAKVQVEAGQLDEALAQL-EWAKGATKDV 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A++   T + A +  +   ++E    L  + E          E+ G   ++ G    A  
Sbjct: 123 ALKPLLTYRVARLQAEQGQFDEALTQLSNIQE--KTWAGRVAELRGDILMRKGDSAGAYA 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  + +++   + 
Sbjct: 181 AYTEAQQADDASQTLQ 196


>gi|281412533|ref|YP_003346612.1| Tetratricopeptide TPR_2 repeat protein [Thermotoga naphthophila
           RKU-10]
 gi|281373636|gb|ADA67198.1| Tetratricopeptide TPR_2 repeat protein [Thermotoga naphthophila
           RKU-10]
          Length = 357

 Score = 45.4 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 60/135 (44%), Gaps = 9/135 (6%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           F         N+ D A  + E++L  D      L  +    +    G+ + A E+  K+ 
Sbjct: 203 FMITEAYHEINRKDLAAKTLERLLKIDPDNIPALYQLSQ--LYRDLGNEEKAKEMEEKIM 260

Query: 117 N-DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
           N     P  +   A +     ++    Y+E+ + L+K+   S+P++  A  +L +  +K 
Sbjct: 261 NCKPKYPTELEPWARV-----MLKHGRYKEVVEELEKI-VESSPLNTLARLLLVVPYVKL 314

Query: 176 GKVQKAKTIFEELAK 190
           G++ KA+ I E++ +
Sbjct: 315 GQIDKAREILEDIGQ 329


>gi|196033782|ref|ZP_03101193.1| TPR domain protein [Bacillus cereus W]
 gi|228945816|ref|ZP_04108162.1| TPR repeat-containing protein [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|195993462|gb|EDX57419.1| TPR domain protein [Bacillus cereus W]
 gi|228813881|gb|EEM60156.1| TPR repeat-containing protein [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 891

 Score = 45.4 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 74/197 (37%), Gaps = 11/197 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +   ++ +         K   K I  +   +++ +      +  +   K     E   QA
Sbjct: 484 LTVAHEQSEPSAFSTWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQA 543

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +     K ++A      +  +D       + + +A+I VA+G  K A +   K+  D  
Sbjct: 544 YDNKKYTKAEEAVGHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDRE 597

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFG 176
                  AA L A++       Y+E  +  ++     ++   P  + A   L +S +K  
Sbjct: 598 IDKENNEAAYLLASA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMK 656

Query: 177 KVQKAKTIFEELAKDNN 193
           + +KA+ +  +++   N
Sbjct: 657 EFEKAEDVIVKMSTKTN 673


>gi|262195382|ref|YP_003266591.1| hypothetical protein Hoch_2153 [Haliangium ochraceum DSM 14365]
 gi|262078729|gb|ACY14698.1| hypothetical protein Hoch_2153 [Haliangium ochraceum DSM 14365]
          Length = 581

 Score = 45.4 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/104 (18%), Positives = 42/104 (40%), Gaps = 9/104 (8%)

Query: 50  KNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAA 109
           +  VG+  A+A++L N  + D A +  ++ L+        L       + + + D  +A 
Sbjct: 42  RQRVGDAVARAVQLGNEGQFDTALAVLDQQLANAPTNQRLL--QQRGILSLERRDFASAL 99

Query: 110 EIFLKV-------ANDDLAPLAVRYAATLQAASILVDTSSYEEI 146
           E F ++       AN       +R    +++ S+ V      ++
Sbjct: 100 ESFERLLAAGPRGANRRKVRRIIRDLRHIRSTSVEVQLVPPADV 143


>gi|52425976|ref|YP_089113.1| hypothetical protein MS1921 [Mannheimia succiniciproducens MBEL55E]
 gi|52308028|gb|AAU38528.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 204

 Score = 45.4 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 15/110 (13%), Positives = 33/110 (30%), Gaps = 1/110 (0%)

Query: 35  LAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMY 94
               +  +      + + + + + Q +  F  +      +  E I       Y  L+   
Sbjct: 35  GVFGWRYWQSYQLSQHHQLSDQYQQVIYEFRQDPAAQKDNLAEFIAQNGKSGYAALALFE 94

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
            A   V K D   A     +  N+          A L+ A++      ++
Sbjct: 95  QAKTAVEKQDFSQAETALKQALNNAP-DEIFASIAALRLANVQFQQKDFD 143


>gi|149176885|ref|ZP_01855495.1| hypothetical protein PM8797T_14082 [Planctomyces maris DSM 8797]
 gi|148844322|gb|EDL58675.1| hypothetical protein PM8797T_14082 [Planctomyces maris DSM 8797]
          Length = 348

 Score = 45.4 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 34/141 (24%), Positives = 59/141 (41%), Gaps = 11/141 (7%)

Query: 49  KKNIVGENFAQALELFNSNKLDD-----ARSSFEKILSQDNKLYNPLSNMYIASILVAKG 103
           K N    ++  A++L   ++L       A S+F  +     K Y   +    A +L+A+G
Sbjct: 143 KANADHFSYYPAMKLLGESQLAKKDYVAANSAFGTVERSPWKDYQMDAKNMKARVLLAQG 202

Query: 104 DTKNAAEIFLKVAN-DDLAPLAVRY--AATLQAASILVDTSSYEEISKILQKLSEPSNPM 160
           +TK A   F  VA  D   P  +    AA L +A  L      ++  K+L ++ +  +  
Sbjct: 203 NTKGALAAFETVAKMDGKTPGELANKHAAQLGSAICLEKDGKPQDAIKVLDEIIKNVSSS 262

Query: 161 HQFANEILGISALKFGKVQKA 181
                 +L  + LK G   +A
Sbjct: 263 QSS---LLAEAYLKKGDCYQA 280


>gi|225848981|ref|YP_002729145.1| Spc97 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644153|gb|ACN99203.1| putative Spc97 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 210

 Score = 45.4 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 72/175 (41%), Gaps = 8/175 (4%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y  I    ++++L  ++ +YL+    +++        ++   L + +K ++AR   ++  
Sbjct: 30  YLKIILAFVVILLIGSLGYYLYTKKKQEENEKASVYVSKIANLLSEDKKEEARKLIDEFE 89

Query: 81  S--QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV 138
              +D   Y  +       I++AK + K   ++   +   +     +        A + +
Sbjct: 90  KKYKDTNFYKVI---LSYKIMMAKDEGKEDEKLANALK--EKLNTQILEGVKEYTAYLKL 144

Query: 139 DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
             ++  +  +IL+ + +        A   LG+   K G  Q+A+ IF E+ +  +
Sbjct: 145 KQNNTNQAKEILKSIDKDKYNY-ISAQATLGLIYKKEGNYQEAEKIFNEIKEKKD 198


>gi|308275079|emb|CBX31678.1| hypothetical protein N47_E51900 [uncultured Desulfobacterium sp.]
          Length = 801

 Score = 45.4 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 59/163 (36%), Gaps = 11/163 (6%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
              +A+ L    K+D A     +I+ ++ K     ++     ILV+K D   A   +  V
Sbjct: 345 KLFKAIILAQEQKIDQALVLINEIIKENTKDIG--AHTLKGDILVSKRDFPGAIAAYRAV 402

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
             +      +      + A +            I +KL   ++ +   A   L     + 
Sbjct: 403 IGEQPGNTDMSS----KLAMVHYLNGEPAIAEDIYKKLLVQNDTLR-SARFGLANIYQRT 457

Query: 176 GKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
            K+  AK   + + K N  P  I   + +++ ++    +  +K
Sbjct: 458 NKIDMAKEQMQIILKKN--PDDIE--ALVMMGDLEILSKNQRK 496


>gi|229029927|ref|ZP_04185995.1| TPR repeat-containing protein [Bacillus cereus AH1271]
 gi|228731354|gb|EEL82268.1| TPR repeat-containing protein [Bacillus cereus AH1271]
          Length = 891

 Score = 45.4 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 74/197 (37%), Gaps = 11/197 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +   ++ +         K   K I  +   +++ +      +  +   K     E   QA
Sbjct: 484 LTITHEQSEPSAFSTWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQA 543

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +     K ++A      +  +D       + + +A+I VA+G  K A +   K+  D  
Sbjct: 544 YDDKKYTKAEEAVGHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDRE 597

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFG 176
                  AA L A++       Y+E  +  ++     ++   P  + A   L +S +K  
Sbjct: 598 IDKENNEAAYLLASA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMK 656

Query: 177 KVQKAKTIFEELAKDNN 193
           + +KA+ +  +++   N
Sbjct: 657 EFEKAEDVIVKMSTKTN 673


>gi|120436880|ref|YP_862566.1| hypothetical protein GFO_2543 [Gramella forsetii KT0803]
 gi|117579030|emb|CAL67499.1| conserved hypothetical protein, secreted [Gramella forsetii KT0803]
          Length = 1006

 Score = 45.4 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 66/175 (37%), Gaps = 5/175 (2%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPL-SNMY 94
           A W    D       ++    +  A   + +N    A ++FEK +       + + +N Y
Sbjct: 705 ASWVRNIDFVEVSDADLDNTTYEAAENQYLNNNSAKAIANFEKYIQNFPNGIHSINANFY 764

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLS 154
           +A +    G+ + +   +  V +      + +  A L    +  +   Y     +L+KL 
Sbjct: 765 LAQLYYRDGNVEKSIPNYRYVTSKPKNEFSEQALARLSQIYL--EKKDYTHALPLLEKLE 822

Query: 155 --EPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
               +     FA + L  S  + G   KA    +++  ++ +       +++++A
Sbjct: 823 KQADNEQNVVFAQQNLMKSYFETGNFGKANEYADKVLNNSTAETEARNDARIMVA 877


>gi|268593182|ref|ZP_06127403.1| putative inner membrane protein [Providencia rettgeri DSM 1131]
 gi|291311228|gb|EFE51681.1| putative inner membrane protein [Providencia rettgeri DSM 1131]
          Length = 207

 Score = 45.4 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 60/167 (35%), Gaps = 9/167 (5%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKK---NIVGENFAQALELFNSNKLDDARSSFEKILS 81
              L++ ++      + ++     K        + F        S   D A ++ +K  +
Sbjct: 22  GVALVIGLVIGVGGVFGWNYWQSHKTNVLQESAQKFETVNAQLRSG-SDQAIAAAQKFAA 80

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIF-LKVANDDLAPLAVRYAATLQAASILVDT 140
           + + +Y+ +  + +A I V KGD  NA       +A        ++    L+ A + +  
Sbjct: 81  ETDDVYSAMMGLELAQIAVDKGDLANAQTALTNALAKAKTVD--MQDLINLRLARVQLAQ 138

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
            + +     +  +   S      A ++ G + L  G    AK  + +
Sbjct: 139 GNADGAIASVANI--KSKSWQATAQDVRGDALLHKGDKAGAKAAYTQ 183


>gi|82703490|ref|YP_413056.1| hypothetical protein Nmul_A2375 [Nitrosospira multiformis ATCC
           25196]
 gi|82411555|gb|ABB75664.1| conserved hypothetical protein [Nitrosospira multiformis ATCC
           25196]
          Length = 212

 Score = 45.4 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/132 (14%), Positives = 49/132 (37%), Gaps = 2/132 (1%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y  +  +++ + ++       ++   ++K     E +   L++  S        +   ++
Sbjct: 22  YGTLVIVIVAVFIAGIAGAQAWNYYKKQKTEQALELYDSVLQVQGSGDAKKISDAAGLVM 81

Query: 81  SQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
                  Y   + +  A      GD +N       V  D+     ++  A L+   +L+D
Sbjct: 82  ESFPSSGYASRAALISAQASFNAGDLQNTKNRLQWVL-DNSGEEELKDMARLRLTGVLLD 140

Query: 140 TSSYEEISKILQ 151
              Y+E  ++L+
Sbjct: 141 EEKYDEALRLLE 152


>gi|52143251|ref|YP_083579.1| TPR repeat-containing protein [Bacillus cereus E33L]
 gi|51976720|gb|AAU18270.1| conserved hypothetical protein; TPR-repeat domains [Bacillus cereus
           E33L]
          Length = 891

 Score = 45.0 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 70/184 (38%), Gaps = 11/184 (5%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
               K   K I  +   +++ +      +  +   K     E   QA +     K ++A 
Sbjct: 497 STWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQAYDDKKYTKAEEAV 556

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
                +  +D       + + +A+I VA+G  K A +   K+  D         AA L A
Sbjct: 557 GHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDREIDKENNEAAYLLA 610

Query: 134 ASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           ++       Y+E  +  ++     ++   P  + A   L +S +K  + +KA+ +  +++
Sbjct: 611 SA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMKEFEKAEDVIVKMS 669

Query: 190 KDNN 193
              N
Sbjct: 670 TKTN 673


>gi|301154678|emb|CBW14141.1| conserved protein [Haemophilus parainfluenzae T3T1]
          Length = 204

 Score = 45.0 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 36/195 (18%), Positives = 62/195 (31%), Gaps = 11/195 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E   + N  K   +  K   K I    IL +  +  W Y       +      E +   
Sbjct: 5   IEEEQELNQLK---EWWKDNGKTIIAAFILGVGGMLGWRYWQSYQANQIMQASAE-YDAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   N +         E + + D   Y   S +  A   VAK D  +A     +      
Sbjct: 61  VYTANKDAAAQQAKVAEFVKAHDKTSYAVFSLLDEAKGFVAKQDYASAENSLKQAIAQSQ 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFGKV 178
               +   A L+ +++      ++     L ++          A + L  G   +  G V
Sbjct: 121 DD-ILTSLAALRLSAVQFQQGQFDAALASLNQVKSQG----FSARKDLLAGDIQVAKGDV 175

Query: 179 QKAKTIFEELAKDNN 193
             AK  FE   K+ N
Sbjct: 176 NGAKASFENAQKNGN 190


>gi|54307960|ref|YP_128980.1| hypothetical protein PBPRA0765 [Photobacterium profundum SS9]
 gi|46912386|emb|CAG19178.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 203

 Score = 45.0 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 60/172 (34%), Gaps = 3/172 (1%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
             L  ++ L     +  + G  +  K +  + ++Q +   +S   +        I + ++
Sbjct: 25  VVLGAVIGLGGLYGWRYYQGEVQTTKELTSDAYSQVMTTLDSGSENAVADVQAFISANES 84

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y+ L+ + +A   V   D   A +      +      A+   A  + A I  +   ++
Sbjct: 85  SQYSVLAALQLAKTQVELSDLDGAIKQLTWAISQTK-DQAILPLAQTRLARIYAEQQKFD 143

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           E    L K++           E+ G   L  G V  A+  +    +   SP 
Sbjct: 144 EALAELDKVTA--TSWQSKIAELRGDILLLKGDVIAARKAYISAQQLGASPA 193


>gi|167856484|ref|ZP_02479200.1| hypothetical protein HPS_02663 [Haemophilus parasuis 29755]
 gi|167852393|gb|EDS23691.1| hypothetical protein HPS_02663 [Haemophilus parasuis 29755]
          Length = 206

 Score = 45.0 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/156 (11%), Positives = 47/156 (30%), Gaps = 2/156 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           +   ++      K     I   + L+  +   W Y      E        ++ Q +E + 
Sbjct: 9   EEQQFEEAKSWFKENGTPIVVAIFLVAAATFGWNYWQKHQIEV-AQTTSASYQQVMESYL 67

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
            N   +A    + I    +  Y   + +  A     KGD      +  + +        +
Sbjct: 68  QNPEKNAPLVQKFIAENKDSSYAVFAQLEEAKQAADKGDFATTKTLLTQ-SLGSTTDATL 126

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMH 161
           +     + A++      ++     L ++ + +    
Sbjct: 127 QNVIRFRLATVDYQLKEFDAALATLSQIKDTAWDFR 162


>gi|33593201|ref|NP_880845.1| hypothetical protein BP2197 [Bordetella pertussis Tohama I]
 gi|33563576|emb|CAE42475.1| putative membrane protein [Bordetella pertussis Tohama I]
 gi|332382612|gb|AEE67459.1| hypothetical protein BPTD_2163 [Bordetella pertussis CS]
          Length = 212

 Score = 45.0 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 71/204 (34%), Gaps = 8/204 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFAQALELFNSNKL 69
            +    +     I  L  L++L+   W       + +    +G  E    A  L  ++  
Sbjct: 14  IRAWWARYGTL-ILTLATLVVLAWGGWSGWKAYQNYRANQAMGYFEALEDAARLGGADAA 72

Query: 70  DDARSSFEKILSQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
              +++   + +      Y     +  A  L ++ D   A E    +A      LA++  
Sbjct: 73  TRIKAAAATLRTDYPATGYAGRGALIAAQALQSQQDVDGAREQLEWLAAQAKQ-LALQPV 131

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A L+ A IL+D   Y+     L +L+ P         +  G      GK  +A+  ++  
Sbjct: 132 ARLRLAGILLDQKQYD---AALAQLNNPPASFAALFADRRGDVLAAQGKRDEARAAWQSA 188

Query: 189 AKDNNSPFGISTRSQMILANIIAS 212
                +   ++   Q+ L  +  +
Sbjct: 189 IDGLGTSNPLTQVVQLKLDALSGA 212


>gi|83941779|ref|ZP_00954241.1| thioredoxin [Sulfitobacter sp. EE-36]
 gi|83847599|gb|EAP85474.1| thioredoxin [Sulfitobacter sp. EE-36]
          Length = 306

 Score = 45.0 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 30/139 (21%), Positives = 42/139 (30%), Gaps = 6/139 (4%)

Query: 47  EKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           E     + E  A A ++       DA  +F  IL +D         M  A I + + D  
Sbjct: 128 EAPGEELSEAVAAADDMLAEGATQDALDTFAAILGEDPNHAGAYCGMVRAYIALDQLDQA 187

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANE 166
            A  +         AP      A LQ A    D     E+       +  +NP    A  
Sbjct: 188 EA-HLNGAPIEISKAPELEAAHAQLQLARQAADAGPVAELQA-----AVDANPDDMQARF 241

Query: 167 ILGISALKFGKVQKAKTIF 185
            L  +    G  Q A    
Sbjct: 242 DLAQALYAHGDTQAAVDQL 260


>gi|219871011|ref|YP_002475386.1| hypothetical protein HAPS_0802 [Haemophilus parasuis SH0165]
 gi|219691215|gb|ACL32438.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 206

 Score = 45.0 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/156 (11%), Positives = 47/156 (30%), Gaps = 2/156 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           +   ++      K     I   + L+  +   W Y      E        ++ Q +E + 
Sbjct: 9   EEQQFEEAKSWFKENGTPIVVAIFLVAAATFGWNYWQKHQIEV-AQTTSASYQQVMESYL 67

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
            N   +A    + I    +  Y   + +  A     KGD      +  + +        +
Sbjct: 68  QNPEKNAPLVQKFIAENKDSSYAVFAQLEEAKQAADKGDFATTKTLLTQ-SLGSTTDATL 126

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMH 161
           +     + A++      ++     L ++ + +    
Sbjct: 127 QNVIRFRLATVDYQLKEFDAALATLSQIKDTAWDFR 162


>gi|217972555|ref|YP_002357306.1| hypothetical protein Sbal223_1375 [Shewanella baltica OS223]
 gi|217497690|gb|ACK45883.1| conserved hypothetical protein [Shewanella baltica OS223]
          Length = 206

 Score = 45.0 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 67/190 (35%), Gaps = 7/190 (3%)

Query: 8   NSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSN 67
           ++ + +    K  +K     + +         Y ++   + K     E  ++A     + 
Sbjct: 5   STEEQQVDAIKQFWKDYGTSIFIGAFVGLGGLYAWNYYSDVKVAQAEEA-SKAFHELTTK 63

Query: 68  KLDDA--RSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             D+A   +   +     D K Y  L  + +A   V   D   A E   KV         
Sbjct: 64  SSDEAAMLAGVAEFSKSHDQKGYQALLELIVAKTAVEAKDYSKAIEALNKVIAAKP-GAG 122

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +   ATL+ A I  +    +     L +++          +E+ G   ++ G+V+KAKT 
Sbjct: 123 LDVIATLRVARIQAEQGQIDAALATLDQVT--DKAFFAQRDELKGDFLVRQGEVEKAKTA 180

Query: 185 FEELAKDNNS 194
           ++    +   
Sbjct: 181 YQAAMDNGGV 190


>gi|304410033|ref|ZP_07391652.1| Protein of unknown function DUF2133 [Shewanella baltica OS183]
 gi|307302254|ref|ZP_07582012.1| Protein of unknown function DUF2133 [Shewanella baltica BA175]
 gi|304351442|gb|EFM15841.1| Protein of unknown function DUF2133 [Shewanella baltica OS183]
 gi|306914292|gb|EFN44713.1| Protein of unknown function DUF2133 [Shewanella baltica BA175]
          Length = 206

 Score = 45.0 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 69/190 (36%), Gaps = 7/190 (3%)

Query: 8   NSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSN 67
           ++ + +    K  +K     +++  +      Y ++   + K     E  ++A     + 
Sbjct: 5   STEEQQVDAIKQFWKDYGNSILIGAVVGLGGLYAWNYYSDVKVAQAEEA-SKAFHELTTK 63

Query: 68  KLDDA--RSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             D+A   +   +     D K Y  L  + +A   V   D   A E   KV         
Sbjct: 64  SADEAAMLAGVAEFSKSHDQKGYQALLELIVAKTAVEAKDYPKAIEALNKVIAAKP-GAG 122

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +   ATL+ A I  +    +     L +++          +E+ G   ++ G+V+KAKT 
Sbjct: 123 LDVIATLRVARIQAEQGQIDAALATLDQVT--DKAFFAQRDELKGDFLVRQGEVEKAKTA 180

Query: 185 FEELAKDNNS 194
           ++    +   
Sbjct: 181 YQAAMDNGGV 190


>gi|89890624|ref|ZP_01202134.1| conserved hypothetical protein, TPR domain [Flavobacteria bacterium
           BBFL7]
 gi|89517539|gb|EAS20196.1| conserved hypothetical protein, TPR domain [Flavobacteria bacterium
           BBFL7]
          Length = 1006

 Score = 45.0 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 29/191 (15%), Positives = 57/191 (29%), Gaps = 34/191 (17%)

Query: 35  LAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMY 94
            A W+   D S   +K      F     L  S K ++A+    ++   D+  Y   +  Y
Sbjct: 121 AAKWYEKVDESTLSRKQQSRYYFNTGYTLVQSKKYEEAKPYLNRV--SDDPEYGSQAKYY 178

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVR-------------YAATLQA-------- 133
           +  I     + + A+++F +          +                A   A        
Sbjct: 179 LGYIAYEGDEYQEASDLFDEAGESPDEDEKLSYYQADLNYKLGNFDKAIALATEQLPKST 238

Query: 134 -----------ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
                         L +   Y++    L++       ++      LG +  K G  +KA 
Sbjct: 239 KKEQSELNRIIGQSLFNQGKYDQALPYLEEYKGVRGRLNNNDYYQLGYAYYKQGDFEKAI 298

Query: 183 TIFEELAKDNN 193
             F ++    N
Sbjct: 299 ETFNKIVDGEN 309


>gi|325577798|ref|ZP_08148073.1| chaperone HscA [Haemophilus parainfluenzae ATCC 33392]
 gi|325160543|gb|EGC72669.1| chaperone HscA [Haemophilus parainfluenzae ATCC 33392]
          Length = 204

 Score = 45.0 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 36/195 (18%), Positives = 61/195 (31%), Gaps = 11/195 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E   + N  K   +  K   K I    IL +  +  W Y       +      E +   
Sbjct: 5   IEEEQELNQLK---EWWKDNGKTIIAAFILGVGGMLGWRYWQSYQANQIMQASAE-YDAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   N +         E + + D   Y   S +  A   VAK D  +A     +      
Sbjct: 61  VYTTNKDAAAQQAKMAEFVKAHDKTSYAVFSLLDEAKGFVAKQDYASAENSLKQAIAQSQ 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFGKV 178
               +   A L+ +++      ++     L ++          A + L  G   +  G V
Sbjct: 121 DD-ILTSLAALRLSAVQFQQGQFDAALASLNQVKSQG----FSARKDLLAGDIQIAKGDV 175

Query: 179 QKAKTIFEELAKDNN 193
             AK  FE   K  N
Sbjct: 176 NGAKASFENAQKSGN 190


>gi|158522425|ref|YP_001530295.1| TPR repeat-containing protein [Desulfococcus oleovorans Hxd3]
 gi|158511251|gb|ABW68218.1| TPR repeat-containing protein [Desulfococcus oleovorans Hxd3]
          Length = 589

 Score = 45.0 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 51/124 (41%), Gaps = 8/124 (6%)

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN-D 118
           A  L    ++D+A + + + LS D +     +N+  A +    GD + AA  F +    D
Sbjct: 433 ADTLLEKGRIDEAIAFYRQALSMDPENALVHNNLGAAFLKA--GDRQRAAAGFRQALKYD 490

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKV 178
              P+A          ++LV+    +E     +K   P NP    A+  +  +  + G+ 
Sbjct: 491 PGHPMAGNNL-----GNLLVEMGRTDEAIACFEKTLTPDNPFLYKAHNNIATAFARKGEF 545

Query: 179 QKAK 182
            KA 
Sbjct: 546 DKAV 549


>gi|83855257|ref|ZP_00948787.1| thioredoxin [Sulfitobacter sp. NAS-14.1]
 gi|83843100|gb|EAP82267.1| thioredoxin [Sulfitobacter sp. NAS-14.1]
          Length = 306

 Score = 45.0 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 30/139 (21%), Positives = 42/139 (30%), Gaps = 6/139 (4%)

Query: 47  EKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           E     + E  A A ++       DA  +F  IL +D         M  A I + + D  
Sbjct: 128 EAPGEELSEAVAAADDMLAEGAAQDALDTFAAILGEDPNHAGAYGGMVRAYIALDQLDQA 187

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANE 166
            A  +         AP      A LQ A    D     E+       +  +NP    A  
Sbjct: 188 EA-HLNGAPIEISKAPELEAAHAQLQLARQAADAGPVAELQA-----AVDANPNDMQARF 241

Query: 167 ILGISALKFGKVQKAKTIF 185
            L  +    G  Q A    
Sbjct: 242 DLAQALYAHGDTQAAVDQL 260


>gi|228985300|ref|ZP_04145463.1| TPR repeat-containing protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228774455|gb|EEM22858.1| TPR repeat-containing protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 891

 Score = 45.0 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 69/184 (37%), Gaps = 11/184 (5%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
               K   K I  +    ++ +      +  +   K     E   QA +     K ++A 
Sbjct: 497 STWWKKNKKRILIIGSTAVVVIGGSTLFYFYTTNAKYQKFMEQARQAYDDKKYTKAEEAV 556

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
                +  +D       + + +A+I VA+G  K A +   K+  D         AA L A
Sbjct: 557 GQAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDREIDKENNEAAYLLA 610

Query: 134 ASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           ++       Y+E  +  ++     ++   P  + A   L +S +K  + +KA+ +  +++
Sbjct: 611 SA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMKEFEKAEDVIVKMS 669

Query: 190 KDNN 193
              N
Sbjct: 670 TKTN 673


>gi|323698093|ref|ZP_08110005.1| protein of unknown function DUF181 [Desulfovibrio sp. ND132]
 gi|323458025|gb|EGB13890.1| protein of unknown function DUF181 [Desulfovibrio desulfuricans
           ND132]
          Length = 575

 Score = 45.0 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 50/139 (35%), Gaps = 5/139 (3%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L      D+A    + +       Y  L       + +  GD   AA  F +  +   A 
Sbjct: 400 LAEDADFDEALEGLDVLEEIYPGAY-FLPFFR-GLLALRMGDPLYAAACFEESVDLQPAD 457

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  A    A  L    ++EE  ++L +         +F N + G++  K G+ + A 
Sbjct: 458 AE-RGLAVFYQAYALSQMEAWEETVELLDRAVSLDRECREFFN-LRGVAHFKGGRYELAA 515

Query: 183 TIF-EELAKDNNSPFGIST 200
             F   L  D+ SP  ++ 
Sbjct: 516 EDFKASLDIDSGSPHDLAN 534


>gi|229155791|ref|ZP_04283897.1| TPR repeat-containing protein [Bacillus cereus ATCC 4342]
 gi|228627777|gb|EEK84498.1| TPR repeat-containing protein [Bacillus cereus ATCC 4342]
          Length = 891

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 69/184 (37%), Gaps = 11/184 (5%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
               K   K I  +    ++ +      +  +   K     E   QA +     K ++A 
Sbjct: 497 STWWKKNKKRILIIGSTAVVVIGGSTLFYFYTTNAKYQKFMEQARQAYDDKKYTKAEEAV 556

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
                +  +D       + + +A+I VA+G  K A +   K+  D         AA L A
Sbjct: 557 GQAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDREIDKENNEAAYLLA 610

Query: 134 ASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           ++       Y+E  +  ++     ++   P  + A   L +S +K  + +KA+ +  +++
Sbjct: 611 SA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMKEFEKAEDVIVKMS 669

Query: 190 KDNN 193
              N
Sbjct: 670 TKTN 673


>gi|83644117|ref|YP_432552.1| thioredoxin domain-containing protein [Hahella chejuensis KCTC
           2396]
 gi|83632160|gb|ABC28127.1| Thioredoxin domain-containing protein [Hahella chejuensis KCTC
           2396]
          Length = 287

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 57/157 (36%), Gaps = 9/157 (5%)

Query: 58  AQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
            QA  L    +   A +   +    D      L ++  A++ VA G+   A+ I   +  
Sbjct: 121 EQARALVEQGQAAQALAMLTEANQADPNNMEILVDI--AAVKVALGEKDEASTILSSLPA 178

Query: 118 D-DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
           D    P   +  A ++        +   +I + LQ  +  +      A   L + A+   
Sbjct: 179 DIQGRPDVKQLLARIRFVEKAGAIAPLADIQQRLQANAADAE-----ARFQLALHAIMNN 233

Query: 177 KVQKAKT-IFEELAKDNNSPFGISTRSQMILANIIAS 212
           K + A   +   +  D +     + ++ + L +++ +
Sbjct: 234 KFEDAVEALLNLMQTDRSYGDDAARKTLIELFDMLGA 270


>gi|303256839|ref|ZP_07342853.1| tetratricopeptide repeat protein [Burkholderiales bacterium 1_1_47]
 gi|330998914|ref|ZP_08322641.1| tetratricopeptide repeat protein [Parasutterella excrementihominis
           YIT 11859]
 gi|302860330|gb|EFL83407.1| tetratricopeptide repeat protein [Burkholderiales bacterium 1_1_47]
 gi|329576128|gb|EGG57647.1| tetratricopeptide repeat protein [Parasutterella excrementihominis
           YIT 11859]
          Length = 389

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 30/148 (20%), Positives = 59/148 (39%), Gaps = 12/148 (8%)

Query: 27  LLILMILSLAIWF-YLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNK 85
           L+++ +L  A WF   FD   ++      +   + ++L  SNK D A  +F  ++  D  
Sbjct: 8   LILVPLLFAAGWFARSFDIKEKQTIANEKDTLYKGVDLLLSNKQDQAIDAFINLVKLDPD 67

Query: 86  LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEE 145
                 +  +A +   +G+   A +I   + N +  P  +R     +A   L +      
Sbjct: 68  TVEM--HFSLAGLFRRRGEFDRAIKIHNVLVNREDLPKKIRS----RALYELGEDYLKAG 121

Query: 146 ISKILQK----LSEPSNPMHQFAN-EIL 168
           +    ++    LS+ S      A  E+L
Sbjct: 122 LWDRAEECFLKLSDTSESYKTIARKELL 149


>gi|225864173|ref|YP_002749551.1| TPR domain protein [Bacillus cereus 03BB102]
 gi|225789433|gb|ACO29650.1| tetratricopeptide repeat protein [Bacillus cereus 03BB102]
          Length = 891

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 70/175 (40%), Gaps = 16/175 (9%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFE-KILSQ 82
           I    +++I    ++++    +  +K         QA + ++  K   A  +    I  +
Sbjct: 510 IGSAAVVVIGGSTLFYFYTTNAKYQKF------MEQARQAYDDKKYTKAEEAVGHAIAVK 563

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSS 142
                   + + +A+I VA+G  K A +   K+  D         AA L A++       
Sbjct: 564 G----KDEAYLQLATIYVAEGKNKIAIDYITKLIKDREIDKENNEAAYLLASA-NFRIGK 618

Query: 143 YEEISKILQKL----SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           Y+E  +  ++     ++   P  + A   L +S +K  + +KA+ +  +++   N
Sbjct: 619 YQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMKEFEKAEDVIVKMSTKTN 673


>gi|229587866|ref|YP_002869985.1| cellulose synthase operon protein C [Pseudomonas fluorescens SBW25]
 gi|22001533|sp|P58937|BCSC_PSEFS RecName: Full=Cellulose synthase operon protein C; Flags: Precursor
 gi|18535635|gb|AAL71845.1| WssE [Pseudomonas fluorescens]
 gi|229359732|emb|CAY46581.1| cellulose synthase operon protein C precursor [Pseudomonas
           fluorescens SBW25]
          Length = 1279

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 58/152 (38%), Gaps = 12/152 (7%)

Query: 54  GENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL 113
           G   A A      N+ DDA + + K+L++     + LS +   ++L   G    A ++  
Sbjct: 385 GAAIALAGFQAQDNQFDDAEAGYRKVLARHPGDPDALSGLI--NVLSQSGQPDEALKLID 442

Query: 114 KVA-NDDLAPLAVRYAATLQAASILVDTSSYEEISK-----ILQKLSEPSNPMHQFANEI 167
            V+               L+A  +        ++            ++P NP  +FA   
Sbjct: 443 SVSPAQRAKFAPSVKINALRATQVGKLAEQRGDLKAAQAAYRQALDADPENPWTRFA--- 499

Query: 168 LGISALKFGKVQKAKTIFEELAKD-NNSPFGI 198
           L    L+ G+++ A+ + + L K   N P  +
Sbjct: 500 LARMYLRDGQIRNARALIDGLLKSQPNQPDAL 531


>gi|298709901|emb|CBJ26241.1| putative methyltransferase [Ectocarpus siliculosus]
          Length = 1611

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 29/169 (17%), Positives = 61/169 (36%), Gaps = 11/169 (6%)

Query: 51  NIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLY---NPLSNMYIASILVAKGDTKN 107
           +        A+ L    + ++AR    ++L  +   +      +   +A +    GD   
Sbjct: 328 SDASVALEVAVALHRLGRTEEARGRLTEVLEMEGGQHGTTRDFARSNLAVLKQESGDIPG 387

Query: 108 AAEIFLKVANDDLAP-LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANE 166
           A E +  V  +     +A+        A    D         +L+K S   +P       
Sbjct: 388 AIEGYRAVLAESPKNCVALNNLGVALLALGQQDEG-----LSMLEK-SFELDPFEPDVLV 441

Query: 167 ILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
            LGI   + G + +A++ +   A+      G+  R  ++L  I+A ++ 
Sbjct: 442 NLGIHWQEDGDLDRARSFYTR-AERLRRNDGLPVRRAIMLQPIMAGERE 489


>gi|126175190|ref|YP_001051339.1| hypothetical protein Sbal_2988 [Shewanella baltica OS155]
 gi|125998395|gb|ABN62470.1| conserved hypothetical protein [Shewanella baltica OS155]
          Length = 206

 Score = 44.6 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 32/190 (16%), Positives = 68/190 (35%), Gaps = 7/190 (3%)

Query: 8   NSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSN 67
           ++ + +    K  +      +++  +      Y ++   + K     E  ++A     + 
Sbjct: 5   STEEQQVDAIKQFWTDYGNSILIGAVVGLGGLYAWNYYSDVKVAQAEEA-SKAFHELTTK 63

Query: 68  KLDDA--RSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             D+A   +   +     D K Y  L  + +A   V   D   A E   KV         
Sbjct: 64  SADEAAMLAGVAEFSKSHDQKGYQALLELIVAKTAVEAKDYPKAIEALNKVIAAKP-GAG 122

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +   ATL+ A I  +    +     L +++          +E+ G   ++ G+V+KAKT 
Sbjct: 123 LDVIATLRVARIQAEQGQIDAALATLDQVT--DKAFFAQRDELKGDFLVRQGEVEKAKTA 180

Query: 185 FEELAKDNNS 194
           ++    +   
Sbjct: 181 YQAAMDNGGV 190


>gi|78484968|ref|YP_390893.1| hypothetical protein Tcr_0623 [Thiomicrospira crunogena XCL-2]
 gi|78363254|gb|ABB41219.1| conserved hypothetical protein [Thiomicrospira crunogena XCL-2]
          Length = 213

 Score = 44.6 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 33/214 (15%), Positives = 76/214 (35%), Gaps = 14/214 (6%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
           ++      K    K   + ++ +L+ ++L+   W Y  +    K  N         ++  
Sbjct: 7   DEEQVEAIKSWWKKNGTQLLSGILV-IVLAWTGWTYWQNTQTTKALNASAVFEVMQVKQS 65

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            +   D  R   + +  Q +  Y     + IA     +     A E +           +
Sbjct: 66  QNALGDVLRDGLKLMEEQPDSPYASGVALMIAKHYFDEKAFDKAIENYQWTIEHAP-DHS 124

Query: 125 VRYAATLQAASILVDTSSYEE-------ISKILQKLSEPSNPMHQFANEILGISALKFGK 177
           ++  A L+  ++ V    +E+       + +    L+E  N   Q A       AL  G 
Sbjct: 125 IQLIARLRLVTVYVQEKMFEKADQVLAGVDQKALSLAEKGNYDFQVAE-----LALTEGD 179

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           + +AK  +  +  +  +P  +   +++ LA++  
Sbjct: 180 LSQAKEAYNRVISNAEAPESVQNLARLKLADLAG 213


>gi|52841773|ref|YP_095572.1| transmembrane protein [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52628884|gb|AAU27625.1| transmembrane protein [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 224

 Score = 44.6 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 67/178 (37%), Gaps = 6/178 (3%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      K    +  Y  +  + + ++L +   +   +  ++K K      +   +  F
Sbjct: 7   EEEQLEIIKKWWKR--YGNMITIFLSIMLLIIAGYRYMNWHNDKIKQQASIAYENMMIAF 64

Query: 65  NSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
           ++  +   RS   +++   ++ +Y  +++M +A I V K   + A      VA+ +    
Sbjct: 65  SNQNIKSVRSYANELIKNYNHTVYADIAHMTLAKIYVNKNKLEQARNELKAVAS-ESQMT 123

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
            +R  A ++ A +L    +Y      L   +          NE+ G      G+ Q A
Sbjct: 124 PLRQIAKIRIARLLAADKAYTNALNELS--AVEDEAYLPVINELKGDIYSAKGQYQDA 179


>gi|291613142|ref|YP_003523299.1| hypothetical protein Slit_0672 [Sideroxydans lithotrophicus ES-1]
 gi|291583254|gb|ADE10912.1| TPR repeat-containing protein [Sideroxydans lithotrophicus ES-1]
          Length = 345

 Score = 44.6 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 45/119 (37%), Gaps = 9/119 (7%)

Query: 52  IVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEI 111
              ++   A +LF   +   A       L+   K  +  +      I   +G+T +A  +
Sbjct: 23  AQADDLQDANKLFKQGEHAQAMEKVNAYLATKPK--DAQARFLKGLIFAEQGNTTDAITV 80

Query: 112 FLKVAND-DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILG 169
           F  +  D    P      A L A         YE+  + L+ ++  +NP +  A+E LG
Sbjct: 81  FNNLTQDYPELPEPYNNLAVLYAGQ-----GQYEKAKEELE-MAIRTNPSYATAHENLG 133


>gi|148359077|ref|YP_001250284.1| transmembrane protein [Legionella pneumophila str. Corby]
 gi|296107125|ref|YP_003618825.1| putative protein conserved in bacteria [Legionella pneumophila
           2300/99 Alcoy]
 gi|148280850|gb|ABQ54938.1| transmembrane protein [Legionella pneumophila str. Corby]
 gi|295649026|gb|ADG24873.1| putative protein conserved in bacteria [Legionella pneumophila
           2300/99 Alcoy]
          Length = 224

 Score = 44.6 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 68/178 (38%), Gaps = 6/178 (3%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      K    +  Y  +  + + ++L +   +   +  ++K K      +   +  F
Sbjct: 7   EEEQLEIIKKWWKR--YGNMITIFLSIMLLIIAGYRYMNWHNDKIKQQASIAYENMMIAF 64

Query: 65  NSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
           ++  +   RS   +++   ++ +Y  +++M +A I V+K   + A      VA+ +    
Sbjct: 65  SNQNIKSVRSYANELIKNYNHTVYADIAHMTLAKIYVSKNKLEQARNELKAVAS-ESQMT 123

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
            +R  A ++ A +L    +Y      L   +          NE+ G      G+ Q A
Sbjct: 124 PLRQIAKIRIARLLAADKAYTNALNELS--AVEDEAYLPVINELKGDIYSAKGQYQDA 179


>gi|118477622|ref|YP_894773.1| TPR repeat-containing protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|229184430|ref|ZP_04311637.1| TPR repeat-containing protein [Bacillus cereus BGSC 6E1]
 gi|118416847|gb|ABK85266.1| TPR-repeat containing protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|228599226|gb|EEK56839.1| TPR repeat-containing protein [Bacillus cereus BGSC 6E1]
          Length = 891

 Score = 44.6 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 70/175 (40%), Gaps = 16/175 (9%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFE-KILSQ 82
           I    +++I    ++++    +  +K         QA + ++  K   A  +    I  +
Sbjct: 510 IGSAAVVVIGGSTLFYFYTTNAKYQKF------MEQARQAYDDKKYTKAEEAVGHAIAVK 563

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSS 142
                   + + +A+I VA+G  K A +   K+  D         AA L A++       
Sbjct: 564 G----KDEAYLQLATIYVAEGKNKIAIDYITKLIKDREIDKENNEAAYLLASA-NFRIGK 618

Query: 143 YEEISKILQKL----SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           Y+E  +  ++     ++   P  + A   L +S +K  + +KA+ +  +++   N
Sbjct: 619 YQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMKEFEKAEDVIVKMSTKTN 673


>gi|113969574|ref|YP_733367.1| hypothetical protein Shewmr4_1230 [Shewanella sp. MR-4]
 gi|114046807|ref|YP_737357.1| hypothetical protein Shewmr7_1301 [Shewanella sp. MR-7]
 gi|113884258|gb|ABI38310.1| conserved hypothetical protein [Shewanella sp. MR-4]
 gi|113888249|gb|ABI42300.1| conserved hypothetical protein [Shewanella sp. MR-7]
          Length = 206

 Score = 44.6 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 61/193 (31%), Gaps = 8/193 (4%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ-AL 61
           S  +      K          +    ++ +  L  W Y  D     K     + F     
Sbjct: 5   STEEQQVDAIKQFWKDYGTSIVIG-AVVGLGGLYGWNYYSD-MKIVKAEEASQAFQTLTT 62

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +  +   +    + F K  + D K Y  L ++ +A   V   D   A E   KV      
Sbjct: 63  KSSDEAAMLAGVAEFSK--NHDQKGYQALLDLIVAKTAVEAKDFPKAEEALKKVIAAKP- 119

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +   ATL+ A I  +          L +++           E+ G   ++ G+  KA
Sbjct: 120 GAGLDTVATLRLARIQAEQGQIGTALATLDQVT--DKAFLAQREELKGDFFVRQGEADKA 177

Query: 182 KTIFEELAKDNNS 194
           KT ++    +   
Sbjct: 178 KTAYQAAMDNGGV 190


>gi|329897035|ref|ZP_08271807.1| membrane protein [gamma proteobacterium IMCC3088]
 gi|328921475|gb|EGG28861.1| membrane protein [gamma proteobacterium IMCC3088]
          Length = 227

 Score = 44.6 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 19/136 (13%), Positives = 43/136 (31%), Gaps = 7/136 (5%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS-SFEKILSQ 82
           +   +++ +L    W    D     +       + + L L       DA     +++ + 
Sbjct: 25  VIAAVVIGVLGSVGWQSWQD-RQVSQAEAASGIYQELLALSAQELSSDADKVRLDELTAT 83

Query: 83  -----DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
                    Y  L  +   S  V++G  + A      + +     +A+     L+ A + 
Sbjct: 84  LTEDYAGTGYARLGQLLQVSAWVSQGRAEEALTALQALESSVADDVAMYPIVKLRRARLQ 143

Query: 138 VDTSSYEEISKILQKL 153
                 E+  + L  L
Sbjct: 144 ASLGDTEQALQALTSL 159


>gi|157964298|ref|YP_001499122.1| hypothetical protein RMA_0319 [Rickettsia massiliae MTU5]
 gi|157844074|gb|ABV84575.1| hypothetical protein RMA_0319 [Rickettsia massiliae MTU5]
          Length = 221

 Score = 44.6 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 24/171 (14%), Positives = 66/171 (38%), Gaps = 6/171 (3%)

Query: 48  KKKNIVGENFAQALELFNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           K     G+   + + L  +   ++   ++ E +++  N     ++ +   +I +++    
Sbjct: 51  KNNQKNGDILVKTVGLKTTKDNEELVFNTLENLVTTSNTKIKEIAALAQVAIKISEKKYS 110

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE-----EISKILQKLSEPSNPMH 161
            A ++  K+  +          A +    +++D  + +     +++K L    +   P  
Sbjct: 111 EAKDLLNKIIENKEYSEISTSYARISWCGLVIDDQNLDIQDKEKLTKYLNYFDDEKKPFW 170

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
             A  I  +  +K     +A+   + L   NN    I  +++ +L N+  S
Sbjct: 171 ATATIIKAMWDIKNNMKPQAEKNLKNLLISNNVSDLIKDQAKALLVNLNKS 221


>gi|117919680|ref|YP_868872.1| hypothetical protein Shewana3_1231 [Shewanella sp. ANA-3]
 gi|117612012|gb|ABK47466.1| conserved hypothetical protein [Shewanella sp. ANA-3]
          Length = 206

 Score = 44.6 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 61/193 (31%), Gaps = 8/193 (4%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ-AL 61
           S  +      K          +    ++ +  L  W Y  D     K     + F     
Sbjct: 5   STEEQQVDAIKQFWKDYGTSIVIG-AVVGLGGLYGWNYYSDMK-IVKAEEASQAFQTLTT 62

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           +  +   +    + F K  + D K Y  L ++ +A   V   D   A E   KV      
Sbjct: 63  KSSDEAAMLAGVAEFSK--NHDQKGYQALLDLIVAKTAVEAKDFAKAEEALKKVIAAKP- 119

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +   ATL+ A I  +          L +++           E+ G   ++ G+  KA
Sbjct: 120 GAGLDTVATLRLARIQAEQGQIGTALATLDQVT--DKAFLAQREELKGDFFVRQGEADKA 177

Query: 182 KTIFEELAKDNNS 194
           KT ++    +   
Sbjct: 178 KTAYQAAMDNGGV 190


>gi|218885715|ref|YP_002435036.1| hypothetical protein DvMF_0611 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756669|gb|ACL07568.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 231

 Score = 44.6 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 30/195 (15%), Positives = 74/195 (37%), Gaps = 10/195 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           ++IA  L +++L+          + +K +    +     +    +++L     + E  L+
Sbjct: 43  RYIAAGLGVLVLAAGAGAGYRWWAADKAREAQADLGMITVTKTGADRLQ----ALEAFLT 98

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           +          + +A+  + + D   AA  + ++A    A  A+   A +  A  L    
Sbjct: 99  KAPSGVRNAVLLDLAAAAMEQKDYDKAASAWERLAA---ADGAIGVVARIGRAQALSQAG 155

Query: 142 SYEEISKILQKLSEPSNPM-HQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG--I 198
              E   +L+ L    + +        L + A + GK+ +A   +E+L    ++      
Sbjct: 156 KDAEALTVLEGLESSVSEISRNAVRGQLAVVAERAGKLDRAVAAYEQLMASESAGNKDYF 215

Query: 199 STRSQMILANIIASD 213
            +R++ + A +    
Sbjct: 216 KSRAEALKARMQKGG 230


>gi|225848002|ref|YP_002728165.1| tetratricopeptide repeat domain protein [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225644404|gb|ACN99454.1| tetratricopeptide repeat domain protein [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 921

 Score = 44.2 bits (103), Expect = 0.011,   Method: Composition-based stats.
 Identities = 28/174 (16%), Positives = 69/174 (39%), Gaps = 15/174 (8%)

Query: 33  LSLAIWFYLFDGSHEKKKNIVGENFAQALELF---NSNKLDDARSSFEKILSQDNKLYNP 89
           L+ +I+    +   ++K     E    A  L       +  +     E  +      Y  
Sbjct: 606 LARSIYKEFIEKYKDRK-----EAVDAAYNLVLLETKGENQEKDKIIEDFI-SKYPDYPL 659

Query: 90  L--SNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEIS 147
           +    + +ASI   KG+ + A +I+ +++N +     +   A  + A I   +   ++  
Sbjct: 660 VNTLKLQLASIYEEKGEIEKAIKIYQQLSNSNDKDSLL---AKYKLAEIYEKSGQNDKAK 716

Query: 148 KILQKLSEP-SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
           +IL  +       +   ++ +L     K   + +A  I++ ++ +++  F +ST
Sbjct: 717 EILLNIINSQDQDIRFKSSLLLAQIYEKESNLDQAIQIYQSISDNDDVKFKLST 770


>gi|197285698|ref|YP_002151570.1| hypothetical protein PMI1843 [Proteus mirabilis HI4320]
 gi|227356209|ref|ZP_03840598.1| tetratricopeptide TPR_4 [Proteus mirabilis ATCC 29906]
 gi|194683185|emb|CAR43823.1| putative membrane protein [Proteus mirabilis HI4320]
 gi|227163673|gb|EEI48589.1| tetratricopeptide TPR_4 [Proteus mirabilis ATCC 29906]
          Length = 206

 Score = 44.2 bits (103), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 49/132 (37%), Gaps = 8/132 (6%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           I   +++ +  +  W Y       + +   GE     +    +    +  +  EK +S+ 
Sbjct: 25  IILAIVIGVGGIWGWKYWQSHQANRLQESAGE--FATINEALTKPTPENIALAEKFVSET 82

Query: 84  NKLYNPLSNMYIASILVAKGDTKNA----AEIFLKVANDDLAPLAVRYAATLQAASILVD 139
           N +Y  L+++ +A + +   D         +    V N+  A +     A +Q A    D
Sbjct: 83  NDIYGALASLELAQLAIDANDLAKGETHLTKAISMVKNEAFADMLNLRLARVQLALDKTD 142

Query: 140 TS--SYEEISKI 149
            +  S E++   
Sbjct: 143 AALISLEQVKSK 154


>gi|237800046|ref|ZP_04588507.1| hypothetical protein POR16_14512 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331022901|gb|EGI02958.1| hypothetical protein POR16_14512 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 213

 Score = 44.2 bits (103), Expect = 0.011,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 58/164 (35%), Gaps = 4/164 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ-D 83
             L ++++L    W     G  +    +  +    AL                K+ S+  
Sbjct: 27  GLLALVVVLGWQGWQRYQAGQSQGASMLYQQLLETALTPSGQADTARVAELSGKLKSEFG 86

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y    ++++A + V  G   +AA     VA D  A   +   A  + A ++   +  
Sbjct: 87  GTTYAQFGSLFVAKVAVDAGKLDDAAAELKTVA-DKPANDTLGEVARQRLARVMAAQNKV 145

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           ++  K+L   +           E+ G   ++ G+  +A   +++
Sbjct: 146 DDALKLLDGDA--DKAFLASREELKGDLLVQLGRTDEAHAAYQK 187


>gi|332290666|ref|YP_004429275.1| Tetratricopeptide TPR_1 repeat-containing protein [Krokinobacter
           diaphorus 4H-3-7-5]
 gi|332168752|gb|AEE18007.1| Tetratricopeptide TPR_1 repeat-containing protein [Krokinobacter
           diaphorus 4H-3-7-5]
          Length = 1006

 Score = 44.2 bits (103), Expect = 0.012,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 48/131 (36%), Gaps = 4/131 (3%)

Query: 64  FNSNKLDDARSSFEKILSQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVAND-DLA 121
            + NK D A ++++K++       Y   + +  A IL  K  +  A  +  KVA D    
Sbjct: 623 VSQNKNDQAITAYDKLVRDLPGSSYVSKAMLKKALILDNKNKSDEALALLRKVAGDYPGT 682

Query: 122 PLAVRYAATLQAASILVDTSS-YEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           P A++   T +   I +     Y +    L  +      +   A             V +
Sbjct: 683 PEALQAVTTAKLIYIDLGRVDEYGQWVSTLDFIDVEDAELDDAAY-ASAEKQYVENNVGQ 741

Query: 181 AKTIFEELAKD 191
           A+ +FE    D
Sbjct: 742 AERLFESYLSD 752


>gi|320095711|ref|ZP_08027365.1| hypothetical protein HMPREF9005_1977 [Actinomyces sp. oral taxon
           178 str. F0338]
 gi|319977361|gb|EFW09050.1| hypothetical protein HMPREF9005_1977 [Actinomyces sp. oral taxon
           178 str. F0338]
          Length = 834

 Score = 44.2 bits (103), Expect = 0.012,   Method: Composition-based stats.
 Identities = 29/165 (17%), Positives = 68/165 (41%), Gaps = 23/165 (13%)

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNP------LSNMYIASILVAKGDTKNAAEIFL 113
           A  L    ++ +A   F ++L+   +++        ++   +A + +  G    A  ++ 
Sbjct: 633 AGALLAVGRVGEAVVMFRELLADRLRVFGADHSVTIVARKSLAGVCLVAGCVDEAVALYE 692

Query: 114 KVAND------DLAPLAVRYAATL----QAASILVDTSS-YEEISKILQKLSEPSNPMHQ 162
           +V  D         P  V    +L    ++A  L D  + Y+++     ++  P +P   
Sbjct: 693 EVVADQLRVLGPDHPDTVASRGSLAGACRSAGRLADAITLYKDVVADQLRVLGPDHPDTL 752

Query: 163 FANEILGISALKFGKVQKAKTIFEELAKD------NNSPFGISTR 201
            +   L  +  + G + +A T+FE++  D       N P+ +++R
Sbjct: 753 ASRGSLAGACWEAGHLDEAITLFEQVLADQLRVLGPNHPYTVASR 797


>gi|239817407|ref|YP_002946317.1| hypotheticalprotein [Variovorax paradoxus S110]
 gi|239803984|gb|ACS21051.1| TPR repeat-containing protein [Variovorax paradoxus S110]
          Length = 393

 Score = 44.2 bits (103), Expect = 0.013,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 39/108 (36%), Gaps = 9/108 (8%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL-A 121
           L  + KLD+A +  +  L    K  +P        I +  G    A   F ++  D    
Sbjct: 44  LMQAGKLDEAMTRADAFLKDKPK--DPQMRFLKGVIQLDTGKRAEAIAAFTQLTQDAPEL 101

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILG 169
           P      A + A+    D +        L+  +  +NP +  A E LG
Sbjct: 102 PEPYNNLAVIYASQNQFDKA-----RSALES-AIRTNPSYATAQENLG 143


>gi|83312205|ref|YP_422469.1| methyltransferase [Magnetospirillum magneticum AMB-1]
 gi|82947046|dbj|BAE51910.1| Predicted methyltransferase [Magnetospirillum magneticum AMB-1]
          Length = 394

 Score = 44.2 bits (103), Expect = 0.013,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 51/159 (32%), Gaps = 18/159 (11%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           E    ALEL   + +D A  +F++I +        L  +   + L      + A  +F  
Sbjct: 31  EAIQSALELVAQDDIDGALRAFDRIEASVPGDATVL-RLRAQTYLKVGQYAEAARILFGL 89

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQK----LSEPSNPMHQFANEILGI 170
           V  D                  LV   +Y +I  +  +    ++         A   LG+
Sbjct: 90  VRADPKVDPIF-DL-----VWALVHARAYVDIVGVCAEYKHVIAGDK---RFLA--ALGM 138

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
           +    G+ Q A     +       P     R  + +A +
Sbjct: 139 AQTALGRYQDALATLSQ--AREVLPRDFYVRHNLSIALL 175


>gi|30249415|ref|NP_841485.1| TPR repeat-containing protein [Nitrosomonas europaea ATCC 19718]
 gi|30138778|emb|CAD85355.1| TPR repeat [Nitrosomonas europaea ATCC 19718]
          Length = 929

 Score = 44.2 bits (103), Expect = 0.014,   Method: Composition-based stats.
 Identities = 44/176 (25%), Positives = 75/176 (42%), Gaps = 17/176 (9%)

Query: 47  EKKKNIVGENFAQALELF----NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAK 102
            +  +I  + F     L       N  + A+  FE +L +D K    ++ +  A I +A+
Sbjct: 501 NQALSIQSDYFPAISNLARIDMQENHPEAAQQRFEDVLKRDKKNVQAMNAL--AGIALAR 558

Query: 103 GDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV-DTSSYEEISKILQKLSEPSNPMH 161
           G+ + A     K + ++  P  ++ A  L A  + V D      ++K LQ +    +P +
Sbjct: 559 GNKEEATGWLEKASREN--PDELQPALQLGAHYLAVNDPGKSLALAKKLQGI----HPDN 612

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
               E+L  S L  G    A   F++LA     P      +Q+ LA I +S Q NK
Sbjct: 613 LSIVELLARSYLATGDKDAALENFQKLA--ARLPDSAP--AQLQLAQIYSSMQNNK 664


>gi|319787001|ref|YP_004146476.1| hypothetical protein Psesu_1398 [Pseudoxanthomonas suwonensis 11-1]
 gi|317465513|gb|ADV27245.1| Protein of unknown function DUF2133 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 207

 Score = 44.2 bits (103), Expect = 0.014,   Method: Composition-based stats.
 Identities = 30/211 (14%), Positives = 81/211 (38%), Gaps = 19/211 (9%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYL--FDGSHEKKKNIVGENFA 58
           M  ++  + ++   ++     K +  ++  + L LA  + +  +   +   +      + 
Sbjct: 1   MAIDDLLDEHEQGERVRAWLRKNLPGIIAGLALGLAAIWGMRQWQERNLGAQQQAHAAYT 60

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
           QAL    + + D   +     L+    +Y  L  +++A   V  G T++A      +  +
Sbjct: 61  QALAKVEAGEEDPGAA-----LAGHEGVYATLGALHVAKAQVEAGKTEDAITTLRGIKAE 115

Query: 119 DLA-PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
               P+  +  A L AA+   D +        ++ L    + +     E+   + +  GK
Sbjct: 116 PELEPVVKQRLAQLLAATGKADEA--------VKLLEGDDSGLGL---ELRADALVAAGK 164

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILAN 208
            ++A+  ++   +  ++      R ++ L +
Sbjct: 165 PEEARAQYQRALEVLDAEAPARRRIELKLQD 195


>gi|300704412|ref|YP_003746015.1| hypothetical protein RCFBP_20216 [Ralstonia solanacearum CFBP2957]
 gi|299072076|emb|CBJ43408.1| conserved protein of unknown function [Ralstonia solanacearum
           CFBP2957]
          Length = 211

 Score = 44.2 bits (103), Expect = 0.014,   Method: Composition-based stats.
 Identities = 26/163 (15%), Positives = 63/163 (38%), Gaps = 7/163 (4%)

Query: 27  LLILMILSLAIWFYLFDGSHEKKKNIVG--ENFAQALELFNSNKLDDARSSFEKILSQDN 84
           + I+++L++A W    +   ++        E   +A++  ++ K+  A +  E       
Sbjct: 28  VAIVVLLAVAAWLGWKNWQRKQAAEATVLYEQVQKAVDAKDAEKIKRAAADMED--KFGR 85

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y  ++ +  A  L    D   A +  L+   D  +    +  A L+ A +L+D  +Y+
Sbjct: 86  TAYAQMTALSAAKALYEASDAAGA-KAQLQWTIDHASDDEYKAVAKLRLAGLLLDEKAYD 144

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           +   ++     P+            ++A    K   A+  ++ 
Sbjct: 145 QGLALVSGDVAPAFAALYADRRGDLLAA--QNKRDDARAAYKL 185


>gi|87307368|ref|ZP_01089513.1| hypothetical protein DSM3645_17635 [Blastopirellula marina DSM
           3645]
 gi|87290108|gb|EAQ81997.1| hypothetical protein DSM3645_17635 [Blastopirellula marina DSM
           3645]
          Length = 1065

 Score = 44.2 bits (103), Expect = 0.014,   Method: Composition-based stats.
 Identities = 28/157 (17%), Positives = 54/157 (34%), Gaps = 5/157 (3%)

Query: 56  NFAQALELFNSNKLDDARSSFE-KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
            +      +       A  +F  +     N      ++      L  K    +A   + +
Sbjct: 817 AYKLGWAQYQQRDYAAASDAFAVQTSKYPNGPLAADASFMRGECLYKKDQFADALSAYGQ 876

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL--SEPSNPMHQFANEILGISA 172
           V +D L+   +R    L A         ++E  + + +L    P +P+   A   LG + 
Sbjct: 877 VKSDRLSSNDMRDLWRLHAGQSAAQLKKWDESIRWMNELLTQSPDSPVAAEAQYELGWAN 936

Query: 173 LKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
               K  +A   F  LA  + SP     R++ +L  +
Sbjct: 937 YNQKKTDEAIQRF--LAAADLSPGKTGARARFMLGEL 971



 Score = 36.9 bits (84), Expect = 2.2,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 45/127 (35%), Gaps = 7/127 (5%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLS--NMYIASILVAKGDTKNAAEIFL 113
            +A  + L   NK  +A   + K L+     ++  +   M  A  ++ + D   A ++  
Sbjct: 190 AYAWGVTLEELNKPTEAADVYSKFLA-AFPDHDLAAEVRMRQAETVLNQNDFAKAEQMLT 248

Query: 114 KVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSE--PSNPMHQFANEILGIS 171
            V  D   PL     A  + A   +      +   I  +++   P +  H  +  + G  
Sbjct: 249 TVTADPQFPLI--DHALYRLAFARLKQEKLADAGAIYAQIAADYPKSKYHDESMMLAGRC 306

Query: 172 ALKFGKV 178
             + G  
Sbjct: 307 YYRAGDW 313


>gi|260771394|ref|ZP_05880319.1| membrane protein [Vibrio furnissii CIP 102972]
 gi|260613520|gb|EEX38714.1| membrane protein [Vibrio furnissii CIP 102972]
 gi|315180974|gb|ADT87888.1| hypothetical protein vfu_A02773 [Vibrio furnissii NCTC 11218]
          Length = 204

 Score = 43.8 bits (102), Expect = 0.014,   Method: Composition-based stats.
 Identities = 27/196 (13%), Positives = 66/196 (33%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + +    +      K   K +    ++ +  L  W +  D     +      ++ +A++ 
Sbjct: 5   DTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRFYQDSVTSGQ-EAASASYTKAIQT 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             +  +D        I S     Y  L+ M +A   V  G    A     + A +     
Sbjct: 64  LTTKGVDGEADVQSFIDSNSKSEYAVLAAMQLAKAQVQAGQLDEALAQL-EWAKNATGDA 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A++   T + A +  +  +++     L   +           E+ G  +L+ G  + A  
Sbjct: 123 ALKPVITYRVARLQAEQGNFDAALSELA--TIKEQSWTGRVAELRGDISLRKGDKEAAYA 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  + +++   + 
Sbjct: 181 AYAEAQQADDASQTLQ 196


>gi|194335759|ref|YP_002017553.1| TPR repeat-containing protein [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308236|gb|ACF42936.1| TPR repeat-containing protein [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 4489

 Score = 43.8 bits (102), Expect = 0.015,   Method: Composition-based stats.
 Identities = 25/170 (14%), Positives = 60/170 (35%), Gaps = 24/170 (14%)

Query: 49  KKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNA 108
             +     F +AL L    ++++A + + +IL  + K ++ L  +  A++   K +   A
Sbjct: 784 AASDHASRFPEALTLHQQGRINEAEALYREILCANPKHFDALQLL--ATVAAQKRNFSEA 841

Query: 109 AEIFLKVANDDLA--------PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM 160
           A +F +    +             ++       A    D ++               NP 
Sbjct: 842 AALFEQAFAINSDCPELLNNWGNTLKELKRYDEALHCFDRAT-------------ELNPY 888

Query: 161 HQFANEILGISALKFGKVQKAKTIFEE-LAKDNNSPFGISTRSQMILANI 209
           +  A    GI+  +  +  +A   ++  +A   + P     R  ++   +
Sbjct: 889 YVEAYYNRGITLKELQRYDEALLSYDAVIALKPDYPEVYVNRGNVLKELL 938



 Score = 41.5 bits (96), Expect = 0.084,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 2/68 (2%)

Query: 48   KKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKN 107
            + +         AL L     LDDA   + KIL +D + ++ L  +  A+I   K +   
Sbjct: 2272 QYRPAHSTRLHSALALHQQGCLDDAEVLYRKILREDPEHFDALQLL--ATIAAQKKNFSE 2329

Query: 108  AAEIFLKV 115
            A E+F + 
Sbjct: 2330 AVELFDQA 2337



 Score = 38.4 bits (88), Expect = 0.70,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 36/94 (38%), Gaps = 10/94 (10%)

Query: 56   NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
                AL L     LDDA   + +IL  + + ++ L  +  A++   + +   A E+F + 
Sbjct: 3667 RLHSALALHQQGCLDDAEVLYREILRANPEHFDALRLL--ATVAAQRKNFPEAEELFDQA 3724

Query: 116  ANDDLA--------PLAVRYAATLQAASILVDTS 141
               + A         +A++       A    D +
Sbjct: 3725 LKINPAHATVWNNRGIALQELKRYDEALQCYDNA 3758



 Score = 37.7 bits (86), Expect = 1.3,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 26/81 (32%), Gaps = 2/81 (2%)

Query: 35  LAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMY 94
           L  +            +        AL      +LD+A + + +IL  +   ++    + 
Sbjct: 14  LGGFRVEHQTETSDPSDAPVARLQAALTFHQQGRLDEAEAVYREILVTEPDQFDAFRLL- 72

Query: 95  IASILVAKGDTKNAAEIFLKV 115
            A I   +     A  +F + 
Sbjct: 73  -AIIAAQRKQFHEAIALFERA 92



 Score = 35.3 bits (80), Expect = 5.7,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 27/74 (36%), Gaps = 6/74 (8%)

Query: 48   KKKNIVGENFAQ----ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKG 103
            +     G  +      AL L     LDDA   + +++  +   +  +  +  A++   K 
Sbjct: 2894 ETAARSGPAYFATLQSALALHQQGCLDDAEVLYREVVHSNPDYFEAVQLL--ATVAAQKQ 2951

Query: 104  DTKNAAEIFLKVAN 117
            +   A E+F     
Sbjct: 2952 NFHEALELFDHALA 2965


>gi|313205668|ref|YP_004044845.1| tetratricopeptide tpr_1 repeat-containing protein [Riemerella
           anatipestifer DSM 15868]
 gi|312444984|gb|ADQ81339.1| Tetratricopeptide TPR_1 repeat-containing protein [Riemerella
           anatipestifer DSM 15868]
 gi|315022600|gb|EFT35626.1| TPR-domain containing protein [Riemerella anatipestifer RA-YM]
 gi|325336890|gb|ADZ13164.1| Tetratricopeptide TPR-1 [Riemerella anatipestifer RA-GD]
          Length = 986

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 31/164 (18%), Positives = 68/164 (41%), Gaps = 5/164 (3%)

Query: 57  FAQALELFNSNKLDDARSSFEK-ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
            + A +L+   + + A   +EK +    +      +   +       GD   A + F  V
Sbjct: 722 LSTARQLYAKKQYEKAIPYYEKYLAQNVSSNTAFQAQYELGESYYQSGDDAKALKSFNFV 781

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNP-MHQFANEILGISALK 174
                 P   +  A +++A IL+  +  EE ++ L KL + +NP +  FA + L      
Sbjct: 782 ---TAYPNDYQEEARIRSAQILLSKNKGEEAAEHLAKLVDSNNPKIKSFAQQELMKYYAD 838

Query: 175 FGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
                KA+T    +  +  +   +  ++++I A  + +  ++K+
Sbjct: 839 KKDFAKAETYAGLILSNTKNSPAVLEQAKVIKARSLMNQGKDKE 882


>gi|260913152|ref|ZP_05919634.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260632739|gb|EEX50908.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 204

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 35/199 (17%), Positives = 69/199 (34%), Gaps = 16/199 (8%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGE----N 56
           +E   + N  K         +K +   +IL   ++  W Y       K +          
Sbjct: 5   IEEEQELNQLKA---WWSENHKTVIASVILAFAAILGWNYWKSYQITKTQQTSAAYEYLI 61

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           +    +L   NK  +     + +      +Y+ L+ +  A + V +     A +   +  
Sbjct: 62  YRNTTDLTERNKDIE-----QFVQESGKNVYSTLALLNKAKVEVEQQFYALAEKTLKQAV 116

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
            D      +   A+L+ AS+      Y      L K+             ++G  +L  G
Sbjct: 117 TDAPDD-ILASIASLRLASVQYQQHDYNGALDSLNKVKSDV--WDSKKYLLMGDISLAKG 173

Query: 177 KVQKAKTIFEELAKDNNSP 195
            +  AKT +E+ A++  SP
Sbjct: 174 DIVSAKTNYEK-AQEKASP 191


>gi|242279006|ref|YP_002991135.1| hypothetical protein Desal_1534 [Desulfovibrio salexigens DSM 2638]
 gi|242121900|gb|ACS79596.1| conserved hypothetical protein [Desulfovibrio salexigens DSM 2638]
          Length = 216

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 25/168 (14%), Positives = 59/168 (35%), Gaps = 9/168 (5%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
              +IL+   ++ + Y+      K ++ +G    +    ++  K  +  S+FEK      
Sbjct: 40  VAAIILIAGGVSGFKYMNQQKLIKAQSEMGTILIK----YSGAKQAEELSAFEK---DVP 92

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
               P   + +A   +  G   +A  ++  +A        V      +   +        
Sbjct: 93  ASMKPAVQLALAKAWMDAGSYADAKAVWAAIAKTSPEMAPVAALGQAKCLMLENKAGEAV 152

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
            + + +++ +          N +LG +A K G  Q A   ++ L   +
Sbjct: 153 TVLQKMKESA--GASYASSINRLLGEAAEKAGNAQVAIQAYQALLTSS 198


>gi|152987483|ref|YP_001346427.1| thioredoxin [Pseudomonas aeruginosa PA7]
 gi|150962641|gb|ABR84666.1| thioredoxin [Pseudomonas aeruginosa PA7]
          Length = 289

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 44/121 (36%), Gaps = 2/121 (1%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           +    A  LF   ++ DA ++ + +L++ N    P + +  A  L  +G+ + A  I   
Sbjct: 121 DPLEVAQALFAEGRIGDAEATLKALLAEHNDN--PAALILYARCLAERGELEEAQAILDA 178

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALK 174
           V +D+         A L       D     E+   L   +      +Q A + L     +
Sbjct: 179 VKSDEHKQALAGARAQLTFLRQAADLPDAAELKSRLANDAGDDEAAYQLAIQQLARQQYE 238

Query: 175 F 175
            
Sbjct: 239 A 239


>gi|114332038|ref|YP_748260.1| TPR repeat-containing protein [Nitrosomonas eutropha C91]
 gi|114309052|gb|ABI60295.1| TPR repeat-containing protein [Nitrosomonas eutropha C91]
          Length = 930

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 38/156 (24%), Positives = 69/156 (44%), Gaps = 15/156 (9%)

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA-- 121
                 + A+  FE++L QD K    ++ +  A I +++G+ + A E   K + ++    
Sbjct: 522 LQEKHPEAAQQRFEEVLKQDKKNVQAMNAL--AGIALSQGNKEKATEWLEKASQENPDEL 579

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           P A++  A   A +   +      ++K LQ +    +P +  A E+L  + L  G    A
Sbjct: 580 PPALQLGAHYLAIN---EPGKSLALAKKLQGI----HPDNLSAIELLARAYLATGDKDAA 632

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
              F++LA     P      +Q+ LA I AS Q  +
Sbjct: 633 LENFQKLA--ARLPDSAP--AQLQLAQIYASMQNTR 664


>gi|242280662|ref|YP_002992791.1| hypothetical protein Desal_3201 [Desulfovibrio salexigens DSM 2638]
 gi|242123556|gb|ACS81252.1| Tetratricopeptide TPR_2 repeat protein [Desulfovibrio salexigens
           DSM 2638]
          Length = 571

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 57/187 (30%), Gaps = 33/187 (17%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL--------------- 69
           A   +L++L    +         K        + +AL +  +N                 
Sbjct: 388 AGTAVLVVLLAGAYTQAGHWKDSKAL------YTRALAVTENNHHMHYNYGNLLEREKNY 441

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
            +A   F+     D   Y  ++++  ASIL  KGD   A +++ +    +         A
Sbjct: 442 TEAAKHFKAAFKADPSHYKAMTSL--ASILSRKGDPYTALDLYQRALQINPDYAP----A 495

Query: 130 TLQAASILVDTSSYEEISK--ILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF-E 186
                 + +    +E         +  EP  P H      +G+     G    AK     
Sbjct: 496 LGNRGIVYMQQGKFESAIADIRKAQQLEPQQPNHMI---NMGLLYYMRGDNSAAKEWLRR 552

Query: 187 ELAKDNN 193
            L  D N
Sbjct: 553 ALQVDPN 559


>gi|15837065|ref|NP_297753.1| hypothetical protein XF0463 [Xylella fastidiosa 9a5c]
 gi|9105309|gb|AAF83273.1|AE003896_10 hypothetical protein XF_0463 [Xylella fastidiosa 9a5c]
          Length = 218

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 76/204 (37%), Gaps = 16/204 (7%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           + G+    W+    + ++  + + F        ++   V +  + A +     KL  A+ 
Sbjct: 17  EHGERIRSWLRKNGVGLLCGVLLGFVFIAAWQWREAKQVDQFTSAAQQFAVFGKLLQAKE 76

Query: 75  ------SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
                 +  K+      LY  L  + +A      G+T  A +I   +          +  
Sbjct: 77  LGNAAQALAKLNGAPAGLYAELGALQLAKAQSEAGNTAEAIKILRTL----PVDSQFKLI 132

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A  + A +LV T   +E +K+L   ++  +       EI G + L  GK ++A+  + + 
Sbjct: 133 ADQRLARLLVATGKADEANKLLATRNDDVS------FEIQGDALLVLGKREQARERYAKA 186

Query: 189 AKDNNSPFGISTRSQMILANIIAS 212
               +S        ++ L ++  +
Sbjct: 187 LAMGDSAAPQRRILEIKLMDVGGT 210


>gi|28199498|ref|NP_779812.1| hypothetical protein PD1621 [Xylella fastidiosa Temecula1]
 gi|182682231|ref|YP_001830391.1| hypothetical protein XfasM23_1713 [Xylella fastidiosa M23]
 gi|28057613|gb|AAO29461.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|182632341|gb|ACB93117.1| conserved hypothetical protein [Xylella fastidiosa M23]
 gi|307578505|gb|ADN62474.1| hypothetical protein XFLM_02375 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 212

 Score = 43.8 bits (102), Expect = 0.017,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 77/204 (37%), Gaps = 16/204 (7%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           + G+    W+    + ++  + + F        ++   V +  + A +     KL  A+ 
Sbjct: 11  EHGERIRSWLRKNGVGLLCGVLLGFVFIAAWQWREAKQVDQFTSAAQQFAVFGKLLQAKE 70

Query: 75  ------SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
                 +  K+    + LY  L  + +A      G+T  A +I   +          +  
Sbjct: 71  LGNAAQALAKLNGAPSGLYAELGALQLAKAQSEAGNTAEAIKILRTL----PVDSQFKLI 126

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A  + A +LV T   +E +K+L   ++  +       EI G + L  GK ++A+  + + 
Sbjct: 127 ADQRLARLLVATGKADEANKLLATRNDDVS------FEIQGDALLVLGKREQARERYAKA 180

Query: 189 AKDNNSPFGISTRSQMILANIIAS 212
               +S        ++ L ++  +
Sbjct: 181 LAMGDSAAPQRRILEIKLMDVGGT 204


>gi|323499820|ref|ZP_08104779.1| hypothetical protein VISI1226_15271 [Vibrio sinaloensis DSM 21326]
 gi|323315061|gb|EGA68113.1| hypothetical protein VISI1226_15271 [Vibrio sinaloensis DSM 21326]
          Length = 204

 Score = 43.8 bits (102), Expect = 0.017,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 65/196 (33%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +++    +      K   K +    ++ +  L  W Y  D S    +    E++ +A++ 
Sbjct: 5   DSEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQD-SVTAAQEAASESYTKAVQA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             +   +   +    I +     Y  L+ + +A + V  G+   A     + A       
Sbjct: 64  LAAKGAEGEAAVQSFIDANKETQYAVLAALQLAKVQVEAGNLDEALAQL-EWAKTATKDE 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           AV      + A +  +   ++     L   +           E+ G   L+ G  Q A  
Sbjct: 123 AVSAVINYRLARLKAEQGDFDAAIAELS--AIGDESWAGRVAELRGDILLRKGDSQAAYA 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  +  ++   + 
Sbjct: 181 AYTEAQQAGDASQTLQ 196


>gi|262402854|ref|ZP_06079415.1| membrane protein [Vibrio sp. RC586]
 gi|262351636|gb|EEZ00769.1| membrane protein [Vibrio sp. RC586]
          Length = 204

 Score = 43.8 bits (102), Expect = 0.017,   Method: Composition-based stats.
 Identities = 34/197 (17%), Positives = 70/197 (35%), Gaps = 6/197 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + +    +      K   K +    ++ +  L  W Y  D S    +     N++QA++ 
Sbjct: 5   DTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQD-SVVAAQEAASHNYSQAMDA 63

Query: 64  FNSNKLDDARSSFEK-ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             + K  +A +S +  I +     Y  L+ M +A + V  G    A             P
Sbjct: 64  LVA-KGAEAEASIQTFIDANKETEYAVLAAMQLAKVQVDAGQLDEALAQLEWANGVTKDP 122

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
            A++   T + A +  +   +EE    L  + E          E+ G   ++ G    A 
Sbjct: 123 -ALKPLLTYRVARLQAEQGQFEEALAQLGNIQE--KSWLGRVAELRGDILMRKGDSTGAY 179

Query: 183 TIFEELAKDNNSPFGIS 199
             + E  + +++   + 
Sbjct: 180 AAYTEAQQADDASQTLQ 196


>gi|168701390|ref|ZP_02733667.1| TPR domain protein [Gemmata obscuriglobus UQM 2246]
          Length = 675

 Score = 43.8 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 56/148 (37%), Gaps = 12/148 (8%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF-L 113
           + F +A+    S  LD+A   + ++L+        L+N+  A+I+  +GD   A  ++  
Sbjct: 6   DLFQRAVAAHRSGSLDEAEHGYRQLLTATPNHPPALTNL--AAIVAQRGDADEAERLYLE 63

Query: 114 KVANDDLAPLAVRYAATL-QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA 172
            +  D          A L +      D   + E +  L   +             LG++A
Sbjct: 64  SLGADPDQLNTHFNLANLYRRTGRSADAIPHYEDALRLSPDA-------PAVLVNLGLAA 116

Query: 173 LKFGKVQKAKTIFE-ELAKDNNSPFGIS 199
              G   ++   F   +  + + P G++
Sbjct: 117 GDVGNWPRSVECFARAVTVNPDVPEGLT 144


>gi|67480111|ref|XP_655416.1| TPR repeat protein [Entamoeba histolytica HM-1:IMSS]
 gi|56472551|gb|EAL50030.1| TPR repeat protein [Entamoeba histolytica HM-1:IMSS]
          Length = 890

 Score = 43.8 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 25/126 (19%), Positives = 48/126 (38%), Gaps = 8/126 (6%)

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSN-MYIASILVAKGDTKNAAEIFL-KVANDDLA 121
            N+ KL +A + F+++L       N L+  +   S     GD + A   F   V  D   
Sbjct: 234 VNTGKLKEAIAHFDQLLKNHP---NVLAGYLGRGSAKAMLGDLQKALTDFNLAVKKDSKC 290

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM--HQFANEILGISALKFGKVQ 179
             A +    ++ A     ++  E+ +K ++   E  +       A   LGI       ++
Sbjct: 291 GDAYKRRGQVKLALGQTQSA-LEDFNKAIELTPEEGDCYRQRGSAYHALGIFDKAAEDIK 349

Query: 180 KAKTIF 185
           K+  + 
Sbjct: 350 KSIKLI 355


>gi|317153062|ref|YP_004121110.1| hypothetical protein Daes_1350 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943313|gb|ADU62364.1| protein of unknown function DUF181 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 575

 Score = 43.8 bits (102), Expect = 0.019,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 53/140 (37%), Gaps = 7/140 (5%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L   +  D+A    +++       Y      + A + +  GD + A + F  V    L P
Sbjct: 400 LAEESDFDEALEGLDEVEDIYPDAY--FIPFFRALLALRMGDPEYAVDQF--VLAGPLQP 455

Query: 123 L-AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
               R       A  L     ++E+   L +     +   ++ N + G++  K G+ + A
Sbjct: 456 ANEERALCAFYEAYALSQQERWDEVVAPLDRALALDDECREYFN-LRGVAHFKGGRYKDA 514

Query: 182 KTIFEE-LAKDNNSPFGIST 200
              FE  L  D+ SP  ++ 
Sbjct: 515 ARDFEASLTIDSGSPHDLAN 534


>gi|152980881|ref|YP_001353815.1| hypothetical protein mma_2125 [Janthinobacterium sp. Marseille]
 gi|151280958|gb|ABR89368.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 216

 Score = 43.4 bits (101), Expect = 0.019,   Method: Composition-based stats.
 Identities = 27/193 (13%), Positives = 68/193 (35%), Gaps = 4/193 (2%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           Y  +   L++++L     +  +      +    G+ + +  +   +   +  + +   + 
Sbjct: 21  YGNLVTWLLIVVLGAYAAWAGWGYYQRSQATQAGQLYEELQKAVAAQDKEKVQRAATDME 80

Query: 81  SQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
           ++     Y  +S +  A       D K A      V  D       +  A ++ A IL+D
Sbjct: 81  AKFAGTAYAQMSALAAAKSAFDSNDFKTAKAQLQWVI-DKGQSDEYKAVAKVRLAGILLD 139

Query: 140 TSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
             +Y+E  K+L               +   + A    K+++A+  ++   +  ++     
Sbjct: 140 EKAYDEGLKVLAGEFPAQFANVVSDRKGDILVA--QNKLEEARAAYQTALEKTDAKNPAR 197

Query: 200 TRSQMILANIIAS 212
              Q+ L  I  +
Sbjct: 198 QLIQIKLDAIGGA 210


>gi|325981899|ref|YP_004294301.1| hypothetical protein NAL212_1229 [Nitrosomonas sp. AL212]
 gi|325531418|gb|ADZ26139.1| Protein of unknown function DUF2133 [Nitrosomonas sp. AL212]
          Length = 212

 Score = 43.4 bits (101), Expect = 0.020,   Method: Composition-based stats.
 Identities = 35/212 (16%), Positives = 75/212 (35%), Gaps = 7/212 (3%)

Query: 1   MESNNDANSYKGKCKMGKC-CYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ 59
           M + N  +  K     G    Y     +++  +L+ A     ++   +K+    G+ +  
Sbjct: 1   MVTYNHEDQEKVDGFKGWWDKYGTAIVIIMTGMLATAGAIKAWEYYQQKQAQQAGDLYVL 60

Query: 60  ALELFNSNKLDDARSSFEKILSQDN--KLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
            L+   +    +  +   ++L Q      Y P + +  A      G+ K A +    +  
Sbjct: 61  -LKQVQAGNDSEKINDTAQLLMQGYSSSGYAPRAALIAAQADAHAGNNKRAIQNLQWIL- 118

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
           D      +R  A L+ + IL+D   Y+E  + L      S        +  G   +   +
Sbjct: 119 DHAKETEMRDLARLRISGILLDEGKYDEALRFLDD--GYSEAFSGLYLDRKGDIQVATQR 176

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
           + +A+  ++E     +         QM L  +
Sbjct: 177 ISEARLSYQEAINALDKSNNYYNIVQMKLDGL 208


>gi|320102982|ref|YP_004178573.1| tetratricopeptide repeat-containing protein [Isosphaera pallida
           ATCC 43644]
 gi|319750264|gb|ADV62024.1| Tetratricopeptide TPR_1 repeat-containing protein [Isosphaera
           pallida ATCC 43644]
          Length = 1053

 Score = 43.4 bits (101), Expect = 0.020,   Method: Composition-based stats.
 Identities = 23/148 (15%), Positives = 55/148 (37%), Gaps = 4/148 (2%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAK-GDTKNAAEIFLKVANDDLA 121
           L   N+L+ AR+ + +   +       ++ M   +    +     +A   +L +      
Sbjct: 323 LAQRNQLEPARTVWNQAAQRFPNSSRWVALMARVADAARRLNQLADAEAAYLSIVQTRPD 382

Query: 122 PLAVRYAATLQAASILVDTSSY--EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
                  A L+AA +      +           ++ P++     A  +   +AL  G+ +
Sbjct: 383 DPFAPD-AQLRAAELAFQRGDHLEARRRAAALAVTFPTSSWIPAARLVEARAALASGQAE 441

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMILA 207
           +A TI   L ++  +   ++  ++  LA
Sbjct: 442 EAVTILTTLIENAQTDPALARAARYQLA 469



 Score = 36.5 bits (83), Expect = 2.5,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 38/97 (39%), Gaps = 1/97 (1%)

Query: 91  SNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKIL 150
           + +  A   +A G  + A  I   +  +     A+  AA  Q A   +  +  E    I 
Sbjct: 426 ARLVEARAALASGQAEEAVTILTTLIENAQTDPALARAARYQLARAALAHNDPETAFAIW 485

Query: 151 QKL-SEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
           ++L S   +P    +   LG++  + G+  +A    E
Sbjct: 486 RELGSTEGHPYVAASRYELGVNLYRLGRYDEAADALE 522


>gi|188996284|ref|YP_001930535.1| Tetratricopeptide TPR_2 repeat protein [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931351|gb|ACD65981.1| Tetratricopeptide TPR_2 repeat protein [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 557

 Score = 43.4 bits (101), Expect = 0.020,   Method: Composition-based stats.
 Identities = 38/139 (27%), Positives = 56/139 (40%), Gaps = 11/139 (7%)

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            S   D A   ++ IL  D      L+ ++   I V K D  NAAE   K+   +     
Sbjct: 210 QSGNYDKAIEIYKNILKDDPNNLEALNRLFQ--IYVDKDDFNNAAETIDKIIRLNPKDND 267

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLS--EPSNPMHQFANEILGISALKFGKVQKAK 182
               A L+   + +      EI + L+K S   P NP  +F   +LG++       Q AK
Sbjct: 268 ----AILKKFLLYIKYGKSNEILQDLKKSSQENPDNPFLKF---MLGMAYETLEDYQNAK 320

Query: 183 TIFEELAKDNNSPFGISTR 201
            I+EEL K       +  R
Sbjct: 321 AIYEELYKQQPDNQELIDR 339


>gi|186682273|ref|YP_001865469.1| hypothetical protein Npun_R1869 [Nostoc punctiforme PCC 73102]
 gi|186464725|gb|ACC80526.1| Tetratricopeptide TPR_2 repeat protein [Nostoc punctiforme PCC
           73102]
          Length = 157

 Score = 43.4 bits (101), Expect = 0.020,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 52/115 (45%), Gaps = 13/115 (11%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           IA + +++ LS+  +F         K  I  + F + + L  +     A ++F K++S +
Sbjct: 11  IAAIAVILSLSILGYFAW-------KTLITSDLFQKGINLAQAKDYQGAEAAFRKVISLN 63

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV 138
           +     +  +++  +L  +G  + A E+F +V             A L+ A+IL+
Sbjct: 64  STN--DVVRLFLGDVLNQQGQVEEATELFREVIRRSPKNPD----AYLRLANILM 112


>gi|209551564|ref|YP_002283481.1| hypothetical protein Rleg2_3993 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537320|gb|ACI57255.1| Tetratricopeptide domain protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 550

 Score = 43.4 bits (101), Expect = 0.021,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 33/86 (38%), Gaps = 3/86 (3%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           + QAL+++ +     A   F ++L       +  +   +A++L  +G    A   +  +A
Sbjct: 366 YEQALDMYRNGARRRAEIVFNQVLQSAPG--HTGAGFGLANLLFDRGKLTEALAAYKALA 423

Query: 117 NDDLAPLAVR-YAATLQAASILVDTS 141
                P  +R      Q A    D +
Sbjct: 424 EQAPDPTPIRMRLGDTQLALHQYDQA 449


>gi|329123604|ref|ZP_08252164.1| hypothetical protein HMPREF9095_1382 [Haemophilus aegyptius ATCC
           11116]
 gi|327469803|gb|EGF15268.1| hypothetical protein HMPREF9095_1382 [Haemophilus aegyptius ATCC
           11116]
          Length = 204

 Score = 43.4 bits (101), Expect = 0.021,   Method: Composition-based stats.
 Identities = 30/194 (15%), Positives = 59/194 (30%), Gaps = 11/194 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E   + N  K      K   K I    IL +  +  W Y      E+        +   
Sbjct: 5   IEEEQEINQLK---DWWKENGKTIIVAFILGVGGMFGWRYWQAHQVEQISQ-ASVQYDAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     N+     +  + + +     Y   + +  +     K D   AA + LK A    
Sbjct: 61  INSVQQNEQAKKANIEQFVQANSKTAYAVFALLDESKKATEKQDFA-AAGVNLKQALMQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFGKV 178
               +     L+ +++       +     L ++   S      A + +  G   +  G  
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVKGES----FNARKAILTGDIQVAKGDK 175

Query: 179 QKAKTIFEELAKDN 192
             AK  FE+  +  
Sbjct: 176 VAAKNSFEQAQQSG 189


>gi|319795775|ref|YP_004157415.1| hypothetical protein Varpa_5146 [Variovorax paradoxus EPS]
 gi|315598238|gb|ADU39304.1| Tetratricopeptide TPR_1 repeat-containing protein [Variovorax
           paradoxus EPS]
          Length = 383

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 39/108 (36%), Gaps = 9/108 (8%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL-A 121
           L  + KLD+A +  +  L    +  +P        I +  G    A   F ++  D    
Sbjct: 45  LMQAGKLDEAMAKADAFLKDKPR--DPQMRFLKGVIQLDTGKRAEAIAAFTQLTQDAPEL 102

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILG 169
           P      A + A+    D +        L+  +  +NP +  A E LG
Sbjct: 103 PEPFNNLAVIYASQNQFDKA-----RSALES-AIRTNPSYATAQENLG 144


>gi|298492032|ref|YP_003722209.1| TPR repeat-containing protein ['Nostoc azollae' 0708]
 gi|298233950|gb|ADI65086.1| TPR repeat-containing protein ['Nostoc azollae' 0708]
          Length = 154

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 22/116 (18%), Positives = 56/116 (48%), Gaps = 9/116 (7%)

Query: 23  WIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ 82
            +  ++ + +++++I F ++ G    K       F + ++L  +   + A ++F +++S 
Sbjct: 6   PVGNIVAISLVTVSIGFLIYFGW---KTLTTSNLFQKGIKLCQAKDYNGAEAAFRQVISI 62

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV 138
           ++     +  + +  IL  +G T+ A E+F +V +           A L+ A+IL+
Sbjct: 63  NSTN--DIVRLLLGDILKHQGKTEEAKELFSEVISRSPKNPD----AYLRLANILL 112


>gi|218663215|ref|ZP_03519145.1| thioredoxin [Rhizobium etli IE4771]
          Length = 324

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 24/160 (15%), Positives = 58/160 (36%), Gaps = 10/160 (6%)

Query: 49  KKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNA 108
           +   V     +A EL  + K+++A   +  ++  D +    L+ M    I   + +    
Sbjct: 148 EAAEVEAVLVEAAELLAAGKINEAAQLYAAVMQADPENAKALAGMAECMIAANQHERARE 207

Query: 109 --AEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANE 166
              ++  +++ D      ++    ++ A  L D  + E      + L+    P +  A  
Sbjct: 208 TLTDLPEELSKDAGIQAVLKKLDQIEEARKLGDPVALE------RDLTAD--PDNHEARL 259

Query: 167 ILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMIL 206
            L       G+  +A     ++ + + S      R Q++ 
Sbjct: 260 KLAKILNVEGRRDEAAEHLLQIMRKDRSFDDDGARRQLLQ 299


>gi|311747917|ref|ZP_07721702.1| hypothetical protein ALPR1_16369 [Algoriphagus sp. PR1]
 gi|126575911|gb|EAZ80221.1| hypothetical protein ALPR1_16369 [Algoriphagus sp. PR1]
          Length = 792

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 52/137 (37%), Gaps = 9/137 (6%)

Query: 69  LDDARSSFE---KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
            ++A   ++   +IL +D  +   L+    A  L+  GDT  A      V N+ L  L  
Sbjct: 458 YEEAVKQYDRMYQILGKDAPVSQYLAPFAEA--LLGVGDTARA----KVVLNESLKKLPN 511

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
            Y +  + A+I  +   YE+   +  +      P    A + LG++ ++      A   F
Sbjct: 512 NYFSKFKLAAISYEEGEYEKAKSLYLESLNAEKPDLHPAYKNLGLTYMRLNDNANAIKYF 571

Query: 186 EELAKDNNSPFGISTRS 202
           E    +   P      +
Sbjct: 572 ELALAEKEEPELRRNLA 588


>gi|126208642|ref|YP_001053867.1| hypothetical protein APL_1174 [Actinobacillus pleuropneumoniae L20]
 gi|190150502|ref|YP_001969027.1| hypothetical protein APP7_1233 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303250076|ref|ZP_07336278.1| hypothetical protein APP6_1488 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307246090|ref|ZP_07528172.1| hypothetical protein appser1_12930 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307252815|ref|ZP_07534705.1| hypothetical protein appser6_13280 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307255071|ref|ZP_07536889.1| hypothetical protein appser9_13050 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259508|ref|ZP_07541233.1| hypothetical protein appser11_13050 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307261657|ref|ZP_07543324.1| hypothetical protein appser12_12170 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307263845|ref|ZP_07545450.1| hypothetical protein appser13_12550 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126097434|gb|ABN74262.1| hypothetical protein APL_1174 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|189915633|gb|ACE61885.1| hypothetical protein APP7_1233 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302651139|gb|EFL81293.1| hypothetical protein APP6_1488 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306853025|gb|EFM85248.1| hypothetical protein appser1_12930 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306859714|gb|EFM91737.1| hypothetical protein appser6_13280 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306861944|gb|EFM93920.1| hypothetical protein appser9_13050 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866444|gb|EFM98307.1| hypothetical protein appser11_13050 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306868649|gb|EFN00459.1| hypothetical protein appser12_12170 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306870834|gb|EFN02573.1| hypothetical protein appser13_12550 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 207

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 22/152 (14%), Positives = 52/152 (34%), Gaps = 6/152 (3%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE--L 63
           +   ++      K     I   +I+   +   W +  +    +        +   +E  L
Sbjct: 10  EEQQFEEAKNWFKENGTPILVAVIIACAATLGWNFWQNH-QVQAAQQTSATYQNVMESYL 68

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K       F  I    +  Y   S +  A   V K D   AA+  L+ A    +  
Sbjct: 69  QDPEKNQPLIEKF--ISENKDSSYAVFSQLESAKQAVEKADFA-AAKTVLQSALTSTSDA 125

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSE 155
           +++     + A++     +Y++    L ++++
Sbjct: 126 SLQTIIRFRLATLDYQLKNYDDALATLGQITD 157


>gi|119357637|ref|YP_912281.1| TPR repeat-containing protein [Chlorobium phaeobacteroides DSM 266]
 gi|119354986|gb|ABL65857.1| TPR repeat-containing protein [Chlorobium phaeobacteroides DSM 266]
          Length = 3035

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 51   NIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
            N       +AL+L    +LD+A +  ++ILS   + ++ L     A+I   + D++ A  
Sbjct: 2268 NEESVKLQRALKLHQEGRLDEAEAICQEILSSIPEHFDAL--QLSATIAAQRHDSEKALA 2325

Query: 111  IFLKVAN 117
            +F +   
Sbjct: 2326 LFDQALA 2332



 Score = 42.7 bits (99), Expect = 0.041,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 34/77 (44%), Gaps = 2/77 (2%)

Query: 51  NIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
           N       +AL L    +LD+A + + +ILS   + ++ L     A+I   + D++ A  
Sbjct: 808 NEESVKLQRALTLHQEGRLDEAEALYREILSSSPEHFDAL--QLSATIAAQRHDSEQALV 865

Query: 111 IFLKVANDDLAPLAVRY 127
           +F +  + +      R 
Sbjct: 866 LFDQAISINPGHPGSRN 882



 Score = 41.5 bits (96), Expect = 0.086,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 48/126 (38%), Gaps = 11/126 (8%)

Query: 56   NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
               +AL+L    +LD+A + + +ILS   + ++ L     A+I   + D++NA  +F + 
Sbjct: 1628 KLQRALKLHQEGRLDEAEALYREILSFSPEHFDAL--QLSATIAAQRHDSENALVLFDQA 1685

Query: 116  ANDDLA--------PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEI 167
                           +A++     + A    + +        ++  S   N + +     
Sbjct: 1686 LAIKPDHARSLNNRGIALQELKRYEEALASYERA-IAVKPDFIEPYSNRGNTLQELKRYE 1744

Query: 168  LGISAL 173
              ++  
Sbjct: 1745 EALACY 1750



 Score = 41.1 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 32/66 (48%), Gaps = 2/66 (3%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
               AL    +  LD+A + ++ IL Q+ + ++ L  +  A+I   + +++ A  +F + 
Sbjct: 32  TLHSALAFHQNGALDEAEALYQAILLQNPEHFDALQLL--ATIAAQRNESEKAVALFDQA 89

Query: 116 ANDDLA 121
            N +  
Sbjct: 90  LNINPD 95


>gi|326559232|gb|EGE09663.1| hypothetical protein E9M_09369 [Moraxella catarrhalis 46P47B1]
          Length = 277

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 25/201 (12%), Positives = 60/201 (29%), Gaps = 22/201 (10%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA---- 60
           ND N    K       +       +L++L++   +  +  ++ K   +  + +       
Sbjct: 7   NDNNFTDQKSFNALKLHGEKIIYAVLLVLAVFFGWQYYQKNYAKIDTVAADAYTSISVRD 66

Query: 61  -----------LELFNSNKLDDARSSF-----EKILSQDNKLYNPLSNMYIASILVAKGD 104
                      L+      L +            + +  N +Y   + M  A       D
Sbjct: 67  ERLVQAYLNPQLDEVAKQALAEEEKQLFGDIDALVAAHGNTVYAWQALMIKARHQTNNND 126

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFA 164
              A     +  + +L    +   A ++ A  ++          I  + + P+       
Sbjct: 127 LDGAVATLSQATSINLDDDGLTAIAKIRHARAMLANGDTNGALSIANE-AMPT-AFEASR 184

Query: 165 NEILGISALKFGKVQKAKTIF 185
            E+LG       ++  AK+ +
Sbjct: 185 QELLGDIYHAKNEIDNAKSAY 205


>gi|15604102|ref|NP_220617.1| hypothetical protein RP231 [Rickettsia prowazekii str. Madrid E]
 gi|14424111|sp|Q9ZDU3|Y231_RICPR RecName: Full=Uncharacterized protein RP231
 gi|3860794|emb|CAA14694.1| unknown [Rickettsia prowazekii]
 gi|292571828|gb|ADE29743.1| hypothetical protein rpr22_CDS226 [Rickettsia prowazekii Rp22]
          Length = 220

 Score = 43.4 bits (101), Expect = 0.023,   Method: Composition-based stats.
 Identities = 25/168 (14%), Positives = 63/168 (37%), Gaps = 6/168 (3%)

Query: 48  KKKNIVGENFAQALEL-FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           K     G+   + + L    +    A ++ E +++  N     ++ +   +I +++    
Sbjct: 51  KNNQKNGDILVKTIGLDTTKDNKALAFNTLENLITSSNTKIKEIAALEQVAIRMSEKKYL 110

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE-----EISKILQKLSEPSNPMH 161
            A  +  K+ +++         A +    I++D  S       ++ K L    +   P  
Sbjct: 111 GAKNLLNKIIDNEKYSEISTAYARIAWCCIVLDDQSLNIQDKGKLQKYLNYFDDEKKPFW 170

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
             A  I  I  +K     +A+   + L   NN    +  +++ +L ++
Sbjct: 171 ATATIIKAILDIKHNMKTQAEKNLKNLLASNNVSDLLKDQAKALLVSL 218


>gi|121998566|ref|YP_001003353.1| hypothetical protein Hhal_1787 [Halorhodospira halophila SL1]
 gi|121589971|gb|ABM62551.1| conserved hypothetical protein [Halorhodospira halophila SL1]
          Length = 208

 Score = 43.4 bits (101), Expect = 0.023,   Method: Composition-based stats.
 Identities = 30/209 (14%), Positives = 78/209 (37%), Gaps = 8/209 (3%)

Query: 8   NSYKGKCKMGKCCYKWIAPLLILMILS---LAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            S   + +  K  ++     ++L +     +   ++ +    E+        +A+ L+  
Sbjct: 3   RSDDEQLQQLKDWWQRNGGSILLGLTGALLILAGWWGYGTWQERGAQQAAAAYAEFLQAT 62

Query: 65  NSNKLDDARSSFEKILSQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            S + + A  + +++L    +  Y  ++ + +A I    G+ + AAE    +  D+    
Sbjct: 63  QSGEPEAAEQAGQRVLDDHARSGYAGMTALRMARIQAEAGEYRRAAETLGWLI-DNADHS 121

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+   A L+ A +L +    EE   +L+             +E+ G    + G+  +A  
Sbjct: 122 AMVELARLRQARVLGEE-DPEEALAVLEGSVSAG--FTASFDELRGDLLRELGRYDEAAE 178

Query: 184 IFEELAKDNNSPFGISTRSQMILANIIAS 212
            +++               ++ L  + + 
Sbjct: 179 AYQQALDQEGLGAQSRELVRLKLQAVESE 207


>gi|73997220|ref|XP_543747.2| PREDICTED: similar to ARG99 protein isoform 2 [Canis familiaris]
          Length = 865

 Score = 43.4 bits (101), Expect = 0.023,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 45/128 (35%), Gaps = 13/128 (10%)

Query: 63  LFNSNKLDDARSSFEKILSQDN---KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           L +  K ++A +  +  +         Y+ L     AS+L  +   K A EI+     + 
Sbjct: 541 LKSQEKKEEAITLLKDSIQYGPEFADAYSSL-----ASLLAEQERFKEAEEIYQAGIKNC 595

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
                +           LVDT S E+     Q+ +   +P H  A   LG      G   
Sbjct: 596 PDSSDLHN----NYGVFLVDTGSPEKAVAHYQQ-AIALSPSHHVAMVNLGRLYRSLGDNS 650

Query: 180 KAKTIFEE 187
            A+  ++ 
Sbjct: 651 AAEEWYKR 658


>gi|162448878|ref|YP_001611245.1| hypothetical protein sce0608 [Sorangium cellulosum 'So ce 56']
 gi|161159460|emb|CAN90765.1| hypothetical protein sce0608 [Sorangium cellulosum 'So ce 56']
          Length = 1633

 Score = 43.4 bits (101), Expect = 0.024,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 60/150 (40%), Gaps = 3/150 (2%)

Query: 58   AQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
             +A  L    KLDDA ++ E +   +      L+    A I  A+GD   AA  + +++ 
Sbjct: 1106 ERARVLRKKGKLDDALAALENVTLLEPDHIGALA--LSADISKAQGDLGQAAAFYAELSR 1163

Query: 118  DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
               AP   R  + + A         ++   ++L  L            E L   A + G 
Sbjct: 1164 VAKAPGEQRLMSGITAVDAYEKLGEHDRALEVLIGLHRAGLSTLVV-RERLVRVAARVGS 1222

Query: 178  VQKAKTIFEELAKDNNSPFGISTRSQMILA 207
              +A  + EEL  + ++P G    +++ +A
Sbjct: 1223 WDEATRLLEELMVERDTPEGRIEAARLAMA 1252


>gi|30262208|ref|NP_844585.1| TPR domain-containing protein [Bacillus anthracis str. Ames]
 gi|47527485|ref|YP_018834.1| TPR domain-containing protein [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49185049|ref|YP_028301.1| TPR domain-containing protein [Bacillus anthracis str. Sterne]
 gi|227814992|ref|YP_002815001.1| TPR domain protein [Bacillus anthracis str. CDC 684]
 gi|254737222|ref|ZP_05194926.1| TPR domain protein [Bacillus anthracis str. Western North America
           USA6153]
 gi|254751538|ref|ZP_05203575.1| TPR domain protein [Bacillus anthracis str. Vollum]
 gi|254759052|ref|ZP_05211079.1| TPR domain protein [Bacillus anthracis str. Australia 94]
 gi|30256839|gb|AAP26071.1| tetratricopeptide repeat protein [Bacillus anthracis str. Ames]
 gi|47502633|gb|AAT31309.1| TPR domain protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|49178976|gb|AAT54352.1| TPR domain protein [Bacillus anthracis str. Sterne]
 gi|227007564|gb|ACP17307.1| tetratricopeptide repeat protein [Bacillus anthracis str. CDC 684]
          Length = 426

 Score = 43.4 bits (101), Expect = 0.024,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 74/197 (37%), Gaps = 11/197 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +   ++ +         K   K I  +   +++ +      +  +   K     E   QA
Sbjct: 19  LTVAHEQSEPSAFSTWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQA 78

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +     K ++A      +  +D       + + +A+I VA+G  K A +   K+  D  
Sbjct: 79  YDNKKYTKAEEAVGHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDRE 132

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFG 176
                  AA L A++       Y+E  +  ++     ++   P  + A   L +S +K  
Sbjct: 133 IDKENNEAAYLLASA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMK 191

Query: 177 KVQKAKTIFEELAKDNN 193
           + +KA+ +  +++   N
Sbjct: 192 EFEKAEDVIVKMSTKTN 208


>gi|261212139|ref|ZP_05926425.1| membrane protein [Vibrio sp. RC341]
 gi|260838747|gb|EEX65398.1| membrane protein [Vibrio sp. RC341]
          Length = 204

 Score = 43.4 bits (101), Expect = 0.024,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 67/196 (34%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + +    +      K   K +    ++ +  L  W Y  D     +      N++QA++ 
Sbjct: 5   DTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDTVVAAQ-EAASHNYSQAMDA 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             +   D   S    I +     Y  L+ M +A   V  G    A     + A       
Sbjct: 64  LVAKGADAESSIQTFIDANKETEYAVLAAMQLAKAQVDAGQLDEALAQL-EWAKGATQDP 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A++   T + A +  + S +++    L  + E S        E+ G   ++ G    A  
Sbjct: 123 ALKPLLTFRVARLQAEQSQFDDALTQLSNIQEKSWAGRVA--ELRGDILMRKGDSAGAYA 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  + +++   + 
Sbjct: 181 AYTEAQQADDASQTLQ 196


>gi|170730867|ref|YP_001776300.1| hypothetical protein Xfasm12_1777 [Xylella fastidiosa M12]
 gi|167965660|gb|ACA12670.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 212

 Score = 43.0 bits (100), Expect = 0.025,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 76/204 (37%), Gaps = 16/204 (7%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           + G+    W+    + ++  + + F        ++   V +  + A +     KL  A+ 
Sbjct: 11  EHGERIRSWLRKNGVGLLCGVLLGFVFIAAWQWREAKQVDQFTSAAQQFAVFGKLLQAKE 70

Query: 75  ------SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
                 +  K+      LY  L  + +A      G+T  A +I   +          +  
Sbjct: 71  LGNAAQALAKLNGASAGLYAELGALQLAKAQSEAGNTAEAIKILRTL----PVDSQFKLI 126

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A  + A +LV T   +E +K+L   ++  +       EI G + L  GK ++A+  + + 
Sbjct: 127 ADQRLARLLVATGKADEANKLLATRNDDVS------FEIQGDALLLLGKREQARERYAKA 180

Query: 189 AKDNNSPFGISTRSQMILANIIAS 212
               +S        ++ L ++  +
Sbjct: 181 LAMGDSAAPQRRILEIKLMDVGGA 204


>gi|323698154|ref|ZP_08110066.1| hypothetical protein DND132_0736 [Desulfovibrio sp. ND132]
 gi|323458086|gb|EGB13951.1| hypothetical protein DND132_0736 [Desulfovibrio desulfuricans
           ND132]
          Length = 886

 Score = 43.0 bits (100), Expect = 0.025,   Method: Composition-based stats.
 Identities = 42/218 (19%), Positives = 81/218 (37%), Gaps = 22/218 (10%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLI--LMILSLAIWFYLFDGSHEKKKNIVGENFA 58
           MES ND  S      + +  ++   P+ +  L ++  +      DG  +      G+   
Sbjct: 410 MESRNDLESL-----LARAVFEIDVPVQLRTLKLVWRSRGKEWADGFKQLAPQE-GDYIW 463

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
            A+E      LD A    ++  ++  + Y P          + KGD   A   + +    
Sbjct: 464 DAMESLEKGDLDAAEGLLKEAQAKYPRSYQP--QSLWGYWYLEKGDVNQAMFHWQEAERM 521

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM-HQFANEILGISALKFGK 177
              PL     A LQA  + V+   Y++     ++++  S         + + +  +K G 
Sbjct: 522 SYTPLQQGCMAFLQARLMEVE-GDYKDAINTYKRVNSLSPTWLQPVYRQAVCM--VKMGF 578

Query: 178 VQKAKT-IFEELAKDNNS-------PFGISTRSQMILA 207
             +A   +F+ +A+D N        P     R Q++ A
Sbjct: 579 TGQAMDTLFDLVARDPNIFNRILVDPELDRGRVQLLSA 616


>gi|282165272|ref|YP_003357657.1| hypothetical protein MCP_2602 [Methanocella paludicola SANAE]
 gi|282157586|dbj|BAI62674.1| conserved hypothetical protein [Methanocella paludicola SANAE]
          Length = 403

 Score = 43.0 bits (100), Expect = 0.025,   Method: Composition-based stats.
 Identities = 23/139 (16%), Positives = 53/139 (38%), Gaps = 9/139 (6%)

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A  + E    +D   Y     M    I + +G+ ++A   F +          +R  A+ 
Sbjct: 161 AEEALESAPDEDQAAY---VRMLKGCIALRQGNPESAITFFDE----RKPAGRLRTLASF 213

Query: 132 QAASILVDTSSYEEISKILQKLS-EPSNPM-HQFANEILGISALKFGKVQKAKTIFEELA 189
            +  +  +   YE   +  +       +P+        +G  A+  G ++KA++  +E++
Sbjct: 214 YSGIVRYEKEDYEGAIRHFESARPGAGDPLDRMAIGCNVGACAVNIGDMEKAESELQEVS 273

Query: 190 KDNNSPFGISTRSQMILAN 208
           +      G     + +LA+
Sbjct: 274 RSAWKKSGAKEAYRKLLAD 292


>gi|87306703|ref|ZP_01088850.1| Cellulose synthase (UDP-forming) [Blastopirellula marina DSM 3645]
 gi|87290882|gb|EAQ82769.1| Cellulose synthase (UDP-forming) [Blastopirellula marina DSM 3645]
          Length = 1121

 Score = 43.0 bits (100), Expect = 0.025,   Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 50/146 (34%), Gaps = 17/146 (11%)

Query: 53  VGENFAQALELFNSNKLDDARSSFEKILSQDNKLY-------NPLSNMYIASILVAKGDT 105
            G   A+A  L  + +   A + F+ I +  N             + +  A       D 
Sbjct: 777 TGLKLARANRLLKTKQTSAALAEFKAIETDLNSGILSGTPEEQINTFLGTARSASDLNDI 836

Query: 106 KNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFAN 165
             A   + +  +    P      A L+ A++LVD  +Y+++ ++L  L          A 
Sbjct: 837 PLAIAAYQQALDRRRDPQ-----AALELANLLVDQEAYDDVRRLLSILPGGYESRLIQAR 891

Query: 166 EILGISALKFGKVQKAKTIFEELAKD 191
                     G + +A T  E L  +
Sbjct: 892 -----LDFADGNIDQALTSLETLTNE 912


>gi|71898144|ref|ZP_00680330.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|71732118|gb|EAO34174.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
          Length = 212

 Score = 43.0 bits (100), Expect = 0.025,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 76/204 (37%), Gaps = 16/204 (7%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           + G+    W+    + ++  + + F        ++   V +  + A +     KL  A+ 
Sbjct: 11  EHGERIRSWLRKNGVGLLCGVLLGFVFIAAWQWREAKQVDQFTSAAQQFAVFGKLLQAKE 70

Query: 75  ------SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
                 +  K+      LY  L  + +A      G+T  A +I   +          +  
Sbjct: 71  LGNAAQALAKLNGAPAGLYAELGALQLAKAQSEAGNTAEAIKILRTL----PVDSQFKLI 126

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A  + A +LV T   +E +K+L   ++  +       EI G + L  GK ++A+  + + 
Sbjct: 127 ADQRLARLLVATGKADEANKLLATRNDDVS------FEIQGDALLVLGKREQARERYAKA 180

Query: 189 AKDNNSPFGISTRSQMILANIIAS 212
               +S        ++ L ++  +
Sbjct: 181 LAMGDSAAPQRRILEIKLMDVGGT 204


>gi|307258932|ref|ZP_07540663.1| UDP-N-acetylglucosamine-peptide-n- acetylglucosaminyltransferase
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306866956|gb|EFM98813.1| UDP-N-acetylglucosamine-peptide-n- acetylglucosaminyltransferase
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
          Length = 495

 Score = 43.0 bits (100), Expect = 0.026,   Method: Composition-based stats.
 Identities = 25/158 (15%), Positives = 59/158 (37%), Gaps = 5/158 (3%)

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           + L    K+D+A  ++  +  +D+      + + +   L  +G    A   F  V+ +D 
Sbjct: 5   IALGKQGKVDEAIVAYRNVNREDSAEVYVRAQINLGITLGEQGKFDEAIAAFNNVSREDS 64

Query: 121 APLAVRYAATLQAASILVDTSSYEE-ISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
               +   A +     L      +E I        E S  ++     +LG+      K+ 
Sbjct: 65  --TELYAIAQVNLGITLRKQGRGDEAIVAYRNVNREDSAKLYVKVQFLLGLIFESQDKLD 122

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           +A+  F  +   ++    + T++Q+ L  +    +  +
Sbjct: 123 EARDAFNNIRLSDSV--ELYTKAQVYLKVLNIGKKEIR 158



 Score = 40.7 bits (94), Expect = 0.12,   Method: Composition-based stats.
 Identities = 14/83 (16%), Positives = 31/83 (37%), Gaps = 5/83 (6%)

Query: 44  GSHEKKKNIVGENFAQA-----LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
                 +    E + +A     + L    K D+A ++F  +  +D+     ++ + +   
Sbjct: 19  AYRNVNREDSAEVYVRAQINLGITLGEQGKFDEAIAAFNNVSREDSTELYAIAQVNLGIT 78

Query: 99  LVAKGDTKNAAEIFLKVANDDLA 121
           L  +G    A   +  V  +D A
Sbjct: 79  LRKQGRGDEAIVAYRNVNREDSA 101


>gi|284036952|ref|YP_003386882.1| hypothetical protein Slin_2038 [Spirosoma linguale DSM 74]
 gi|283816245|gb|ADB38083.1| TPR repeat-containing protein [Spirosoma linguale DSM 74]
          Length = 1024

 Score = 43.0 bits (100), Expect = 0.026,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 60/160 (37%), Gaps = 5/160 (3%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNP-LSNMYIASILVAKGDTKNAAEIFLK 114
            F  A  ++ S K + A  SF   + +     N   +  Y+A       D  NA   +  
Sbjct: 755 QFENARNIYASGKYEQAIQSFLNFMQEYPASPNTNQARYYVAESYRQTNDVANALRYYNL 814

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSY--EEISKILQKLSEPSNPMHQFANEILGISA 172
           V  D+ +   VR  A  +AA + V   +Y     +  L +    S      A   L  + 
Sbjct: 815 VIADNKSDYLVR--AATRAAELEVKQKNYGRAVRNYQLIQSRAGSKAEQVTAQLGLMDTY 872

Query: 173 LKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
             + K+  A  +  E+A   N   G   R+Q++L  +  S
Sbjct: 873 FVYPKLDSAAIVAREIAAGGNVVPGAQNRAQLMLGKVALS 912



 Score = 42.3 bits (98), Expect = 0.044,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 47/128 (36%), Gaps = 2/128 (1%)

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           A  L+   + DD  +  E +L ++N        ++ A +   +     A   +    N  
Sbjct: 243 AQSLYRQRRYDDLLAYTEPLLKRNNGAGMNEVALFTAEVFYQQNQFARAIPYYKSYVNTA 302

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
            A      A   +    L  T +Y +    L+ L+   +   Q+A   LG+S L+     
Sbjct: 303 GAKAP--GAVKFRYGQSLFRTGAYNDAIAQLKTLAGGKDTTAQYAAYTLGVSYLQTQNPT 360

Query: 180 KAKTIFEE 187
            A   F++
Sbjct: 361 YALNAFDQ 368


>gi|51473430|ref|YP_067187.1| hypothetical protein RT0223 [Rickettsia typhi str. Wilmington]
 gi|51459742|gb|AAU03705.1| rickettsial conserved hypothetical protein [Rickettsia typhi str.
           Wilmington]
          Length = 220

 Score = 43.0 bits (100), Expect = 0.026,   Method: Composition-based stats.
 Identities = 24/162 (14%), Positives = 62/162 (38%), Gaps = 6/162 (3%)

Query: 54  GENFAQALEL-FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
           G+   + + L       + A ++ E +++  N     ++ +   ++ +++     A E+ 
Sbjct: 57  GDILVKTIGLDTTKANNELAFNTLENLVTSSNTKIKEIAALEQVALKISEKKYLEAKELL 116

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYE-----EISKILQKLSEPSNPMHQFANEI 167
            K+  +          A +    I++D  + +     ++ K L    +   P    A  I
Sbjct: 117 NKIIENKEYSEISTSYARISWCCIVLDDQNLDIQDKEKLQKYLDYFDDEKKPFWATATII 176

Query: 168 LGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
             I  +K     +A+   + L   NN    +  +++ +L N+
Sbjct: 177 KSILDIKHNMKTQAEKNLKNLLASNNVSDLLKDQAKALLVNL 218


>gi|163783489|ref|ZP_02178480.1| hypothetical protein HG1285_08749 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881253|gb|EDP74766.1| hypothetical protein HG1285_08749 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 850

 Score = 43.0 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 69/171 (40%), Gaps = 11/171 (6%)

Query: 51  NIVGEN-FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAA 109
              GE  +   +  F   K  +A + F+++L  D   +   + + IA      G+ + A 
Sbjct: 490 EESGEEIYLMGMSFFIEGKYREAIAYFKRLL--DRGEFKSKALLRIADSYYNLGNYERAK 547

Query: 110 EIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSE--PSNPMHQFANEI 167
           E++ ++             ATL  A I +     +++ K+++      P +PM       
Sbjct: 548 ELYKEILTFYPDSTEAFD-ATLALAQIELQK-PTKDLEKLVRDFERKFPGSPMITDLKYQ 605

Query: 168 LGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           L    +K G+  +A+ I EEL     +      ++ + LA I    +R ++
Sbjct: 606 LANLYIKEGRRSEARRILEELL----TKETYRAKALIKLAEIEEDPRRKEE 652


>gi|71274605|ref|ZP_00650893.1| conserved hypothetical protein [Xylella fastidiosa Dixon]
 gi|71900905|ref|ZP_00683020.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|71164337|gb|EAO14051.1| conserved hypothetical protein [Xylella fastidiosa Dixon]
 gi|71729317|gb|EAO31433.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
          Length = 212

 Score = 43.0 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 76/204 (37%), Gaps = 16/204 (7%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           + G+    W+    + ++  + + F        ++   V +  + A +     KL  A+ 
Sbjct: 11  EHGERIRSWLRKNGVGLLCGVLLGFVFIAAWQWREAKQVDQFTSAAQQFAVFGKLLQAKE 70

Query: 75  ------SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
                 +  K+      LY  L  + +A      G+T  A +I   +          +  
Sbjct: 71  LGNAAQALAKLNGASAGLYAELGALQLAKAQSEAGNTAEAIKILCTL----PVDSQFKLI 126

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A  + A +LV T   +E +K+L   ++  +       EI G + L  GK ++A+  + + 
Sbjct: 127 ADQRLARLLVATGKADEANKLLATRNDDVS------FEIQGDALLLLGKREQARERYAKA 180

Query: 189 AKDNNSPFGISTRSQMILANIIAS 212
               +S        ++ L ++  +
Sbjct: 181 LAMGDSAAPQRRILEIKLMDVGGA 204


>gi|328552259|gb|AEB22751.1| transcriptional regulator of the glucitol operon [Bacillus
           amyloliquefaciens TA208]
 gi|328910598|gb|AEB62194.1| transcriptional regulator of the glucitol operon [Bacillus
           amyloliquefaciens LL3]
          Length = 825

 Score = 43.0 bits (100), Expect = 0.028,   Method: Composition-based stats.
 Identities = 29/141 (20%), Positives = 53/141 (37%), Gaps = 12/141 (8%)

Query: 62  ELFNSNKLDDARSSFEK----ILSQDNKLYNPL---SNMYIASILVAKGDTKNAAEIFLK 114
            L   N LD A    E     +       ++ L        + +L+  GD + AA +   
Sbjct: 626 ALMEVNDLDGALQQVETGLKILEQSGAPDHDDLKVWGLALQSRLLLKTGDPEKAAAMLDD 685

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQ-FANEI---LGI 170
           +  D      +R+   L    +    S YEE   + +  +  S         E    LG+
Sbjct: 686 I-KDQPVSPIIRHRVLLVRGDLSFAHSHYEEAITLYEAANTTSAAYGGEKTIEAYFNLGM 744

Query: 171 SALKFGKVQKAKTIFEELAKD 191
           + +K  +++KA+  FE++  D
Sbjct: 745 AYVKCNQLEKAEKAFEQMLYD 765


>gi|116625490|ref|YP_827646.1| TPR repeat-containing protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228652|gb|ABJ87361.1| Tetratricopeptide TPR_2 repeat protein [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 701

 Score = 43.0 bits (100), Expect = 0.028,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 66/163 (40%), Gaps = 16/163 (9%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKL--YNPLSNMYIASILVAKGDTKNAAEIF 112
           +   QA +L+ + +  +A   F+ + ++D K   Y          +++      +A ++F
Sbjct: 26  QTLDQAEQLWKARRFKEANEVFKALEAKDPKNPDYKV----RWGRMMLDHAQPTDAEDLF 81

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA 172
            +      A    +  A       L+   S+E  +  L + +  S+P    A E+L   A
Sbjct: 82  GE------ALEIKKDHAGALVGMALIAADSFEARAGDLARKALASDPKLTEAQELLARLA 135

Query: 173 LKFGKVQKAKTIFEE-LAKDNNSPFGISTRSQMILANIIASDQ 214
           L+     KA    ++ +A D   P  +  ++ +   +++A  +
Sbjct: 136 LEDNDNVKATEEAKKAIAMD---PNSVQGKAILATIDLLADKK 175


>gi|193213294|ref|YP_001999247.1| hypothetical protein Cpar_1652 [Chlorobaculum parvum NCIB 8327]
 gi|193086771|gb|ACF12047.1| conserved hypothetical protein [Chlorobaculum parvum NCIB 8327]
          Length = 229

 Score = 43.0 bits (100), Expect = 0.029,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 24  IAPLLILMILSLAIWFYLFDGSH--EKKKNIVGENFAQALELF-NSNKLDDAR--SSFEK 78
           I  L+ +++L+    FY    S   E++ +        A+E+   +   D+A+  S+ + 
Sbjct: 30  IIILVSVILLAAGGSFYWLQKSRVDEQQASAALSKLIPAIEVASETGDTDNAKLVSNMQT 89

Query: 79  ILSQ-DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
           I+ +         + +Y+A++    G T  A  ++ KV +D+    
Sbjct: 90  IIKRWGYTPSGNKTRLYLATLWYNNGKTSEALALYEKVKSDNKDLQ 135


>gi|163856332|ref|YP_001630630.1| hypothetical protein Bpet2021 [Bordetella petrii DSM 12804]
 gi|163260060|emb|CAP42361.1| putative membrane protein [Bordetella petrii]
          Length = 212

 Score = 43.0 bits (100), Expect = 0.030,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 65/204 (31%), Gaps = 8/204 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFAQALELFNSNKL 69
            K    +     +  L  +  L+   W+        +    +G  E    A  L  ++  
Sbjct: 14  IKAWWARYGTL-VVTLAAIAALAWGGWWGWKAYQTHRANQAMGYFEALEDAARLGGTDST 72

Query: 70  DDARSSFEKILSQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
              +++   + S      Y     +  A  L  + D   A E    +A       A++  
Sbjct: 73  VRIKAAASTLRSDYPSTGYAARGALVAAHALEQQNDIAGAREQLEWLAGQSKQ-AALQPV 131

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A ++ A +L+D   Y+     L +L  P         +  G      GK + A+  ++  
Sbjct: 132 ARVRLAGLLLDQKQYD---AALAQLDNPPAAFAALYADRRGDILAAQGKPEDARKAWQAA 188

Query: 189 AKDNNSPFGISTRSQMILANIIAS 212
                +   +    Q+ L  +  +
Sbjct: 189 LDGLAANDPLRQAVQLKLDALSGA 212


>gi|159185684|ref|NP_357303.2| cellulose biosynthesis protein [Agrobacterium tumefaciens str. C58]
 gi|159140818|gb|AAK90088.2| cellulose biosynthesis protein [Agrobacterium tumefaciens str. C58]
          Length = 548

 Score = 43.0 bits (100), Expect = 0.031,   Method: Composition-based stats.
 Identities = 31/159 (19%), Positives = 67/159 (42%), Gaps = 16/159 (10%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           + QAL+L+ S K  +A  +F ++LS         +   +A++   +G+ + A   FL + 
Sbjct: 366 YEQALKLYKSGKKSEASIAFGQVLSAAPDHLG--AQFGLANLAFDRGEFREAEIAFLSLI 423

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL---GISAL 173
                P+ +     L+     +    Y E S+  ++++    P H    E L    ++ +
Sbjct: 424 AAGHEPVVL----WLRIGETRLAQQHYHEASEAFRQVTN-RAPFH---REALYKCAVALI 475

Query: 174 KFGKVQKAKTIFEELA---KDNNSPFGISTRSQMILANI 209
              +  +A  I E L     D+ +    + +++  LA +
Sbjct: 476 AAERQMEAAEILERLQHYHSDDAAHLEYAEKARAALARL 514


>gi|288818942|ref|YP_003433290.1| tetratricopeptide repeat protein [Hydrogenobacter thermophilus
           TK-6]
 gi|288788342|dbj|BAI70089.1| tetratricopeptide repeat protein [Hydrogenobacter thermophilus
           TK-6]
 gi|308752528|gb|ADO46011.1| conserved hypothetical protein [Hydrogenobacter thermophilus TK-6]
          Length = 189

 Score = 43.0 bits (100), Expect = 0.031,   Method: Composition-based stats.
 Identities = 26/169 (15%), Positives = 60/169 (35%), Gaps = 9/169 (5%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
             LL+  +  L   F  +     ++ + +     Q      S    +A+   +K+  +++
Sbjct: 8   IALLLAGVCLLVGAFLGWRWWESRRLSKISYQEYQIRREIQSGNYQEAQKLIKKVAEEES 67

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKV---ANDDLAPLAVRYAATLQAASILVDTS 141
             Y PL   Y   +    G   +  +    +     D       R     + A       
Sbjct: 68  P-YTPLVLSYRLYLEREGGLQVDEVKTLQSIISSLKDKDILSLYRE----RLAYAYFTAG 122

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
           +Y++  ++L+ +   S      A  + G+   K G+  +AK ++ ++ K
Sbjct: 123 NYQKALELLESIKGDSLNY-YSAQILKGLVLEKVGRRDEAKAVYSQVEK 170


>gi|256819391|ref|YP_003140670.1| hypothetical protein Coch_0551 [Capnocytophaga ochracea DSM 7271]
 gi|256580974|gb|ACU92109.1| Tetratricopeptide TPR_2 repeat protein [Capnocytophaga ochracea DSM
           7271]
          Length = 1001

 Score = 43.0 bits (100), Expect = 0.031,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 54/175 (30%), Gaps = 5/175 (2%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLY-NPLSNMY 94
           A W             + G  +  A   +  N   +A S FEK L +         +  +
Sbjct: 703 ASWAKGLGYVEVTDLELEGATYEAAERQYMQNNTKEAISGFEKYLKEFPNGMRRTNAEFF 762

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL- 153
           +A +    G    A   +  V          +    +    IL++  SY +    L+ L 
Sbjct: 763 LAQMYFNSGQKAKALTHYENVTKSGSNEYGEQSLTRV--CQILLEAGSYLKAKPYLEDLE 820

Query: 154 -SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
            +        +A   L           KA     ++ ++ +    I   + ++LA
Sbjct: 821 RTATIAQNKTYAQSNLMRVCYNEKLYDKAIEYANKVLEEKSIDTRIKNDAYIVLA 875


>gi|189424524|ref|YP_001951701.1| type II and III secretion system protein [Geobacter lovleyi SZ]
 gi|189420783|gb|ACD95181.1| type II and III secretion system protein [Geobacter lovleyi SZ]
          Length = 769

 Score = 42.7 bits (99), Expect = 0.032,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 58/185 (31%), Gaps = 41/185 (22%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           ++IA L++ + L ++              +   +N+++  +L    KL++A   + + + 
Sbjct: 5   RYIAILVVALALFISG------------CSAARKNYSEGRDLEEQGKLEEAMYRYAEAVK 52

Query: 82  QDN--KLYNPL---SNMYIASILVAKGDT-------KNAAEIFLKVAN-DDLAPLA---- 124
                  Y      + M  A     +GDT         A   +   A  D   P      
Sbjct: 53  AAPEESEYRVKFLNTRMAAARGREQEGDTLLKTGNYAGAVAAYQTAAGLDPSQPRLVQKA 112

Query: 125 -----VRYAATLQAASILVDTS----SYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
                +R AA      + ++                 L+  +      A     I+AL+ 
Sbjct: 113 NNAIRLRDAAAAYQEGLTLEKGNKLRDAATAFGRALDLAAENPEYRSAAQR---IAALRK 169

Query: 176 GKVQK 180
            K+  
Sbjct: 170 SKLDG 174


>gi|308172496|ref|YP_003919201.1| glucitol operon transcriptional regulator [Bacillus
           amyloliquefaciens DSM 7]
 gi|307605360|emb|CBI41731.1| transcriptional regulator of the glucitol operon [Bacillus
           amyloliquefaciens DSM 7]
          Length = 825

 Score = 42.7 bits (99), Expect = 0.032,   Method: Composition-based stats.
 Identities = 29/141 (20%), Positives = 53/141 (37%), Gaps = 12/141 (8%)

Query: 62  ELFNSNKLDDARSSFEK----ILSQDNKLYNPL---SNMYIASILVAKGDTKNAAEIFLK 114
            L   N LD A    E     +       ++ L        + +L+  GD + AA +   
Sbjct: 626 ALMEVNDLDGALQQVETGLKILEQSGAPDHDDLKVWGLALQSRLLLKTGDPEKAAAMLDD 685

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQ-FANEI---LGI 170
           +  D      +R+   L    +    S YEE   + +  +  S         E    LG+
Sbjct: 686 I-KDQPVSPIIRHRVLLVRGDLSFAHSHYEEAITLYEAANTTSAAYGGEKTIEAYFNLGM 744

Query: 171 SALKFGKVQKAKTIFEELAKD 191
           + +K  +++KA+  FE++  D
Sbjct: 745 AYVKCNQLEKAEKAFEQMLYD 765


>gi|47227439|emb|CAG04587.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 553

 Score = 42.7 bits (99), Expect = 0.033,   Method: Composition-based stats.
 Identities = 21/107 (19%), Positives = 41/107 (38%), Gaps = 15/107 (14%)

Query: 91  SNMYIASILVAKGDTKNAAEIFLKV----ANDDLAPLAVRYAATL-------QAASILVD 139
           + +   +IL+ +G+T+ A E F +V    A+++ A   +     L        AA    D
Sbjct: 108 ARLQRGNILLKQGNTQEAREDFNEVLQRSADNEEAQQQLMKTHELVGLQEEAHAAYHQGD 167

Query: 140 TSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
            S+   + + +       +P      E+     ++ G  QKA     
Sbjct: 168 YSTTISVLERV----IEISPWDPDVRELRAECYIRMGDPQKAIQDLA 210


>gi|225849348|ref|YP_002729512.1| tetratricopeptide repeat domain protein [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225643614|gb|ACN98664.1| tetratricopeptide repeat domain protein [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 556

 Score = 42.7 bits (99), Expect = 0.033,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 67/153 (43%), Gaps = 11/153 (7%)

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              + D+A   ++ +L  + +  + L+ ++   + V   D +NA++   K+   +     
Sbjct: 212 QQKRYDEAIKLYKSVLQDNPQNLDALNRLFQ--VYVDIDDFENASKTIDKIITLNPKDND 269

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKL--SEPSNPMHQFANEILGISALKFGKVQKAK 182
               A L+   + +    Y++  +IL+ L  +   NP + FA  +LG++       +KAK
Sbjct: 270 ----ALLKKFLLYI---KYDKAKEILEDLQKTVKENPDNLFAKFMLGMAYESLNDYKKAK 322

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
            I+EEL +       +  R   +  N+   D+ 
Sbjct: 323 EIYEELYQQQPDNQELVDRLTQVYVNLKEYDKA 355


>gi|330894496|gb|EGH27157.1| hypothetical protein PSYMO_38995 [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 213

 Score = 42.7 bits (99), Expect = 0.034,   Method: Composition-based stats.
 Identities = 27/164 (16%), Positives = 58/164 (35%), Gaps = 4/164 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ-D 83
             L ++++L    W     G  +    +  +    AL                K+ S+  
Sbjct: 27  GLLALVVVLGWQFWHRYQAGQSQGASMLYQQLLETALTPSGQADTARVAEISGKLKSEFG 86

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y    ++++A + V  G   +AA     VA D  A   +   A  + A +L   +  
Sbjct: 87  GTTYAQFGSLFVAKVAVDAGKLDDAAAELKTVA-DKPANDTLGEIARQRLARVLAAQNKT 145

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           ++  K+L   +           E+ G   ++ G+  +A   +++
Sbjct: 146 DDALKLLDGDA--DKAFLASREELKGDLLVQLGRTDEAYAAYQK 187


>gi|228939335|ref|ZP_04101927.1| TPR repeat-containing protein [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228972213|ref|ZP_04132828.1| TPR repeat-containing protein [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228978828|ref|ZP_04139197.1| TPR repeat-containing protein [Bacillus thuringiensis Bt407]
 gi|228780904|gb|EEM29113.1| TPR repeat-containing protein [Bacillus thuringiensis Bt407]
 gi|228787526|gb|EEM35490.1| TPR repeat-containing protein [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228820359|gb|EEM66392.1| TPR repeat-containing protein [Bacillus thuringiensis serovar
           berliner ATCC 10792]
          Length = 890

 Score = 42.7 bits (99), Expect = 0.035,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 68/180 (37%), Gaps = 26/180 (14%)

Query: 24  IAPLLILMILSLAIWFYL-----FDGSHEKKKNIVGENFAQALELFNSN-KLDDARSSFE 77
           I  + I++I     +++      +    E+ +    +   +  +L         A    +
Sbjct: 509 IGSITIVVIGGATAYYFYTTNAKYQHFMEQARQAYHD---KKYKLAEEAVGHAIAVKGKD 565

Query: 78  KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
           +            +++ +A+I VA+G  K A +   K+  D         AA L A++  
Sbjct: 566 E------------AHLQLATIYVAEGKNKIAIDYITKLIKDREIDKENNEAAYLLASA-N 612

Query: 138 VDTSSYEE----ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
                Y+E      + L   ++   P  + A   L +S +K  + +KA+ +  +++   N
Sbjct: 613 FRIGKYQEAVPNFEQALANNAKGIEPYKKDAMRDLAVSHMKMKEFEKAEDVIVKMSTKTN 672


>gi|160871620|ref|ZP_02061752.1| transmembrane protein [Rickettsiella grylli]
 gi|159120419|gb|EDP45757.1| transmembrane protein [Rickettsiella grylli]
          Length = 208

 Score = 42.7 bits (99), Expect = 0.035,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 49/149 (32%), Gaps = 4/149 (2%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           +    +   K  +     I   +I  I     W Y    S E   +I    +   +    
Sbjct: 6   EIEQAEHVKKWFRDYGGGIVLGIIFAIFVSLGWNYWHQ-SRENNLSIASMQYEHLVVAII 64

Query: 66  SNKLDDARSSFEK--ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
           SN+         +  I +     Y  L+ + +A I V + +   AA     V  D     
Sbjct: 65  SNENITTLKKRAEEIIKNYAYTPYASLAALQLAKIAVNQNNLVLAANRLTWVV-DHGHDQ 123

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQK 152
            +R  A ++   IL+  +   E  K + +
Sbjct: 124 TLRSIAKMRLVRILLAQNRPIEALKRVSQ 152


>gi|94269422|ref|ZP_01291458.1| hypothetical protein MldDRAFT_1984 [delta proteobacterium MLMS-1]
 gi|93451226|gb|EAT02129.1| hypothetical protein MldDRAFT_1984 [delta proteobacterium MLMS-1]
          Length = 223

 Score = 42.7 bits (99), Expect = 0.036,   Method: Composition-based stats.
 Identities = 31/185 (16%), Positives = 76/185 (41%), Gaps = 13/185 (7%)

Query: 26  PLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNK 85
             LI+ IL+ +       G  E+      E  AQA+ L +  +     ++ E++     +
Sbjct: 47  AALIVAILAYSFGTQFATGREEQ----ASEQLAQAMRLDDEAQR---LAAMEEVADSYRR 99

Query: 86  -LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
                 S + +A      G+ + AA  + ++ +             L  A +L++  + E
Sbjct: 100 TGAGIWSRIELAHHQRGSGELEAAATAYEELLDSLSRHDPRHPMVRLSLAQVLLELGAKE 159

Query: 145 EISKILQKLSEPSNPMHQFANEILGISAL--KFGKVQKAKTIFEELAKDNNSPFGISTRS 202
              +  ++L+         A  +LG + +  + G+   A+  ++++A+  ++P  +  ++
Sbjct: 160 RAVEQYRQLAAVEG---YQAWGLLGSAEILRRQGETAAAREKYQQVAELADAPPLLVEQA 216

Query: 203 QMILA 207
           +  LA
Sbjct: 217 ERRLA 221


>gi|332878926|ref|ZP_08446641.1| putative tol-pal system protein YbgF [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|332683277|gb|EGJ56159.1| putative tol-pal system protein YbgF [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 1000

 Score = 42.7 bits (99), Expect = 0.037,   Method: Composition-based stats.
 Identities = 30/175 (17%), Positives = 52/175 (29%), Gaps = 5/175 (2%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLY-NPLSNMY 94
           A W             +    +  A      N   +A  +FEK L Q         +  Y
Sbjct: 702 AAWAKSLGYVEVTDLELESATYEAAERQLLQNNNKEAIVAFEKYLQQFPNGMRRTNAEFY 761

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL- 153
           +A  L   G    A   +  V             +  +   IL+D  SY +    L++L 
Sbjct: 762 LAQALYNTGKKAEALTHYENVTKAGS--SEFGEPSLTRVCQILLDAGSYLKAKPYLEELE 819

Query: 154 -SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
            +        +A   L           KA     ++  + +    I   + ++LA
Sbjct: 820 KTATIAQNKTYAQSNLMRVCYNEKLYDKAIEYANKVLSEKSIDTRIKNDAYIVLA 874



 Score = 38.8 bits (89), Expect = 0.51,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 62/165 (37%), Gaps = 12/165 (7%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKL--YNPL 90
           +   +   F      K +   + F   A   FN     +A  +FEK L Q+ K   +   
Sbjct: 478 AATYFQQFFANPSASKTDEYPKAFYGLAYANFNQRHYAEAIVNFEKYLKQNPKDEDFKHD 537

Query: 91  SNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA--SILVD--TSSYEEI 146
           + + +A      G    A E + K+     A       A  Q A     VD   +  E++
Sbjct: 538 AMLRLADSYFVTGKYWPAMEGYNKLIESKSADQ---DYAAYQKAISYGFVDRPNNKIEDL 594

Query: 147 SKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
            + ++    P++ +   A   LG + +  G   K    +++LAKD
Sbjct: 595 ERFIKNY--PTSNLRPNALYELGNTYVTQGDTDKGLQYYQQLAKD 637


>gi|304414050|ref|ZP_07395418.1| hypothetical protein REG_1110 [Candidatus Regiella insecticola
           LSR1]
 gi|304283264|gb|EFL91660.1| hypothetical protein REG_1110 [Candidatus Regiella insecticola
           LSR1]
          Length = 212

 Score = 42.7 bits (99), Expect = 0.037,   Method: Composition-based stats.
 Identities = 34/198 (17%), Positives = 72/198 (36%), Gaps = 18/198 (9%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG----------ENFAQALELFNSNKLDD 71
           K +   ++L+I  L  W Y  +  +   KN             +N   A+   + N  D 
Sbjct: 23  KILVVSVLLIITVLIGWHYWQNNQNTAMKNAASSYQQVSEILTDNKKAAVTKSDDNTNDV 82

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A    E+ + +++  Y     + +A+  V +     A +    +A        +     L
Sbjct: 83  A----EQFVRENDNNYAVFIALELANRFVVQKIFDKAEQQL-MLALTKTKDTNLLSLTNL 137

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A + +     ++  K L   S         A ++ G   L  G +  A+  + + A +
Sbjct: 138 RLAKLQLQLKKPDQALKTLN--SVEGEAWVAMAEDVRGDIFLNKGDIPAARAAYTK-ATE 194

Query: 192 NNSPFGISTRSQMILANI 209
            N+   + T  ++ L N+
Sbjct: 195 VNAAQTLQTLLRLKLDNL 212


>gi|114571477|ref|YP_758157.1| thioredoxin [Maricaulis maris MCS10]
 gi|114341939|gb|ABI67219.1| thioredoxin [Maricaulis maris MCS10]
          Length = 315

 Score = 42.7 bits (99), Expect = 0.039,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 47/131 (35%), Gaps = 5/131 (3%)

Query: 59  QALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
           +AL    +  L+ A      +L  D      + ++    + +  GDT  AA I  +V  D
Sbjct: 148 RALASIEAGDLNGASQDLAAVLQADPGHPGAIGSLVR--LWIKAGDTDKAASILAQVPAD 205

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKV 178
                A+   A  +AA  L   +  ++      + +  ++  +  A   L  + L  G  
Sbjct: 206 RADDPAI-DGA--RAALELATGAPVDDAETAALRQAVAADSSNFQARYDLAEALLTGGDH 262

Query: 179 QKAKTIFEELA 189
           + A      + 
Sbjct: 263 KGAVDQLIAIT 273


>gi|313676599|ref|YP_004054595.1| hypothetical protein [Marivirga tractuosa DSM 4126]
 gi|312943297|gb|ADR22487.1| Tetratricopeptide TPR_1 repeat-containing protein [Marivirga
           tractuosa DSM 4126]
          Length = 232

 Score = 42.7 bits (99), Expect = 0.040,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 70/177 (39%), Gaps = 16/177 (9%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSS-------F 76
           +  ++ L+I++   + Y  +  +        +   QA+  + + + D A +         
Sbjct: 42  LGGIIALIIVAFFGYRYYMNNLN----QEAQKEMFQAVYWYENEEYDLALNGDGNNFGFL 97

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
             +    +     L++ Y+ SI + +G+ + A +     ++DDL   A R  A +  A  
Sbjct: 98  AIVEDYGSTKAGNLASFYLGSIYLQQGEFETAIDYLEDFSSDDLLVQA-RAYALIGDAY- 155

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFGKVQKAKTIFEELAKD 191
            ++  +Y   +    K +   +        ++  G++  K   ++ A   + ++ KD
Sbjct: 156 -MELGNYSTAADHYGKAANYKSNKEFSPEYLMKQGLAYEKANDLEAAMGSYRKVVKD 211


>gi|315185627|gb|EFU19395.1| Tetratricopeptide TPR_1 repeat-containing protein [Spirochaeta
           thermophila DSM 6578]
          Length = 304

 Score = 42.7 bits (99), Expect = 0.040,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 45/113 (39%), Gaps = 6/113 (5%)

Query: 84  NKLYNPLSNMYIASI-LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSS 142
            K Y     +    +    +GD   ++E FL+ A D      +   A  ++   L++   
Sbjct: 152 AKGYEAADLLEYLGLSAAREGDYSKSSEFFLR-AKDQGKDSPLLDLALARS---LIELGD 207

Query: 143 YEEISKILQKLSEPSN-PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
           Y+    +L  L+E SN      A  +LG    +  + + A+   E+L +   S
Sbjct: 208 YDRAHDLLSPLAEQSNREYQVEALLLLGELHYRAQRYEDARDYLEKLVQIQES 260


>gi|15966702|ref|NP_387055.1| hypothetical protein SMc03144 [Sinorhizobium meliloti 1021]
 gi|307300262|ref|ZP_07580042.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
 gi|307321139|ref|ZP_07600543.1| tetratricopeptide TPR_4 [Sinorhizobium meliloti AK83]
 gi|15075974|emb|CAC47528.1| Hypothetical protein SMc03144 [Sinorhizobium meliloti 1021]
 gi|306893214|gb|EFN23996.1| tetratricopeptide TPR_4 [Sinorhizobium meliloti AK83]
 gi|306904428|gb|EFN35012.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
          Length = 399

 Score = 42.7 bits (99), Expect = 0.041,   Method: Composition-based stats.
 Identities = 26/169 (15%), Positives = 58/169 (34%), Gaps = 16/169 (9%)

Query: 50  KNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAA 109
           +  +G    +A+ L        A + + +++          +   +A +L   GD   A 
Sbjct: 186 RRSLGIVLERAVALHAFGDFHGAEAGYRQLIRTVPGHIE--ARCRLAHLLSDVGDYVEAE 243

Query: 110 EIFLKVA-NDDLAPLAVRYAATLQAASILVDTS--SYEEISKILQKLSEPSNPMHQFANE 166
            ++  +      A   + +    Q A      +  +++E+            P       
Sbjct: 244 HLYRTLLPAVPNADDVLHWLGDTQMAQASYRKAGKTFQELLARY--------PHRGILRY 295

Query: 167 ILGISALKFGKVQKAKTIFEE---LAKDNNSPFGISTRSQMILANIIAS 212
            L ++ L  G+   A   F+    +  D+ + F   TR+Q IL  ++  
Sbjct: 296 KLAVARLASGQRDAAIATFQSFHDIVSDDANHFLCKTRAQEILIRLMGV 344


>gi|307257230|ref|ZP_07539001.1| hypothetical protein appser10_12290 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306864272|gb|EFM96184.1| hypothetical protein appser10_12290 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 207

 Score = 42.7 bits (99), Expect = 0.041,   Method: Composition-based stats.
 Identities = 22/152 (14%), Positives = 52/152 (34%), Gaps = 6/152 (3%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE--L 63
           +   ++      K     I   +I+   +   W +  +    +        +   +E  L
Sbjct: 10  EEQQFEEAKNWFKENGTPILVAVIIACAATLGWNFWQNH-QVQAAQQTSAIYQNVMESYL 68

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  K       F  I    +  Y   S +  A   V K D   AA+  L+ A    +  
Sbjct: 69  QDPEKNQPLIEKF--ISENKDSSYAVFSQLESAKQAVEKADFA-AAKTVLQSALTSTSDA 125

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSE 155
           +++     + A++     +Y++    L ++++
Sbjct: 126 SLQTIIRFRLATLDYQLKNYDDALATLGQITD 157


>gi|91216378|ref|ZP_01253345.1| putative TPR-repeat protein [Psychroflexus torquis ATCC 700755]
 gi|91185516|gb|EAS71892.1| putative TPR-repeat protein [Psychroflexus torquis ATCC 700755]
          Length = 1003

 Score = 42.7 bits (99), Expect = 0.041,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 62/175 (35%), Gaps = 5/175 (2%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPL-SNMY 94
           A W    D       +I    +  A   F  N+ D A   F+K L +     N L SN Y
Sbjct: 701 ATWVRGLDFVEVADSDIEEATYEAAENKFLDNETDKAIEGFKKYLEEFPNGKNSLKSNFY 760

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLS 154
           +A  L      + +   + +V N   +         L  A I +   +Y++    L +L 
Sbjct: 761 LAQSLFNSDQRQASVPYYEEVINSRSSEFTEESLRRL--AQIYLSEKNYDQAITSLNRLE 818

Query: 155 EPSNPMH--QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
             +N      FA   L  +  +     +     E +   +N    + + +++ +A
Sbjct: 819 TEANFSQNVVFAQSNLMKAYYEIENFDRTVIYAELILSKDNIDEEVLSDAKIFIA 873


>gi|256840799|ref|ZP_05546307.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|256738071|gb|EEU51397.1| conserved hypothetical protein [Parabacteroides sp. D13]
          Length = 485

 Score = 42.3 bits (98), Expect = 0.043,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 50/142 (35%), Gaps = 15/142 (10%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYN---PLSNMYIASILVAKGDTKNAAEIFL-KVAND 118
           L     +  A     +++ ++   Y     L  ++        GD + A E F   +  D
Sbjct: 172 LETEGDVPRAIELCNELIDKNPFSYEYWFTLGRLHSMV-----GDYEKAIEAFDFALTCD 226

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKV 178
           D           +  A  L    SYE+  +  Q++      M + +  ++    +K  + 
Sbjct: 227 DSDTEL-----KILKAYCLYMNESYEKAIEEYQEIEGDEEVMRRIS-PLMAECYMKLEQY 280

Query: 179 QKAKTIFEELAKDNNSPFGIST 200
           +KA  +F  +  D +   G + 
Sbjct: 281 EKAYQLFSTIINDPDMEDGPTN 302


>gi|311694783|gb|ADP97656.1| TPR repeat protein [marine bacterium HP15]
          Length = 891

 Score = 42.3 bits (98), Expect = 0.044,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 59/154 (38%), Gaps = 9/154 (5%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
             L                  A+ L  +   ++A    E +   + +      N+ +A +
Sbjct: 485 RELQQSLENGYPENRSAQLLAAISLAGTGDTEEAIKKLEGLRDTNPESIEV--NITLAQL 542

Query: 99  LVAKGDTKNAAEIFLKVAN--DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
               G    A   F+  A   +   PL  R AA L AA+   +++  E+ +K + + +EP
Sbjct: 543 YQEAGQPAKAVNSFVAAAKQTEPKLPLLFR-AARLHAANHQNESA-VEDWTKSVSQ-AEP 599

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
                  A EIL + +    +++ A++   E+ K
Sbjct: 600 ELADALAATEILWLIS--EDELETARSRLAEVGK 631


>gi|224437952|ref|ZP_03658894.1| hypothetical protein HcinC1_08263 [Helicobacter cinaedi CCUG 18818]
 gi|313144396|ref|ZP_07806589.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313129427|gb|EFR47044.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 237

 Score = 42.3 bits (98), Expect = 0.045,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 66/204 (32%), Gaps = 29/204 (14%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           +S+        + ++    Y+    + ++       WF +      +K       +A  +
Sbjct: 15  KSDEKLLENAFRLEILWRRYRKYVYVAVVCGAVGLGWFGISSYIQAQKAQEASAAYAVLM 74

Query: 62  ELFNSNKLDDARSS--------------------FEKILSQDNKLYNPLSNMYIASI-LV 100
           +   + +  ++                       +EK+ +  NKL   L+   +A++ L 
Sbjct: 75  QDSENKEALESLQKASPNLYDMYMYFNANGDKTNYEKLANSQNKLIKNLAKYEVATLNLS 134

Query: 101 AKGDTKNAAEIFLKVANDDLAP----LAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
            K   K+A +                 A+R  A LQ A +L       E  + L  L   
Sbjct: 135 EKIQDKDAIKNTDFTGEFKSLENVEYKALRDLAILQEAYVLFQQDKIAEAHQKLM-LIAE 193

Query: 157 SNPMHQFANEILGISALKFGKVQK 180
           ++P    A E + +    F    K
Sbjct: 194 NSPF---AAEAMILKHYGFEDSAK 214


>gi|153833527|ref|ZP_01986194.1| tetratricopeptide TPR_2 [Vibrio harveyi HY01]
 gi|156973382|ref|YP_001444289.1| hypothetical protein VIBHAR_01069 [Vibrio harveyi ATCC BAA-1116]
 gi|148870178|gb|EDL69119.1| tetratricopeptide TPR_2 [Vibrio harveyi HY01]
 gi|156524976|gb|ABU70062.1| hypothetical protein VIBHAR_01069 [Vibrio harveyi ATCC BAA-1116]
          Length = 204

 Score = 42.3 bits (98), Expect = 0.047,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 74/197 (37%), Gaps = 6/197 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + +    +      K   K +    ++ +  L  W Y  D S  +      +++   +  
Sbjct: 5   DTEEQQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQD-SVIQASEAASQSYTTVMNA 63

Query: 64  FNSNKLDDARSSFEKILSQDN-KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             + K  DA++  +  +  +  K Y+ L+ + +A + V   D   A E   K A  +   
Sbjct: 64  LQT-KGADAQADIQAFIDSNEVKEYSVLAALQLAKVQVDAKDLSAALEQL-KWAQSNTKD 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
            A+    + + A I  +  +++  +  L K++           E+ G  AL+ G  + A 
Sbjct: 122 AALSPLISYRIARIEAEMGNFDAANAELGKVT--DAAWTGRIAELRGDIALRQGDKEAAY 179

Query: 183 TIFEELAKDNNSPFGIS 199
             + E  +  ++   + 
Sbjct: 180 AAYTEAQQAADASPTLQ 196


>gi|148658023|ref|YP_001278228.1| hypothetical protein RoseRS_3925 [Roseiflexus sp. RS-1]
 gi|148570133|gb|ABQ92278.1| Tetratricopeptide TPR_2 repeat protein [Roseiflexus sp. RS-1]
          Length = 1180

 Score = 42.3 bits (98), Expect = 0.047,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 43/129 (33%), Gaps = 5/129 (3%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL-K 114
              +AL  +      +A ++F+++      L   L     A I  A+GD + +   F   
Sbjct: 238 RLVRALADYKRGAYSNAIATFDELERDYPALRPGLLRTLRAVIWWARGDYEQSVGEFQRA 297

Query: 115 VANDDLAPLAVRYAATLQA--ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA 172
           +A    A  A    A L A   ++  D           + ++   +         L +  
Sbjct: 298 IAAMPDASPA--ELARLYASLGAVQYDMGDPASRESFNRAIALLQDQDLGVLRYSLALEE 355

Query: 173 LKFGKVQKA 181
           L+ G    A
Sbjct: 356 LRAGDPADA 364


>gi|50122140|ref|YP_051307.1| hypothetical protein ECA3218 [Pectobacterium atrosepticum SCRI1043]
 gi|49612666|emb|CAG76116.1| putative membrane protein [Pectobacterium atrosepticum SCRI1043]
          Length = 206

 Score = 42.3 bits (98), Expect = 0.047,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 53/149 (35%), Gaps = 4/149 (2%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +             ++ Q  E     K  +A +S EK  +++   Y  L+++ +A  
Sbjct: 39  WRFWQSHQNDSVQAASASYQQVTEQLAEGK-AEAIASTEKFTAENKNTYGALASLELARH 97

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V + D   A +  ++  +       +     L+ A + +  +  ++  K L  +     
Sbjct: 98  YVDQKDFAKAVQQLVQAQSQTK-DADLLAVVNLRLARVQLQENKADDALKTLDAIKLEG- 155

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEE 187
                A E+ G      G  Q A+  + +
Sbjct: 156 -WASQAAEVRGDILASKGDNQAARDAYNK 183


>gi|188996311|ref|YP_001930562.1| Tetratricopeptide TPR_2 repeat protein [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931378|gb|ACD66008.1| Tetratricopeptide TPR_2 repeat protein [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 938

 Score = 42.3 bits (98), Expect = 0.048,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 47/113 (41%), Gaps = 12/113 (10%)

Query: 45  SHEKKKNIVGENFAQALELFNS----NKLDDARSSFEKILSQDNKLYNPLSNMYIASILV 100
             E   +   E+     +L  S    N+LD A+      L+ +N+ Y   S + +A I  
Sbjct: 702 YQEVAASNSKESALATYKLAESYYKLNQLDKAKQVLIDYLNTNNEEYKVPSKLLLAEIYE 761

Query: 101 AKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
            + D  N+ +I+ ++  +D            + A IL+    Y++ S   ++L
Sbjct: 762 KQNDLDNSIKIYEELKENDDV--------KFKLAKILLQKGDYDKASAYFKEL 806



 Score = 41.9 bits (97), Expect = 0.060,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 68/166 (40%), Gaps = 13/166 (7%)

Query: 48  KKKNIVGENFAQALELF---NSNKLDDARSSFEKILSQDNKLYNP--LSNMYIASILVAK 102
            K +   ++   A  L    +    +D  S  +  L++    Y    +  + +A I   K
Sbjct: 634 TKYSGTKDSIDAAYNLIILESKGSSEDVESMIKSFLAK-YPNYPLANILKIQLAEIYQNK 692

Query: 103 GDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN-PMH 161
           G  ++A +I+ +VA  +    A+   AT + A      +  ++  ++L      +N    
Sbjct: 693 GKIEDAIKIYQEVAASNSKESAL---ATYKLAESYYKLNQLDKAKQVLIDYLNTNNEEYK 749

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
             +  +L     K   +  +  I+EEL ++++  F +   ++++L 
Sbjct: 750 VPSKLLLAEIYEKQNDLDNSIKIYEELKENDDVKFKL---AKILLQ 792


>gi|65319495|ref|ZP_00392454.1| COG0457: FOG: TPR repeat [Bacillus anthracis str. A2012]
          Length = 216

 Score = 42.3 bits (98), Expect = 0.049,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 74/197 (37%), Gaps = 11/197 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +   ++ +         K   K I  +   +++ +      +  +   K     E   QA
Sbjct: 19  LTVAHEQSEPSAFSTWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQA 78

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +     K ++A      +  +D       + + +A+I VA+G  K A +   K+  D  
Sbjct: 79  YDNKKYTKAEEAVGHAIAVKGKDE------AYLQLATIYVAEGKNKIAIDYITKLIKDRE 132

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKL----SEPSNPMHQFANEILGISALKFG 176
                  AA L A++       Y+E  +  ++     ++   P  + A   L +S +K  
Sbjct: 133 IDKENNEAAYLLASA-NFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMK 191

Query: 177 KVQKAKTIFEELAKDNN 193
           + +KA+ +  +++   N
Sbjct: 192 EFEKAEDVIVKMSTKTN 208


>gi|220935215|ref|YP_002514114.1| tetratricopeptide repeat family protein [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996525|gb|ACL73127.1| tetratricopeptide repeat family protein [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 209

 Score = 42.3 bits (98), Expect = 0.050,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 72/188 (38%), Gaps = 7/188 (3%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   D    +   K  +   K +   ++L +  L  W Y  D  +E +     + F    
Sbjct: 3   EYTTDEEKVEAIKKWWQENGKAVIAGIVLGVGGLFGWRYWVD-LNETRAERASDLFLAVD 61

Query: 62  ELFNSNKLDDARSSFEKILSQDNKL-YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               +  L+ AR   + + +   +  Y PL+ + +A +  A+G+  +A E   + A    
Sbjct: 62  RASRAGDLEQARQQADLLRADYARTPYAPLAALELARLQAARGELDSAEENL-RWAIGQG 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS-NPMHQFANEILGISALKFGKVQ 179
               V + A ++ A +LV   + E   + L+ ++            E+ G +    G   
Sbjct: 121 RSEEVTWTARVRLARVLV---ALERADEALETVAGSHPQGFEALVEEVRGDAWRAKGDRD 177

Query: 180 KAKTIFEE 187
           +A+  ++ 
Sbjct: 178 QARAAYDR 185


>gi|225873528|ref|YP_002754987.1| tetratricopeptide repeat protein [Acidobacterium capsulatum ATCC
           51196]
 gi|225794548|gb|ACO34638.1| tetratricopeptide repeat protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 300

 Score = 42.3 bits (98), Expect = 0.051,   Method: Composition-based stats.
 Identities = 25/172 (14%), Positives = 57/172 (33%), Gaps = 26/172 (15%)

Query: 43  DGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAK 102
                +        F +A++   +  +D+A + +E IL+Q         N+   +I   +
Sbjct: 125 HRFRREPAPHTPAAFLEAVQCEEAGNIDEAVALYEAILAQAPGHAPSAINL--GTIYYHR 182

Query: 103 GDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQ 162
            D   A  ++      +  P           A    D      +   LQ+++E       
Sbjct: 183 KDYARAERLYR--GATEADPNY---------ALAFFDLG---NVLDELQRMTEAIEAYQA 228

Query: 163 FANEI---------LGISALKFGKVQKA-KTIFEELAKDNNSPFGISTRSQM 204
               +         L ++  + G+ ++A +     +  D + P+    R Q+
Sbjct: 229 AIRLVPRYADAHYNLALAYERQGERRQALRHWTAYIKLDPHGPWHNHARLQI 280


>gi|70732276|ref|YP_262032.1| hypothetical protein PFL_4952 [Pseudomonas fluorescens Pf-5]
 gi|68346575|gb|AAY94181.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 213

 Score = 42.3 bits (98), Expect = 0.053,   Method: Composition-based stats.
 Identities = 36/192 (18%), Positives = 70/192 (36%), Gaps = 10/192 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M S  D    + K    +     +   L+ +++     +  +      +       + Q 
Sbjct: 1   MSSTEDEQLAELKDWWQRNGKPLVTGGLLALVI--VFGWQAWHKYQNNQSQGASVLYQQL 58

Query: 61  LE--LFNSNKLDDAR-SSFEKILSQDNKL--YNPLSNMYIASILVAKGDTKNAAEIFLKV 115
           LE  L    K D AR +     L+ +     Y    N+++A + V  G   +AA     V
Sbjct: 59  LETTLTPDGKPDAARVTDLAGKLNSEFGGTAYAQYGNLFVAKVAVDTGKLDDAAAQLKAV 118

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
           A D  A   +   A  + A +L   +  +E  K+L   +           E+ G   ++ 
Sbjct: 119 A-DKPANPTLGEVARQRLAQVLAAQNKADEALKLLDGDA--DKAFLATREELKGDLLVQL 175

Query: 176 GKVQKAKTIFEE 187
           G+V +A   +++
Sbjct: 176 GRVDEAHAAYQK 187


>gi|237756064|ref|ZP_04584643.1| hypothetical protein SULYE_0692 [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691781|gb|EEP60810.1| hypothetical protein SULYE_0692 [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 210

 Score = 42.3 bits (98), Expect = 0.054,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 73/178 (41%), Gaps = 15/178 (8%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           +K++   L+L+I+ ++   Y  +    + +     + ++  +L + NKL+DAR   E   
Sbjct: 31  FKFVLAFLLLLIV-ISGGLYYKNQVDRQNREKASLHLSKIADLLSENKLEDARKELENFK 89

Query: 81  SQ--DNKLYNP-LSNMYIASILVAKGDTKNAAEIFLKVAND--DLAPLAVRYAATLQAAS 135
            Q  +  LY   L+   + +    K + + A ++  ++  D        +        A 
Sbjct: 90  KQYGNTDLYKVALAYEILINKEENKENKEPAEKLKNELKTDLSSGVNEYL--------AY 141

Query: 136 ILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           +     + +E  +IL+ +          A  +  +   K G  Q+A+ IFE +  + N
Sbjct: 142 LKNKEGNSKEAKEILKSIDSKKYNY-ISAQTLYALILRKEGNFQEAQKIFETIKNNQN 198


>gi|308050455|ref|YP_003914021.1| hypothetical protein Fbal_2745 [Ferrimonas balearica DSM 9799]
 gi|307632645|gb|ADN76947.1| Protein of unknown function DUF2133 [Ferrimonas balearica DSM 9799]
          Length = 204

 Score = 42.3 bits (98), Expect = 0.054,   Method: Composition-based stats.
 Identities = 26/190 (13%), Positives = 64/190 (33%), Gaps = 7/190 (3%)

Query: 8   NSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEK---KKNIVGENFAQALELF 64
           ++ + + +  K  +K     +I   +      + ++   +    K       + + +E  
Sbjct: 5   STEEQQVEAIKRFWKEYGVSIIGGAVLGLGGLFGWNTYQDHLVGKAEQASAAYGRVIEQA 64

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             ++     +  +         Y PLS + +A   V  GD   A  +  +V        A
Sbjct: 65  GQSQDALDTAVAQFQNEYGESGYGPLSQLLLARAAVEAGDLAKAETLLTEVL--PSMDSA 122

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
                TL+ A + +     +     L+K++           E+ G   +K G++  A+  
Sbjct: 123 TAPMVTLRLARVQLAQDKLDAAQATLEKVTSE--AFAAQREELKGDVLVKKGEMDAARAA 180

Query: 185 FEELAKDNNS 194
           ++       +
Sbjct: 181 YQSALDAGGA 190


>gi|171321333|ref|ZP_02910292.1| conserved hypothetical protein [Burkholderia ambifaria MEX-5]
 gi|171093390|gb|EDT38578.1| conserved hypothetical protein [Burkholderia ambifaria MEX-5]
          Length = 209

 Score = 42.3 bits (98), Expect = 0.054,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 72/199 (36%), Gaps = 7/199 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +   +    K    +  +  +   ++L  L +A  F  ++    ++       + Q  + 
Sbjct: 5   DEQESIESLKAWWAR--WGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKA 62

Query: 64  FNSNKLDD-ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +N     AR++ +      +  Y  ++ +  A+  +        A+  L+ A D    
Sbjct: 63  AAANDKATMARAAADMEDKFGSTPYAQMTAL-AAAKTLYAAGDAAGAKAQLQWAADHAKD 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+
Sbjct: 122 EEYKQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGLVADRRGDLLAAQGKTDDAR 179

Query: 183 TIFEELAKDNNSPFGISTR 201
             + +LA D  S    S R
Sbjct: 180 AAY-KLALDGLSKDDQSAR 197


>gi|296113388|ref|YP_003627326.1| uncharacterized protein family (UPF0070) family protein [Moraxella
           catarrhalis RH4]
 gi|295921082|gb|ADG61433.1| uncharacterized protein family (UPF0070) family protein [Moraxella
           catarrhalis RH4]
          Length = 277

 Score = 41.9 bits (97), Expect = 0.054,   Method: Composition-based stats.
 Identities = 21/178 (11%), Positives = 55/178 (30%), Gaps = 22/178 (12%)

Query: 28  LILMILSLAIWFYLFDGSHEKKKNIVGENFAQA---------------LELFNSNKLDDA 72
            +L++L++   +  +  ++ K   +  + +                  L+      L + 
Sbjct: 30  AVLLVLAVFFGWQYYQKNYAKIDTVAADAYTSISVRDERLVQAYLNPQLDEVAKQALAEE 89

Query: 73  RSSF-----EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRY 127
                      + +  N +Y   + M  A       D   A     +  + +L    +  
Sbjct: 90  EKQLFGDIDALVAAHGNTVYAWQALMIKARHQTNNNDLDGAVATLSQATSINLDDDGLTA 149

Query: 128 AATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
            A ++ A  ++          I  + + P+        E+LG       ++  AK+ +
Sbjct: 150 IAKIRHARAMLANGDTNGALSIANE-AMPT-AFEASRQELLGDIYHAKNEIDNAKSAY 205


>gi|253702419|ref|YP_003023608.1| hypothetical protein GM21_3833 [Geobacter sp. M21]
 gi|251777269|gb|ACT19850.1| Tetratricopeptide TPR_2 repeat protein [Geobacter sp. M21]
          Length = 760

 Score = 41.9 bits (97), Expect = 0.055,   Method: Composition-based stats.
 Identities = 29/144 (20%), Positives = 55/144 (38%), Gaps = 8/144 (5%)

Query: 47  EKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
             + +   E FA AL+L  S    +A   +  + +         + + + ++L   G  +
Sbjct: 4   SSRADSPAETFAAALDLQKSGHRGEAERLYRALAASG-GELAADACINLGALLDESGRAE 62

Query: 107 NAAEIF-LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFAN 165
            A E +   +A  +  PLA+       A S L     + E +  L + +    P    A 
Sbjct: 63  EALEKYREALALREGDPLALNN-----AGSTLFKLGRFTE-AAQLFRHALERAPDSLEAQ 116

Query: 166 EILGISALKFGKVQKAKTIFEELA 189
             LG +  + G +  A  +F +L 
Sbjct: 117 VALGAALQRDGDLPAALAVFRDLV 140


>gi|313675127|ref|YP_004053123.1| hypothetical protein [Marivirga tractuosa DSM 4126]
 gi|312941825|gb|ADR21015.1| Tetratricopeptide TPR_3 repeat-containing protein [Marivirga
           tractuosa DSM 4126]
          Length = 1375

 Score = 41.9 bits (97), Expect = 0.057,   Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 68/172 (39%), Gaps = 25/172 (14%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
           +LA++ Y     ++ ++      F +AL L N N +  A S +              S  
Sbjct: 178 ALAVYDYA-SLRYQSQEEDALAYFQEALPLLN-NHISQAGSQYLN------------SLY 223

Query: 94  YIASILVAKGDTKNAAEIFLKV----ANDDLAPLAVRYAATLQAASILVDTSS------- 142
           Y+AS+L  KG+   AA+ + KV     +++L    +   +  Q A I  + S        
Sbjct: 224 YVASLLQEKGEADKAAKFYDKVIGITQDNNLQNSDLWKISAYQRALIYQENSQNDNAISF 283

Query: 143 YEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
           YE +   L+   +    M+      LG+   K G+  K +++      D  S
Sbjct: 284 YEILKTQLENDEDTDREMYASTRNNLGVLYQKTGQTNKGESLLALSGDDLQS 335


>gi|255072115|ref|XP_002499732.1| predicted protein [Micromonas sp. RCC299]
 gi|226514994|gb|ACO60990.1| predicted protein [Micromonas sp. RCC299]
          Length = 604

 Score = 41.9 bits (97), Expect = 0.057,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 27/92 (29%), Gaps = 4/92 (4%)

Query: 92  NMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRY--AATLQAASILVDTSSYEEISKI 149
               A  L   G  + A   +   A+   A    R    A  QAA    ++      +  
Sbjct: 469 RFERAQALKQLGRWEEAIGDYDAAADAFTANRQKREAKIAEAQAAFAKFESGDVPSATAR 528

Query: 150 LQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
           L+ L+             L  +  + G   KA
Sbjct: 529 LETLAR--QLYSSDVRAALAATYWRAGDAAKA 558


>gi|66044498|ref|YP_234339.1| hypothetical protein Psyr_1250 [Pseudomonas syringae pv. syringae
           B728a]
 gi|71737138|ref|YP_273580.1| hypothetical protein PSPPH_1322 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257487196|ref|ZP_05641237.1| hypothetical protein PsyrptA_28231 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289626151|ref|ZP_06459105.1| hypothetical protein PsyrpaN_13628 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649057|ref|ZP_06480400.1| hypothetical protein Psyrpa2_15127 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298486025|ref|ZP_07004099.1| putative membrane protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|302185743|ref|ZP_07262416.1| hypothetical protein Psyrps6_05338 [Pseudomonas syringae pv.
           syringae 642]
 gi|63255205|gb|AAY36301.1| conserved hypothetical protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|71557691|gb|AAZ36902.1| conserved hypothetical protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298159502|gb|EFI00549.1| putative membrane protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320322919|gb|EFW79009.1| hypothetical protein PsgB076_19710 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329958|gb|EFW85946.1| hypothetical protein PsgRace4_11956 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330869575|gb|EGH04284.1| hypothetical protein PSYAE_20478 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330874710|gb|EGH08859.1| hypothetical protein Pgy4_06724 [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330950785|gb|EGH51045.1| hypothetical protein PSYCIT7_05133 [Pseudomonas syringae Cit 7]
 gi|330969068|gb|EGH69134.1| hypothetical protein PSYAR_01052 [Pseudomonas syringae pv. aceris
           str. M302273PT]
 gi|330985016|gb|EGH83119.1| hypothetical protein PLA107_08326 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009188|gb|EGH89244.1| hypothetical protein PSYTB_05737 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 213

 Score = 41.9 bits (97), Expect = 0.057,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 57/164 (34%), Gaps = 4/164 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ-D 83
             L ++++L    W        +    +  +    AL                K+ S+  
Sbjct: 27  GLLALVVVLGWQFWHRYQASQSQGASMLYQQLLETALTPSGQADTARVAEISGKLKSEFG 86

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y    ++++A + V  G   +AA     VA D  A   +   A  + A +L   +  
Sbjct: 87  GTTYAQFGSLFVAKVAVDAGKLDDAAAELKTVA-DKPANDTLGEIARQRLARVLAAQNKT 145

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           ++  K+L   +           E+ G   ++ G+  +A   +++
Sbjct: 146 DDALKLLDGDA--DKAFLASREELKGDLLVQLGRTDEAYAAYQK 187


>gi|241206783|ref|YP_002977879.1| thioredoxin [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860673|gb|ACS58340.1| thioredoxin [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 324

 Score = 41.9 bits (97), Expect = 0.059,   Method: Composition-based stats.
 Identities = 24/160 (15%), Positives = 53/160 (33%), Gaps = 10/160 (6%)

Query: 49  KKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNA 108
           +   +    A+A EL  +  +D+A   +  ++  D +    L+ M    I   +      
Sbjct: 148 EAAEIEAVVAEAAELLATGNIDEAAQLYGAVMQADPENAKALAGMAECMIAANQHHRARE 207

Query: 109 A--EIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANE 166
              E+  ++A D      +     ++ A  L        + + L      +NP    A  
Sbjct: 208 ILTELPEELAKDAGIQAVLMKLEQIEEARKL---GDPVALERELA-----ANPDDHEARI 259

Query: 167 ILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMIL 206
            L       G+  +A      + + + +      R Q++ 
Sbjct: 260 KLAKIRNVEGRRDEAADHLLLIMRKDRAFDDDGARRQLLQ 299


>gi|329120686|ref|ZP_08249348.1| hypothetical protein HMPREF9123_2779 [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327460483|gb|EGF06819.1| hypothetical protein HMPREF9123_2779 [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 471

 Score = 41.9 bits (97), Expect = 0.059,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 45/125 (36%), Gaps = 13/125 (10%)

Query: 41  LFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILV 100
           L+    E++++ V E++A++  L    +   A      IL+Q+         + +A  L 
Sbjct: 92  LYRRLDEERRDAVLEDYAESFLLREDGQYARAEEKLRGILAQNPGYAPV--RLQLALTLS 149

Query: 101 AKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM 160
             G T+ AA    +V      P          AA +     S+ +  K  +     +N  
Sbjct: 150 QSGQTREAAAEVAEVKETSELPPDA-------AAFLN----SFSDYLKRDRAWQFDANAY 198

Query: 161 HQFAN 165
           +    
Sbjct: 199 YLADR 203


>gi|257464647|ref|ZP_05629018.1| hypothetical protein AM202_05319 [Actinobacillus minor 202]
 gi|257450307|gb|EEV24350.1| hypothetical protein AM202_05319 [Actinobacillus minor 202]
          Length = 351

 Score = 41.9 bits (97), Expect = 0.060,   Method: Composition-based stats.
 Identities = 13/66 (19%), Positives = 30/66 (45%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           E F+ A +L  + KLD+A   ++ I  +D+  +   + + +  +   +G    A   +  
Sbjct: 7   ELFSTATQLVQAGKLDEAIDIYQSIQKEDSAEWFANAQVNLGVLFYKQGKVSEAIGAWQL 66

Query: 115 VANDDL 120
           +  +D 
Sbjct: 67  IQKEDS 72


>gi|167392256|ref|XP_001733493.1| tetratricopeptide repeat protein, tpr [Entamoeba dispar SAW760]
 gi|165895951|gb|EDR23526.1| tetratricopeptide repeat protein, tpr, putative [Entamoeba dispar
           SAW760]
          Length = 454

 Score = 41.9 bits (97), Expect = 0.060,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 47/128 (36%), Gaps = 12/128 (9%)

Query: 64  FNSNKLDDARSSFEKILSQDN---KLYNPLSNMYIASILVAKGDTKNAAEIFL-KVANDD 119
            N+ KL +A + F+++L         Y     +   S     GD + A   F   V  D+
Sbjct: 244 VNTGKLKEAITHFDQLLRNHPNLLAGY-----LGRGSAKAMLGDLQKALTDFNLAVKKDN 298

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM--HQFANEILGISALKFGK 177
               A +    ++ A     ++  E+ +K ++   E  +       A   LGI       
Sbjct: 299 KCGDAYKRRGQVKLALGQTQSA-LEDFNKAIELTPEEGDCYRQRGSAYHALGIFDKAAED 357

Query: 178 VQKAKTIF 185
           ++K+  + 
Sbjct: 358 IKKSIKLI 365


>gi|222056474|ref|YP_002538836.1| Lytic transglycosylase catalytic [Geobacter sp. FRC-32]
 gi|221565763|gb|ACM21735.1| Lytic transglycosylase catalytic [Geobacter sp. FRC-32]
          Length = 717

 Score = 41.9 bits (97), Expect = 0.063,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 55/152 (36%), Gaps = 12/152 (7%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLS---NMYIASILVAKGDTKNAAEIF 112
            F +A  LF S    DA   F  +   ++     L+     ++A  L   G    A   +
Sbjct: 265 QFKKAQALFKSRHYKDAEQLFTALGKVNSG--KVLNGEIRFWLARTLAKNGKEDEAVSAY 322

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQK--LSEPSNPMHQFANEILGI 170
           L +  D     A+   A L+AA I       +E  ++LQ+     P + + +     +  
Sbjct: 323 L-LLADTWPKAALADDALLEAAQIRKSQKKTDEAQQLLQRSLFLYPESGLKKSLLWEIAW 381

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRS 202
              +    + A   F +LA   N+      R+
Sbjct: 382 ERYQAKDYKAASDWFGKLAGYENA----RDRA 409


>gi|284041501|ref|YP_003391841.1| glycosyl transferase family 2 [Conexibacter woesei DSM 14684]
 gi|283945722|gb|ADB48466.1| glycosyl transferase family 2 [Conexibacter woesei DSM 14684]
          Length = 797

 Score = 41.9 bits (97), Expect = 0.064,   Method: Composition-based stats.
 Identities = 32/162 (19%), Positives = 56/162 (34%), Gaps = 17/162 (10%)

Query: 57  FAQALELFNSNKLDDARSSFEKILS--QDNKLYNPLSNMY-------IASILVAKGDTKN 107
           F QA       + DDA + FE+ ++       Y     M        +A I    GD   
Sbjct: 442 FEQAAAAQALGRTDDAIAYFERCIAMGDAPSRYTATVGMGTYLPTIALAEIRHQHGDPAA 501

Query: 108 AAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEI 167
           A E+         A           AA++L D +  + +   +++L     P       +
Sbjct: 502 AVELLDGALA---AHPGFFGLVLPFAAALLDDGAEPDVVVARVEELVAKLTP---TVRFM 555

Query: 168 LGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
           LG +  + G+ + A+  + EL      P     R  +  A +
Sbjct: 556 LGTALYEHGETEAAEQQYRELL--AQQPSSGHARVALAEALL 595


>gi|254785745|ref|YP_003073174.1| tetratricopeptide repeat domain-containing protein [Teredinibacter
           turnerae T7901]
 gi|237684440|gb|ACR11704.1| tetratricopeptide repeat domain protein [Teredinibacter turnerae
           T7901]
          Length = 933

 Score = 41.9 bits (97), Expect = 0.064,   Method: Composition-based stats.
 Identities = 34/148 (22%), Positives = 64/148 (43%), Gaps = 14/148 (9%)

Query: 59  QALELFNSNKLDDARSSF-EKILSQDNKLYN--------PLSNMYIASILVAKGDTKNAA 109
           +A    N+N+  +A ++F + +  +               LS    A      GDT  A 
Sbjct: 548 RARSYLNTNQFSEAEAAFTDTLALEGITSSQRAKLESSIALSIYRQAENARDTGDTALAQ 607

Query: 110 EIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEI-- 167
            +F +V+ D +    +   A   AAS+ +   S++     L+KL + + P  ++A E   
Sbjct: 608 NLFNRVS-DTIPGSELAPTALYDAASLALKDKSWQAAIFFLEKL-QSNYPRQKYAKETSR 665

Query: 168 -LGISALKFGKVQKAKTIFEELAKDNNS 194
            L ++ L   +  KA + FE LA  +++
Sbjct: 666 QLSVAYLNAKQTDKAASQFEALANSDDT 693


>gi|326570124|gb|EGE20169.1| hypothetical protein E9U_04475 [Moraxella catarrhalis BC8]
          Length = 277

 Score = 41.9 bits (97), Expect = 0.065,   Method: Composition-based stats.
 Identities = 21/178 (11%), Positives = 55/178 (30%), Gaps = 22/178 (12%)

Query: 28  LILMILSLAIWFYLFDGSHEKKKNIVGENFAQA---------------LELFNSNKLDDA 72
            +L++L++   +  +  ++ K   +  + +                  L+      L + 
Sbjct: 30  AVLLVLAVFFGWQYYQKNYAKIDTVAADAYTSISVRDERLVQAYLNPQLDEVAKQALAEE 89

Query: 73  RSSF-----EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRY 127
                      + +  N +Y   + M  A       D   A     +  + +L    +  
Sbjct: 90  EKQLFGDIDALVAAHGNTVYAWQALMIKARHQTNNNDLDGAVTTLGQATSINLDDDGLTA 149

Query: 128 AATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
            A ++ A  ++          I  + + P+        E+LG       ++  AK+ +
Sbjct: 150 IAKIRHARAMLANGDTNGALSIANE-AMPT-AFEASRQELLGDIYHAKNEIDNAKSAY 205


>gi|126667425|ref|ZP_01738397.1| hypothetical protein MELB17_14201 [Marinobacter sp. ELB17]
 gi|126628181|gb|EAZ98806.1| hypothetical protein MELB17_14201 [Marinobacter sp. ELB17]
          Length = 809

 Score = 41.9 bits (97), Expect = 0.065,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 66/151 (43%), Gaps = 7/151 (4%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
              A+          A +  EK+ + +  +    +++ +A++  +  ++  A E  L  A
Sbjct: 489 LLAAIADGRMGNSGPAITRLEKLTTDNPNMQP--AHLALANLYASTDNSDKAVEQLLAAA 546

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
                P  +      QA  +     S EE+ + L  ++E   P+   A+ +  +  ++ G
Sbjct: 547 VIT--PEVIGPLQ--QAGQLYASNHSVEEVQQWLGTVAETHPPLAPNASLLSALIHIQQG 602

Query: 177 KVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
            V++A+T+ E +A ++N P G     Q++ A
Sbjct: 603 DVEQARTLLEPMANEDN-PIGYRAYGQLLAA 632


>gi|326559871|gb|EGE10271.1| hypothetical protein E9G_07545 [Moraxella catarrhalis 7169]
 gi|326560780|gb|EGE11147.1| hypothetical protein E9K_09114 [Moraxella catarrhalis 103P14B1]
 gi|326569643|gb|EGE19695.1| hypothetical protein E9Q_01818 [Moraxella catarrhalis BC1]
 gi|326570862|gb|EGE20886.1| hypothetical protein E9S_03977 [Moraxella catarrhalis BC7]
 gi|326574412|gb|EGE24354.1| hypothetical protein E9Y_05582 [Moraxella catarrhalis 101P30B1]
 gi|326576407|gb|EGE26316.1| hypothetical protein EA1_05607 [Moraxella catarrhalis O35E]
          Length = 277

 Score = 41.9 bits (97), Expect = 0.066,   Method: Composition-based stats.
 Identities = 21/178 (11%), Positives = 55/178 (30%), Gaps = 22/178 (12%)

Query: 28  LILMILSLAIWFYLFDGSHEKKKNIVGENFAQA---------------LELFNSNKLDDA 72
            +L++L++   +  +  ++ K   +  + +                  L+      L + 
Sbjct: 30  AVLLVLAVFFGWQYYQKNYAKIDTVAADTYTSISVRDERLVQAYLNPQLDEVAKQALAEE 89

Query: 73  RSSF-----EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRY 127
                      + +  N +Y   + M  A       D   A     +  + +L    +  
Sbjct: 90  EKQLFGDIDALVAAHGNTVYAWQALMIKARHQTNNNDLDGAVATLSQATSINLDDDGLTA 149

Query: 128 AATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
            A ++ A  ++          I  + + P+        E+LG       ++  AK+ +
Sbjct: 150 IAKIRHARAMLANGDTNGALSIANE-AMPT-AFEASRQELLGDIYHAKNEIDNAKSAY 205


>gi|262091743|gb|ACY25332.1| tetratricopeptide repeat protein [uncultured actinobacterium]
          Length = 225

 Score = 41.9 bits (97), Expect = 0.066,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 57/150 (38%), Gaps = 12/150 (8%)

Query: 58  AQALELFNSNKLDDARSSFEKILSQDNK---LYNPLSNMYIASILVAKGDTKNAAEIFLK 114
              L L+   +  DA    EK  +        +  L++ Y A +   K D     E++ +
Sbjct: 75  IAGLSLYRLGQWRDAADHLEKARAAMPASTLNHPVLADCYRALMRYEKVD-----ELWKE 129

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMH-QFANEILGISAL 173
           + +    P  V     + AAS   D    +   +I+Q+  +    +      E   ++ L
Sbjct: 130 LKDASPDPAIVAE-GRIVAASAQADKGDIQNAVRIMQQTKKDPAKVREHHLREWYVLADL 188

Query: 174 --KFGKVQKAKTIFEELAKDNNSPFGISTR 201
             + G V  A+  F+++A ++     I  R
Sbjct: 189 YDRSGDVINAREWFKKIAHNDPDFSDIRDR 218


>gi|261252180|ref|ZP_05944753.1| membrane protein [Vibrio orientalis CIP 102891]
 gi|260935571|gb|EEX91560.1| membrane protein [Vibrio orientalis CIP 102891]
          Length = 204

 Score = 41.9 bits (97), Expect = 0.066,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 69/197 (35%), Gaps = 6/197 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + +    +      K   K +    ++ +  L  W Y  D S    +    E++ +A+++
Sbjct: 5   DTEEQQVEAIKDWWKENGKAVILGAVVGLGGLFGWRYYQD-SVTAAQEAASESYTKAVQV 63

Query: 64  FNSNKLDDARSSFEKILSQD-NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
               K   A    +  +  + +  Y  L+ + +A + V  G+   A     + A      
Sbjct: 64  LAE-KGASAEGDIQTFIDGNKDTEYATLAALQLAKVQVEAGNFDEALAQL-EWAKSATKD 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
            AV      + A +  +   ++     L  +++ S        E+ G   L+ G  Q A 
Sbjct: 122 AAVLSVVNYRLARVKAEQGEFDAAVAELANITDESWAGRVA--ELKGDILLRKGDEQAAY 179

Query: 183 TIFEELAKDNNSPFGIS 199
             + E  +  ++   + 
Sbjct: 180 AAYTEAQQSGDASQTLQ 196


>gi|226328003|ref|ZP_03803521.1| hypothetical protein PROPEN_01894 [Proteus penneri ATCC 35198]
 gi|225203707|gb|EEG86061.1| hypothetical protein PROPEN_01894 [Proteus penneri ATCC 35198]
          Length = 206

 Score = 41.9 bits (97), Expect = 0.068,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 48/145 (33%), Gaps = 5/145 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +  N      K     Y     L  ++       +  +      +       FA  
Sbjct: 1   MEVYSTENEQVDAIKQFFKNYGLTIVLAAVIGFGGVFGWKYWQSHQTNRLQESAGAFATI 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE----IFLKVA 116
            E   +    +  +  EK +++ N +Y  L+++ +A I +   D  +          KV 
Sbjct: 61  SEAL-AKPTPENIALAEKFVTETNDIYGALASLELAQIAIDANDLVSGERHLTNAVAKVK 119

Query: 117 NDDLAPLAVRYAATLQAASILVDTS 141
           ND  A +     A +Q A    D +
Sbjct: 120 NDAFADMLNLRLARVQLALDKTDAA 144


>gi|294789789|ref|ZP_06755019.1| putative tetratricopeptide repeat protein [Simonsiella muelleri
           ATCC 29453]
 gi|294482295|gb|EFG29992.1| putative tetratricopeptide repeat protein [Simonsiella muelleri
           ATCC 29453]
          Length = 474

 Score = 41.9 bits (97), Expect = 0.069,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 31/82 (37%), Gaps = 2/82 (2%)

Query: 41  LFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILV 100
           L+D   E +++     +A A+      +   A      +L Q+ +       + +A +L 
Sbjct: 94  LYDRLPENQRDKTLGEYAHAIVASADGQYAQAEQQLRALLVQNPEYAPV--RLQLARVLA 151

Query: 101 AKGDTKNAAEIFLKVANDDLAP 122
             G  ++AA+    +      P
Sbjct: 152 KDGQLRDAAKEIDTLKQTPDMP 173


>gi|261820575|ref|YP_003258681.1| hypothetical protein Pecwa_1260 [Pectobacterium wasabiae WPP163]
 gi|261604588|gb|ACX87074.1| Protein of unknown function DUF2133 [Pectobacterium wasabiae
           WPP163]
          Length = 206

 Score = 41.5 bits (96), Expect = 0.072,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 55/149 (36%), Gaps = 4/149 (2%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +             ++ Q  E   + K  +A +S EK  +++   Y  L+++ +A  
Sbjct: 39  WRFWQSHQNDSVQAASASYQQVTEQLAAGK-AEAIASTEKFTAENKNTYGALASLELARH 97

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V + D   AA+    +A        +     L+ A + +  +  ++  K L  +     
Sbjct: 98  YVDQKDFAKAAQQL-VLAQSQTKDADLLAVVNLRLARVQLQENKADDALKTLDAIKPEG- 155

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEE 187
                A E+ G   +  G  Q A+  + +
Sbjct: 156 -WASQAAEVRGDILVSKGDNQAARDAYNK 183


>gi|169634403|ref|YP_001708139.1| hypothetical protein ABSDF2999 [Acinetobacter baumannii SDF]
 gi|169797241|ref|YP_001715034.1| hypothetical protein ABAYE3261 [Acinetobacter baumannii AYE]
 gi|260556123|ref|ZP_05828342.1| UPF0070 protein [Acinetobacter baumannii ATCC 19606]
 gi|332851254|ref|ZP_08433327.1| hypothetical protein HMPREF0021_00898 [Acinetobacter baumannii
           6013150]
 gi|332866123|ref|ZP_08436838.1| hypothetical protein HMPREF0020_00444 [Acinetobacter baumannii
           6013113]
 gi|332873248|ref|ZP_08441205.1| hypothetical protein HMPREF0022_00810 [Acinetobacter baumannii
           6014059]
 gi|169150168|emb|CAM88062.1| conserved hypothetical protein [Acinetobacter baumannii AYE]
 gi|169153195|emb|CAP02285.1| conserved hypothetical protein [Acinetobacter baumannii]
 gi|260410178|gb|EEX03477.1| UPF0070 protein [Acinetobacter baumannii ATCC 19606]
 gi|332730134|gb|EGJ61461.1| hypothetical protein HMPREF0021_00898 [Acinetobacter baumannii
           6013150]
 gi|332734764|gb|EGJ65858.1| hypothetical protein HMPREF0020_00444 [Acinetobacter baumannii
           6013113]
 gi|332738760|gb|EGJ69630.1| hypothetical protein HMPREF0022_00810 [Acinetobacter baumannii
           6014059]
          Length = 248

 Score = 41.5 bits (96), Expect = 0.072,   Method: Composition-based stats.
 Identities = 35/192 (18%), Positives = 69/192 (35%), Gaps = 8/192 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFD---GSHEKKKNIVGENF 57
           M  +++      K    K     I+ +LI +I +   W Y       + + +   V +  
Sbjct: 17  MSLSDEEQFDSLKSFAKKYGSAMISGILIALI-AFFGWEYWQKRNLATSQTETAKVQQLM 75

Query: 58  AQALELFNS-NKLDDARSSFEKILSQDNKLYNPL-SNMYIASILVAKGDTKNAAEIFLKV 115
            +A    ++ N L    +S +KI+  D      + +   +A +   K D   A +   KV
Sbjct: 76  DEANATADNPNALASITASADKIVKDDIDSVQAIQTQFVLAKLAYEKQDYAAAEKALKKV 135

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
            N  +    +     L+ A   +  + Y+E  K L    +P         E+ G   +  
Sbjct: 136 ENSKVKDEGLIQVVKLRLADAQLAQNKYDEALKTLSGDVDP--AFKATVEELRGDIFVAK 193

Query: 176 GKVQKAKTIFEE 187
             +  AK  ++ 
Sbjct: 194 KDIDSAKKAYQA 205


>gi|149176866|ref|ZP_01855476.1| BatB [Planctomyces maris DSM 8797]
 gi|148844303|gb|EDL58656.1| BatB [Planctomyces maris DSM 8797]
          Length = 798

 Score = 41.5 bits (96), Expect = 0.072,   Method: Composition-based stats.
 Identities = 25/112 (22%), Positives = 44/112 (39%), Gaps = 2/112 (1%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           +        +A LLIL+ LS++        +    K +  E    A +     K  +A  
Sbjct: 354 EKASVPRSAVAALLILVTLSMSTKSLSAAETDAPAKQVSAEQINLANQFVREGKYAEALE 413

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
            ++++    +       N   A  +  +GD + AAE+F  VA D    +A R
Sbjct: 414 RYQQVKPTPDDQAEL--NYNEAVTMYRQGDKQQAAEMFTSVAGDGETSIAAR 463


>gi|254506813|ref|ZP_05118953.1| Tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           16]
 gi|219550394|gb|EED27379.1| Tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           16]
          Length = 204

 Score = 41.5 bits (96), Expect = 0.074,   Method: Composition-based stats.
 Identities = 31/196 (15%), Positives = 67/196 (34%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           +++    +      K   K +    +L +  L  W Y  D S    +    E++ QA++ 
Sbjct: 5   DSEEQQVEAIKDWWKENGKAVIFGAVLGLGGLFGWRYYQD-SVTAAQEAASESYTQAVQE 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             +N      +    I +     Y  L+ + +A + V   +   A     + A       
Sbjct: 64  LAANGAAGEAAVQSFIDANKETQYAVLAALQLAKVQVEANNLDEALAQL-EWAKTATKDE 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           AV      + A +  +  +++     L  +++ S        E  G   L+ G  Q A  
Sbjct: 123 AVLSVINYRLARLKAEQGNFDAALSELAAITDESWAGRVA--EQKGDILLRKGDEQAAYA 180

Query: 184 IFEELAKDNNSPFGIS 199
            + E  +  ++   + 
Sbjct: 181 AYTEAQQSGDASQTLQ 196


>gi|238027073|ref|YP_002911304.1| hypothetical protein bglu_1g14520 [Burkholderia glumae BGR1]
 gi|237876267|gb|ACR28600.1| Hypothetical protein bglu_1g14520 [Burkholderia glumae BGR1]
          Length = 209

 Score = 41.5 bits (96), Expect = 0.076,   Method: Composition-based stats.
 Identities = 35/188 (18%), Positives = 65/188 (34%), Gaps = 12/188 (6%)

Query: 4   NNDANSYKGKCKMGKC--CYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG--ENFAQ 59
           +   +    K    +      WI   ++++  +   W Y       +     G  E   Q
Sbjct: 5   DEQESIESVKAWWARWGDLTTWILTAVLVVAAAWNGWNYW---QRHQAAQASGLYEAVQQ 61

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           A+   +  K+  A S  E         Y  ++ +  A  L   GDT  A +  L+   D 
Sbjct: 62  AVSSGDKAKIARAASDMED--KYGRTAYAQMTALAAAKALYMAGDTAGA-KAQLQWTIDH 118

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
               A +  A L+ AS+L++  +Y+    +L     P +       +  G      GK  
Sbjct: 119 AQDDAYKQIAKLRLASLLLEEKAYDAGLALLSG--TPDDGFKGLVADRRGDLLAAQGKRG 176

Query: 180 KAKTIFEE 187
            A+  ++ 
Sbjct: 177 DARAAYQL 184


>gi|297569750|ref|YP_003691094.1| TPR repeat-containing protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296925665|gb|ADH86475.1| TPR repeat-containing protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 787

 Score = 41.5 bits (96), Expect = 0.077,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 59/163 (36%), Gaps = 9/163 (5%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV- 115
              A  +  + + D+A + +  +L++  +L    + M +A +L  KGD   A   + ++ 
Sbjct: 602 LLIARLMTETGRTDEAIAEYRALLAKRPELTP--ARMNLAVLLQQKGDDAGAMAAYREIL 659

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
           A       A    A L A     D  +    +  L  L++   P   +  + LG+     
Sbjct: 660 ARAPNFAPAANNLAWLLAHEPKPDLGA----ALRLAMLAKEQAPTDPYVADTLGLIHYLR 715

Query: 176 GKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           G    A     + A     P   +    +  A   A +++  +
Sbjct: 716 GSHDLAIRQLSQAA--AALPDNPTIGYHLARALRAAGNKKEAE 756


>gi|260549071|ref|ZP_05823292.1| UPF0070 protein [Acinetobacter sp. RUH2624]
 gi|260407799|gb|EEX01271.1| UPF0070 protein [Acinetobacter sp. RUH2624]
          Length = 248

 Score = 41.5 bits (96), Expect = 0.079,   Method: Composition-based stats.
 Identities = 34/192 (17%), Positives = 69/192 (35%), Gaps = 8/192 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFD---GSHEKKKNIVGENF 57
           M  +++      K    K     I+ +LI +I +   W Y       + + +   V +  
Sbjct: 17  MSLSDEEQFDSLKSFAKKYGSAMISGILIALI-AFFGWEYWQKRNLATSQTETAKVQQLM 75

Query: 58  AQALELFNS-NKLDDARSSFEKILSQDNKLYNPL-SNMYIASILVAKGDTKNAAEIFLKV 115
            +A    ++ N L    +S +K++  D      + +   +A +   K D   A +   KV
Sbjct: 76  DEANATADNPNALASITASADKLVKDDIDSVQAIQTQFVLAKLAYEKQDYAAAEKALKKV 135

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
            N  +    +     L+ A   +  + Y+E  K L    +P         E+ G   +  
Sbjct: 136 ENSKVKDEGLIQVVKLRLADAQLAQNKYDEALKTLSGNVDP--AFKATVEELRGDIFVAK 193

Query: 176 GKVQKAKTIFEE 187
             +  AK  ++ 
Sbjct: 194 KDIDSAKKAYQA 205


>gi|120610113|ref|YP_969791.1| hypothetical protein Aave_1426 [Acidovorax citrulli AAC00-1]
 gi|120588577|gb|ABM32017.1| conserved hypothetical protein [Acidovorax citrulli AAC00-1]
          Length = 221

 Score = 41.5 bits (96), Expect = 0.079,   Method: Composition-based stats.
 Identities = 16/133 (12%), Positives = 46/133 (34%)

Query: 20  CYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKI 79
            +  +   ++++I      +  +     ++                      A  +F+ +
Sbjct: 22  AWGTLISGVLVVIFGGVAAWNGYHYWQNQQAGQAAALSDAVQVAVQGGDAARATQAFDDL 81

Query: 80  LSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
            S+            +A+  +      + A+  L+   D+ +    +  A+L+ +S+L+D
Sbjct: 82  KSRYGGTVQAAQAGLLAAKAMVDSGNPDGAKPILQWLADNASDDGYKAIASLRLSSLLID 141

Query: 140 TSSYEEISKILQK 152
             +Y+E    L  
Sbjct: 142 QKAYDEALSRLSG 154


>gi|91788727|ref|YP_549679.1| hypothetical protein Bpro_2866 [Polaromonas sp. JS666]
 gi|91697952|gb|ABE44781.1| Tetratricopeptide TPR_2 [Polaromonas sp. JS666]
          Length = 215

 Score = 41.5 bits (96), Expect = 0.079,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 51/138 (36%), Gaps = 11/138 (7%)

Query: 50  KNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAA 109
                +++A    L  + +  +A +  ++ ++   +  +P    +   I    G T +A 
Sbjct: 35  SAAHADDYADVSRLMRAGQYPEALAKADQYIASKPR--DPQMRFFKGVIQTETGKTSDAI 92

Query: 110 EIFLKVAND-DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL 168
             F K+  +    P      A + A     D +        L+ ++  +NP +  A+E L
Sbjct: 93  ATFTKITEEYPELPEPYNNLAVIYAGQNQFDKA-----RAALE-MAIRTNPSYATAHENL 146

Query: 169 G--ISALKFGKVQKAKTI 184
           G   + L      KA  +
Sbjct: 147 GDVYAKLASQAYDKALQL 164


>gi|150398038|ref|YP_001328505.1| tetratricopeptide TPR_4 [Sinorhizobium medicae WSM419]
 gi|150029553|gb|ABR61670.1| Tetratricopeptide TPR_4 [Sinorhizobium medicae WSM419]
          Length = 420

 Score = 41.5 bits (96), Expect = 0.081,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 49/145 (33%), Gaps = 13/145 (8%)

Query: 54  GENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL 113
           G    +A+ L      D A + + +++       +  +   +A +L   G+   A   + 
Sbjct: 190 GLVLERAVALHAFGDFDGAEAGYRQLIRTVPG--HVEARFRLAHLLNDVGEYDEAEHFYR 247

Query: 114 KVANDDLAPLAVRYAATLQAAS-ILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA 172
            +      P  V     L       +    Y + SK  Q+L    +P        L ++ 
Sbjct: 248 TLLPTVPNPDDV-----LHWIGDTQMAQGFYRKASKTFQELLV-RHPQRGAVRYKLAVAH 301

Query: 173 LKFGKVQKAKTIF----EELAKDNN 193
           L  G+   A   F    + L+ D N
Sbjct: 302 LASGRRDAAVAAFESFDDVLSDDTN 326


>gi|315224829|ref|ZP_07866650.1| TPR-domain containing protein [Capnocytophaga ochracea F0287]
 gi|314945232|gb|EFS97260.1| TPR-domain containing protein [Capnocytophaga ochracea F0287]
          Length = 1001

 Score = 41.5 bits (96), Expect = 0.083,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 53/175 (30%), Gaps = 5/175 (2%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLY-NPLSNMY 94
           A W             + G  +  A   +  N   +A S FEK L +         +  Y
Sbjct: 703 ASWAKGLGYVEVTDLELEGATYEAAERQYMQNNTKEAISGFEKYLKEFPNGMRRTNAEFY 762

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL- 153
           +  +    G    A   +  V          +    +    IL++  SY +    L+ L 
Sbjct: 763 LGQMYFNSGQKSKALTHYENVTKSGSNEYGEQSLTRV--CQILLEAGSYLKAKPYLEDLE 820

Query: 154 -SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
            +        +A   L           KA     ++ ++ +    I   + ++LA
Sbjct: 821 RTATIAQNKTYAQSNLMRVCYNEKLYDKAIEYANKVLEEKSIDTRIKNDAYIVLA 875


>gi|330895890|gb|EGH28175.1| hypothetical protein PSYJA_03859 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 213

 Score = 41.5 bits (96), Expect = 0.083,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 57/164 (34%), Gaps = 4/164 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ-D 83
             L ++++L    W        +    +  +    AL                K+ S+  
Sbjct: 27  GLLALVVVLGWQFWHRYQASQSQGASMLYQQLLETALTPSGQADTARVAEISGKLKSEFG 86

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y    ++++A + V  G   +AA     VA D  A   +   A  + A +L   +  
Sbjct: 87  GTTYAQFGSLFVAKVAVDAGKLDDAAAELKPVA-DKPANDTLGEIARQRLARVLAAQNKT 145

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           ++  K+L   +           E+ G   ++ G+  +A   +++
Sbjct: 146 DDALKLLDGDA--DKAFLASREELKGDLLVQLGRTDEAYAAYQK 187


>gi|303236371|ref|ZP_07322961.1| tetratricopeptide repeat protein [Prevotella disiens FB035-09AN]
 gi|302483429|gb|EFL46434.1| tetratricopeptide repeat protein [Prevotella disiens FB035-09AN]
          Length = 224

 Score = 41.5 bits (96), Expect = 0.083,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 44/106 (41%), Gaps = 2/106 (1%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E   + +  K +    K     +  ++ ++I+   I+ Y  +   E ++       A+A 
Sbjct: 7   EGTYEESLNKSEAFFAKYGKTALIAIVAILIVVAGIFLY-KNYVSEPREAEASTELAKAQ 65

Query: 62  ELFNSNKLDDARSSFEKILSQ-DNKLYNPLSNMYIASILVAKGDTK 106
           +LF + + D A   F+K+ S   +     L+N+Y+A     +    
Sbjct: 66  QLFQTQQFDQALKGFQKVQSDYSSTDAGNLANLYVALCYAHQQKPD 111


>gi|269962409|ref|ZP_06176759.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269832905|gb|EEZ87014.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 204

 Score = 41.5 bits (96), Expect = 0.084,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 73/197 (37%), Gaps = 6/197 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + +    +      K   K +    ++ +  L  W Y  D S  +      +++   +  
Sbjct: 5   DTEEQQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQD-SVIQASEAASQSYTTVMNA 63

Query: 64  FNSNKLDDARSSFEKILSQDN-KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             + K  DA++  +  +  +  K Y+ L+ + +A + V   D   A E   K A  +   
Sbjct: 64  LQT-KGADAQADIQAFIDSNEVKEYSVLAALQLAKVQVDAKDLSAALEQL-KWAQSNTKD 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
            A+    + + A I  +  +++  +  L K++           E  G  AL+ G  + A 
Sbjct: 122 AALSPLISYRIARIEAEMGNFDAANAELDKVT--DAAWTGRIAEQRGDIALRQGDKEAAY 179

Query: 183 TIFEELAKDNNSPFGIS 199
             + E  +  ++   + 
Sbjct: 180 AAYTEAQQAADASPTLQ 196


>gi|22001550|sp|Q9WX71|BCSC4_ACEXY RecName: Full=Cellulose synthase 2 operon protein C; Flags:
           Precursor
 gi|4827170|dbj|BAA77596.1| bcsCII [Gluconacetobacter xylinus]
          Length = 1307

 Score = 41.5 bits (96), Expect = 0.085,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 49/121 (40%), Gaps = 7/121 (5%)

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++  N+ + D AR+    +  +    Y        A++   +GDT +A  ++ +V     
Sbjct: 432 VQAINAGRYDAARADLATLGRR--PGYGLTVLSLQAALARRQGDTADAVRLYREVV--RR 487

Query: 121 APLAVRYAATLQAASILV-DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
           AP       +L A  + V D +   +I   LQ+L+ P+      A  +L   A + G   
Sbjct: 488 APRDAGALFSLGALDVQVGDATEAADILTRLQRLA-PAMARRLEAM-MLSAQADRAGDDD 545

Query: 180 K 180
            
Sbjct: 546 G 546



 Score = 37.7 bits (86), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/146 (15%), Positives = 42/146 (28%), Gaps = 9/146 (6%)

Query: 53  VGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
            G  F+            +A     ++      +   L  M +++     GD      + 
Sbjct: 492 AGALFSLGALDVQVGDATEAADILTRLQRLAPAMARRLEAMMLSAQADRAGDDDGRIALL 551

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA 172
            +    D     VR    L+ A  L D   +     ++  L+ P N     A  +     
Sbjct: 552 RRAQALDPDDPWVR----LKLAHALDDAGDHAAAQAMMDALTAPRNA---SAQALQAGII 604

Query: 173 LKFG--KVQKAKTIFEELAKDNNSPF 196
              G      A  + E + +   +P 
Sbjct: 605 YAMGRHDTATAGALLERMPRTGRTPD 630


>gi|46136823|ref|XP_390103.1| hypothetical protein FG09927.1 [Gibberella zeae PH-1]
          Length = 613

 Score = 41.5 bits (96), Expect = 0.085,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 53/136 (38%), Gaps = 16/136 (11%)

Query: 58  AQALELFNSNKLDDARSSFEK-ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK-V 115
            QALE    +  ++AR +FEK +   D   Y  L+     +     G+   A + F K +
Sbjct: 293 LQALEKKTGDGYEEARQAFEKALELGDLGEYEALAYNMRGTFRTLLGNHAEATQDFDKSI 352

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYE----EISKILQKLSEPSNPMHQFANEILGIS 171
             D     +      ++ ASI ++    E    E +K L++     +  +  A      +
Sbjct: 353 ELDPSMTQSY-----IKRASISLELGEPEKAEAEFAKALEQDKNDPDVYYHRAQ-----A 402

Query: 172 ALKFGKVQKAKTIFEE 187
               G +  A+  +++
Sbjct: 403 HFIKGDLADAQKDYQK 418


>gi|323491633|ref|ZP_08096812.1| hypothetical protein VIBR0546_18526 [Vibrio brasiliensis LMG 20546]
 gi|323314209|gb|EGA67294.1| hypothetical protein VIBR0546_18526 [Vibrio brasiliensis LMG 20546]
          Length = 204

 Score = 41.5 bits (96), Expect = 0.086,   Method: Composition-based stats.
 Identities = 27/196 (13%), Positives = 62/196 (31%), Gaps = 4/196 (2%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + +    +      K   K +    ++ +  L  W Y  D S    +    E++ +A++ 
Sbjct: 5   DTEEQQVEAIKDWWKENGKAVILGAVVGLGGLFGWRYYQD-SVTAAQEAASESYTKAVQT 63

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
                          I +     Y  L+ + +A + V  G+   A     + A       
Sbjct: 64  LAEKGASAEGDIQAFIDANKETEYAVLAALQLAKVQVEAGNLDEALAQL-EWAKSTTKDA 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           AV      + A +  +   ++     L  ++           E+ G   L+ G  Q A  
Sbjct: 123 AVSAVLNYRLARVKAEQGEFDAAVSELANIT--DQSWAGRVAELKGDILLRKGDAQGAYA 180

Query: 184 IFEELAKDNNSPFGIS 199
            + +  +  ++   + 
Sbjct: 181 AYTQAQQSGDASQTLQ 196


>gi|158522421|ref|YP_001530291.1| TPR repeat-containing protein [Desulfococcus oleovorans Hxd3]
 gi|158511247|gb|ABW68214.1| Tetratricopeptide TPR_2 repeat protein [Desulfococcus oleovorans
           Hxd3]
          Length = 648

 Score = 41.5 bits (96), Expect = 0.086,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 39/110 (35%), Gaps = 7/110 (6%)

Query: 76  FEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAAS 135
           ++K+++ D +     ++     +L  +G    A   +    +              +   
Sbjct: 512 YQKVMAVDPRNAE--AHYGTGQLLERQGKIDAAITAYETTLD---IDPLYTDVYQ-RLGK 565

Query: 136 ILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           I +  + YE+       L +  +P    A E LG+S    G ++ A   +
Sbjct: 566 IHLTRNEYEKAIDRFFMLLK-IDPFRAEAFEQLGLSYYHTGDLENAIRAY 614


>gi|296387684|ref|ZP_06877159.1| hypothetical protein PaerPAb_05997 [Pseudomonas aeruginosa PAb1]
          Length = 214

 Score = 41.5 bits (96), Expect = 0.088,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 53/164 (32%), Gaps = 4/164 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ-D 83
             L + ++     W        +    +  +    AL                K+ S+  
Sbjct: 28  GILALAVVFGWQAWQKYQTNQAQGASIVYQQLIETALNPAGQPDPAKVAELAGKLKSEFG 87

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y    ++++A + V  G   +A      V  D  A   +   A  + A +L      
Sbjct: 88  GTHYAQYGSLFVAKVAVDSGKLDDAVAELKAVM-DKPADATLGELARQRLARVLAAQGKV 146

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           EE  K+L+  +           E+ G   ++  +  +A+  +E+
Sbjct: 147 EEGLKLLEGDA--DKAYVSTREELKGDLLVQLKRTDEARAAYEK 188


>gi|85059736|ref|YP_455438.1| hypothetical protein SG1758 [Sodalis glossinidius str. 'morsitans']
 gi|84780256|dbj|BAE75033.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 204

 Score = 41.5 bits (96), Expect = 0.088,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 65/181 (35%), Gaps = 9/181 (4%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEK--KKNIVGENFAQALELFNSNKLDDARSSFEKI 79
           K +A  ++L + +L  W Y  +  ++     +   +     L    +    DA   F   
Sbjct: 23  KALAIGVVLGVGALVGWRYWHNHHNDAMMAASSAWQPVNAGLSGQAAQPQLDAAQHF--- 79

Query: 80  LSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
              ++  Y  L++M +A     +GD   A +   K          ++    L+ A + + 
Sbjct: 80  ADANDNNYGALTSMGLARQFAERGDFPAAEKQLQKALGQTRE-ANLQSLINLRLARVQLQ 138

Query: 140 TSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
             + +   K L             A +  G + +  G  Q A+T +E+ A  + +P  + 
Sbjct: 139 QKNVDGALKTLDG--VKDQGWTALAEDTRGDAQVIKGDQQAARTAYEK-ALQSGAPQALV 195

Query: 200 T 200
            
Sbjct: 196 R 196


>gi|289677944|ref|ZP_06498834.1| hypothetical protein PsyrpsF_31953 [Pseudomonas syringae pv.
           syringae FF5]
 gi|330975907|gb|EGH75973.1| hypothetical protein PSYAP_04524 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 213

 Score = 41.5 bits (96), Expect = 0.091,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 57/164 (34%), Gaps = 4/164 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ-D 83
             L ++++L    W        +    +  +    AL                K+ S+  
Sbjct: 27  GLLALVVVLGWQFWHRYQASQSQGASMLYQQLLETALTPSGQADTARVAEISGKLKSEFG 86

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y    ++++A + V  G   +AA     VA D  A   +   A  + A +L   +  
Sbjct: 87  GTTYAQFGSLFVAKVAVDAGKLDDAAAELKPVA-DKPANDTLGEIARQRLARVLAAQNKT 145

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           ++  K+L   +           E+ G   ++ G+  +A   +++
Sbjct: 146 DDALKLLDGDA--DKAFLASREELKGDLLVQLGRTDEAYAAYQK 187


>gi|229496266|ref|ZP_04389986.1| putative TPR domain protein [Porphyromonas endodontalis ATCC 35406]
 gi|229316844|gb|EEN82757.1| putative TPR domain protein [Porphyromonas endodontalis ATCC 35406]
          Length = 1009

 Score = 41.5 bits (96), Expect = 0.091,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 57/152 (37%), Gaps = 6/152 (3%)

Query: 43  DGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAK 102
           D S   +          A  L  +N+  +         +Q N  +  ++ +Y+AS  +AK
Sbjct: 130 DESALSRAERTEWQVRTAYALLRTNRGGEQLGPLFAEAAQANNRWGRIAKLYVASSKMAK 189

Query: 103 GDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL--SEPSNPM 160
           GD + A  I+  ++ D       R    +  A++   +  Y +    + ++   EP    
Sbjct: 190 GDLQAAEAIYRSLSGDRELAPETR----IGMAALSYYSGDYAKAVAEVGEIERVEPRLAS 245

Query: 161 HQFANEILGISALKFGKVQKAKTIFEELAKDN 192
           +    ++ G +  + G    A    E   +D+
Sbjct: 246 NPSLLQVAGNAYYRLGDAPNASKYLERFIEDS 277


>gi|156086610|ref|XP_001610714.1| variant erythrocyte surface antigen-1, alpha subunit [Babesia bovis
           T2Bo]
 gi|154797967|gb|EDO07146.1| variant erythrocyte surface antigen-1, alpha subunit [Babesia
           bovis]
          Length = 1231

 Score = 41.1 bits (95), Expect = 0.093,   Method: Composition-based stats.
 Identities = 21/164 (12%), Positives = 49/164 (29%), Gaps = 16/164 (9%)

Query: 31  MILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNS--NKLDDARSSFEKILSQDNKLYN 88
           +++ L       +G  +K    V     +A    ++   KL+ A+ + EK+ +       
Sbjct: 610 VVVQLGNAQEALEGKEKKAIQGVKRELEKAKGALDTAKGKLEKAKKALEKLTTNGGGG-- 667

Query: 89  PLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISK 148
                    IL    D    A+       D            ++    ++     E I K
Sbjct: 668 --------GILKNVVDAIGKAQS-DVTNVDPGKNAISEGVHKIREVLKILKEEVPEAIDK 718

Query: 149 ILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
            + ++ +     +    E+L        +   A    +++    
Sbjct: 719 AIDEMKQKGKDAYGTTRELL---DWASKQFIHAIEQIKDICNSA 759


>gi|110637942|ref|YP_678149.1| TPR repeat-containing protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110280623|gb|ABG58809.1| conserved hypothetical protein, with TPR repeat [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 1012

 Score = 41.1 bits (95), Expect = 0.093,   Method: Composition-based stats.
 Identities = 25/135 (18%), Positives = 46/135 (34%), Gaps = 13/135 (9%)

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + + D A +  +K      K Y PL  + IA+I   +           KV  D  A    
Sbjct: 187 NGEYDTAIADLQKAAES--KEYKPLVAVLIANIYYRQAKYDELIPYAEKVIADKSAGPNT 244

Query: 126 RYAATLQAASILVDTSSYEEISKILQKL------SEPSNPMHQFANEILGISALKFGKVQ 179
                     IL D   +++       L      +  +  +       +G S+ K    +
Sbjct: 245 NDVK-----LILADAYFFKQEYAKATPLFKDYLTATGTKSLTPDMKYRIGFSSYKAADYK 299

Query: 180 KAKTIFEELAKDNNS 194
           +A  + + +A D +S
Sbjct: 300 QAVDMLQAIATDKDS 314


>gi|326563521|gb|EGE13780.1| hypothetical protein E9O_08152 [Moraxella catarrhalis 12P80B1]
          Length = 277

 Score = 41.1 bits (95), Expect = 0.094,   Method: Composition-based stats.
 Identities = 23/194 (11%), Positives = 57/194 (29%), Gaps = 28/194 (14%)

Query: 28  LILMILSLAIWFYLFDGSHEKKKNIVGENFAQA---------------LELFNSNKLDDA 72
            +L++L++   +  +  ++ K   +  + +                  L+      L + 
Sbjct: 30  AVLLVLAVFFGWQYYQKNYAKIDTVAADAYTSISVRDERLAQAYLNPQLDEVAKQALAEE 89

Query: 73  RSSF-----EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRY 127
                      + + DN +Y   + M  A       D   A     +  + +L    +  
Sbjct: 90  EKQLFGDIDALVAANDNTVYAWQALMIKARHQTNNNDLDGAVATLSQATSINLDDDGLTA 149

Query: 128 AATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
            A ++ A  ++          I  +             E+LG       ++  AK+ +  
Sbjct: 150 IAKIRHARAMLANGDTNGALSIANEAMP--TAFEASRQELLGDIYHAKNEIDNAKSAY-- 205

Query: 188 LAKDNNSPFGISTR 201
                N+   +  R
Sbjct: 206 ----TNAWEALRER 215


>gi|187734973|ref|YP_001877085.1| TPR repeat-containing protein [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187425025|gb|ACD04304.1| TPR repeat-containing protein [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 884

 Score = 41.1 bits (95), Expect = 0.095,   Method: Composition-based stats.
 Identities = 27/144 (18%), Positives = 51/144 (35%), Gaps = 6/144 (4%)

Query: 44  GSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD----NKLYNPLSNMYIASIL 99
           G  E            A  L N     +A +  E++ ++D    N+L    + +    + 
Sbjct: 179 GQAESPAVSRPARLLLADVLVNQECYQNAAAILEQLKTEDGTDSNRLIRSYAELIEGKLA 238

Query: 100 VAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD--TSSYEEISKILQKLSEPS 157
             +G+   A + F  V ++   P  +R    L  A   +D   S+ E+  +  + L +  
Sbjct: 239 GKQGNLDQAIKTFSAVMDNKSYPEKIRDLGRLALAKAEIDREKSNPEQAEEETRSLPQEE 298

Query: 158 NPMHQFANEILGISALKFGKVQKA 181
              H        + A   GK + A
Sbjct: 299 EAPHTAGTAEERLLAFIGGKAESA 322



 Score = 40.4 bits (93), Expect = 0.19,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 59/157 (37%), Gaps = 11/157 (7%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAK-GDTKNAAEIFLKV 115
           +  A+ LFN      A      I   D      L  + + + L  +  D +   E   ++
Sbjct: 122 YWTAVGLFNKGSFTKALEKLTAIPETDPL---SLYGLQLKAQLARQLQDRQLLLETLSRL 178

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNP-----MHQFANEILGI 170
              +  P   R  A L  A +LV+   Y+  + IL++L           +  +A  I G 
Sbjct: 179 GQAES-PAVSR-PARLLLADVLVNQECYQNAAAILEQLKTEDGTDSNRLIRSYAELIEGK 236

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
            A K G + +A   F  +  + + P  I    ++ LA
Sbjct: 237 LAGKQGNLDQAIKTFSAVMDNKSYPEKIRDLGRLALA 273


>gi|148264128|ref|YP_001230834.1| TPR repeat-containing protein [Geobacter uraniireducens Rf4]
 gi|146397628|gb|ABQ26261.1| TPR repeat-containing protein [Geobacter uraniireducens Rf4]
          Length = 757

 Score = 41.1 bits (95), Expect = 0.095,   Method: Composition-based stats.
 Identities = 29/157 (18%), Positives = 54/157 (34%), Gaps = 16/157 (10%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
              A       ++D A   +E+I++ D K         +A +LV  G  + A   +  + 
Sbjct: 9   LESAQRFILKGQIDRAIKDYEQIVALDPKEIRH--RQRLAELLVRAGRKEEAIGEYDAIG 66

Query: 117 ---NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLS-EPSNPMHQFANEILGIS- 171
               D+       Y     A    +       I   L   S      +   A    G+S 
Sbjct: 67  KYYADNG------YFLKAIAVYKQIQKLDSGNIKVTLTLASLNEKQGLIGNALAEYGLSV 120

Query: 172 --ALKFGKVQKAKTIF-EELAKDNNSPFGISTRSQMI 205
               K G++ +A  +  + LA D ++P      ++M+
Sbjct: 121 DYYEKNGQLSEALKVIEQMLAIDADNPATCQKYAEML 157


>gi|238896989|ref|YP_002921734.1| putative cellulose synthase [Klebsiella pneumoniae NTUH-K2044]
 gi|238549316|dbj|BAH65667.1| putative cellulose synthase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 975

 Score = 41.1 bits (95), Expect = 0.098,   Method: Composition-based stats.
 Identities = 24/162 (14%), Positives = 51/162 (31%), Gaps = 18/162 (11%)

Query: 63  LFNSNKLDDARSSFE--------KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           L   NK  +A++  +        K+  +        +    A   V+ G+   A     +
Sbjct: 54  LREQNKSAEAQAMLQTLPQSLRQKLQPRVVAGMPGDALRRQAQAQVSGGNPAGAIATLRE 113

Query: 115 VANDDLAPLAVR-YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
                     +R   A      +L  + +  E S ++     P       A     + A 
Sbjct: 114 GVARYPDDPWLRLDLAR-----LLQKSGNGSEASSLMSAAYRPGAS--NSALYAAALFAS 166

Query: 174 KFGKVQKAKTIFEELAKDNNSP--FGISTRSQMILANIIASD 213
           + G  Q+A+T+   +   + +     +  R    L  + A +
Sbjct: 167 ENGAWQQAQTLLARIPGGSQTSDMRDLRQRVNYNLQLVTAEN 208


>gi|224025913|ref|ZP_03644279.1| hypothetical protein BACCOPRO_02659 [Bacteroides coprophilus DSM
           18228]
 gi|224019149|gb|EEF77147.1| hypothetical protein BACCOPRO_02659 [Bacteroides coprophilus DSM
           18228]
          Length = 487

 Score = 41.1 bits (95), Expect = 0.098,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 34/84 (40%), Gaps = 5/84 (5%)

Query: 104 DTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF 163
           D K   + + +V             A + AAS  + +  ++   K+L+K+ + +   +  
Sbjct: 385 DLKPGTKEYKEVYEIAARTYPEDAVACINAASANIVSGDFQNAEKLLEKVKDDNRAWNN- 443

Query: 164 ANEILGISALKFGKVQKAKTIFEE 187
               LG+ A   G  Q A+  F +
Sbjct: 444 ----LGVLAWLRGDFQAARDWFNK 463


>gi|310658458|ref|YP_003936179.1| hypothetical protein CLOST_1154 [Clostridium sticklandii DSM 519]
 gi|308825236|emb|CBH21274.1| protein of unknown function [Clostridium sticklandii]
          Length = 371

 Score = 41.1 bits (95), Expect = 0.10,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 3/76 (3%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           E  + + EL  S K D+A +  E+I+ +D   Y   +  Y+  I   KG+ ++A + F  
Sbjct: 225 EKISLSSELIESEKYDEALAILEEIVDEDTSSYE--AYFYLGYINRLKGEYESAIDYFEF 282

Query: 115 VAN-DDLAPLAVRYAA 129
               D   P  +   A
Sbjct: 283 AYKLDTSQPQLINEMA 298


>gi|187735095|ref|YP_001877207.1| serine/threonine protein kinase [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187425147|gb|ACD04426.1| serine/threonine protein kinase [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 860

 Score = 41.1 bits (95), Expect = 0.10,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 43/132 (32%), Gaps = 5/132 (3%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           + I    I  I++LA+  + +    E+         +       +     A        S
Sbjct: 336 RIIVASSIAFIVALALGVWGWTKWREEGAPAPATPPSPISPAAEA-----ALEDRGAAES 390

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           +  +          A   + +GD   AA +F  +A     PL+    A L     +    
Sbjct: 391 RLERSIRFGKLFNEAQESLNRGDLVKAAAMFGDLAAQPDCPLSTSLWAGLNQVLCMWVRG 450

Query: 142 SYEEISKILQKL 153
            + E  + L++L
Sbjct: 451 QFPEGVERLEEL 462


>gi|256420544|ref|YP_003121197.1| hypothetical protein Cpin_1499 [Chitinophaga pinensis DSM 2588]
 gi|256035452|gb|ACU58996.1| hypothetical protein Cpin_1499 [Chitinophaga pinensis DSM 2588]
          Length = 324

 Score = 41.1 bits (95), Expect = 0.10,   Method: Composition-based stats.
 Identities = 20/172 (11%), Positives = 48/172 (27%), Gaps = 25/172 (14%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEK-KKNIVGENFAQALELFNSNKLDDARSSFEKILSQ 82
           I  ++  +I +           H+   +   G     A  +                   
Sbjct: 164 IYVIITAIIGAGLAGLLFLSPWHKDIYRQFSGTEMVHANHMSTEQDTA------------ 211

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSS 142
                     M+ A+     G    A  +  +V    +   ++   A       LVD   
Sbjct: 212 --------LLMHQAAAAFNHGHFNKAIGLLNQV----IVRDSLHTTARYYRGVSLVDEGK 259

Query: 143 YEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
             E    L+K+   ++     A   + +S ++    Q+      ++ +++  
Sbjct: 260 LGEARADLKKVYNSNSSYRYDAAFYMALSYIRENDKQQCLEWVLKIPENSTV 311


>gi|152985142|ref|YP_001346697.1| hypothetical protein PSPA7_1313 [Pseudomonas aeruginosa PA7]
 gi|150960300|gb|ABR82325.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 214

 Score = 41.1 bits (95), Expect = 0.10,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 53/164 (32%), Gaps = 4/164 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ-D 83
             L + ++     W        +    +  +    AL                K+ S+  
Sbjct: 28  GILALAVVFGWQAWQKYQTNQAQGASIVYQQLIETALNPAGQPDTAKVAELAGKLKSEFG 87

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y    ++++A + V  G   +A      V  D  A   +   A  + A +L      
Sbjct: 88  GTHYAQYGSLFVAKVAVDSGKLDDAVAELKAVM-DKPADATLGELARQRLARVLAAQGKV 146

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           EE  K+L+  +           E+ G   ++  +  +A+  +E+
Sbjct: 147 EEGLKLLEGDA--DKAYVSTREELKGDLLVQLKRTDEARAAYEK 188


>gi|302038477|ref|YP_003798799.1| hypothetical protein NIDE3180 [Candidatus Nitrospira defluvii]
 gi|300606541|emb|CBK42874.1| protein of unknown function, TPR-like [Candidatus Nitrospira
           defluvii]
          Length = 584

 Score = 41.1 bits (95), Expect = 0.10,   Method: Composition-based stats.
 Identities = 21/131 (16%), Positives = 54/131 (41%), Gaps = 6/131 (4%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L  S ++++A +  ++I + D +   PL ++ +A  L      + + + + +        
Sbjct: 128 LVRSGQVEEAVTELQRIAAIDPQN--PLIHLRLARELRKLDRLEESLKSYQQAVELGPDM 185

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
           L  R  A  +A   ++D    +   + + +   P +P+   A  +L +     G  ++ +
Sbjct: 186 LNWR-LALARARFDILDYEGADREVQSVLQQVSPGSPLELSAKNLLTVFY---GSTERGR 241

Query: 183 TIFEELAKDNN 193
                ++ D N
Sbjct: 242 RFAPMMSPDAN 252


>gi|330936982|gb|EGH41080.1| hypothetical protein PSYPI_01050 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 213

 Score = 41.1 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 57/164 (34%), Gaps = 4/164 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ-D 83
             L ++++L    W        +    +  +    AL                K+ S+  
Sbjct: 27  GLLALVVVLGWQFWHRYQASQSQGASMLYQQLLETALTPSGQADTARVAEISGKLKSEFG 86

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
              Y    ++++A + V  G   +AA     VA D  A   +   A  + A +L   +  
Sbjct: 87  GTTYAQFGSLFVAKVAVDAGKLDDAAAELKPVA-DKPANDTLGEIARQRLARVLAAQNKT 145

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
           ++  K+L   +           E+ G   ++ G+  +A   +++
Sbjct: 146 DDALKLLDGDA--DKAFLASREELKGDLLVQLGRTDEAYVAYQK 187


>gi|77165454|ref|YP_343979.1| TPR repeat-containing protein [Nitrosococcus oceani ATCC 19707]
 gi|76883768|gb|ABA58449.1| TPR repeat protein [Nitrosococcus oceani ATCC 19707]
          Length = 934

 Score = 41.1 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 61/152 (40%), Gaps = 9/152 (5%)

Query: 46  HEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDT 105
            ++ +N  G  +AQ L  F   +  DA +SF+K LS++ +     +  Y       +G  
Sbjct: 265 SKRARNHPGVTYAQGLLHFQQQQYADALTSFQKTLSKNPEYMP--AVFYAGIAYYQQGQL 322

Query: 106 KNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFAN 165
             A ++  +              A    A I +   +Y     IL+ +    NP    A 
Sbjct: 323 TQAGQLLNQFLKR----FPHSDTAAKTLAMIRLREGNYTSAQAILEPIIA-QNPNDTAAL 377

Query: 166 EILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
           ++LG + L  GK +K+   F+++     +P  
Sbjct: 378 DLLGSAILGQGKPEKSAAYFQKVT--AQTPES 407


>gi|83311391|ref|YP_421655.1| Fe-S oxidoreductase [Magnetospirillum magneticum AMB-1]
 gi|82946232|dbj|BAE51096.1| Predicted Fe-S oxidoreductase [Magnetospirillum magneticum AMB-1]
          Length = 442

 Score = 41.1 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 52/128 (40%), Gaps = 15/128 (11%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
             AQAL L +   LD+A ++  K  +  +       +   A +L+ +     A  +F +V
Sbjct: 22  ALAQALRLADGQLLDEAIAALAK--ADGHPE----CDYRRAGLLLMRQRPTEAEALFRRV 75

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQ--KLSEPSNPMHQFANEILGISAL 173
                 P  +     L  A  LV+     E   +L+   L +P +    +   +LGI+  
Sbjct: 76  L--SAVPGHLDTMVGL--AGALVEQGRPAESLPLLEAAALVQPQSGRIHY---LLGIALD 128

Query: 174 KFGKVQKA 181
           + G+  +A
Sbjct: 129 EAGRGAEA 136


>gi|78186368|ref|YP_374411.1| TPR repeat-containing protein [Chlorobium luteolum DSM 273]
 gi|78166270|gb|ABB23368.1| TPR repeat [Chlorobium luteolum DSM 273]
          Length = 230

 Score = 41.1 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 39/204 (19%), Positives = 72/204 (35%), Gaps = 14/204 (6%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFE-----K 78
           IA  LIL+++  A  F+  +     ++N      A A   F+      A    E     K
Sbjct: 32  IAGALILILIGGAAIFFWTE-RQASRENEAAPMMAAAAMAFDRGDFQRAIDGTEKEPGLK 90

Query: 79  ILSQDNKLYNP--LSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
            +++         ++ + +A+   A G  K+A + F            +  AA    AS 
Sbjct: 91  TIAEQYNGTPSGEMAELLLANAYYAIGKPKDALKAFDAA---SPVSPDLAAAAIAGKASC 147

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALK--FGKVQKAKTIFEELAKDNNS 194
             D   Y+  +K     SE +      A  ++  +  +   G  +KA  +F ++      
Sbjct: 148 QSDLQQYDAAAKSFLSASEKAENNALKAQYLMAAADCRLGAGDTEKAGELFGQVVDRYPG 207

Query: 195 PFGISTRSQMILANIIASDQRNKK 218
             G    +Q  L  I    + + K
Sbjct: 208 SSGARA-AQQALWKISGMQEVSNK 230


>gi|255073749|ref|XP_002500549.1| predicted protein [Micromonas sp. RCC299]
 gi|226515812|gb|ACO61807.1| predicted protein [Micromonas sp. RCC299]
          Length = 661

 Score = 41.1 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 23/153 (15%), Positives = 52/153 (33%), Gaps = 8/153 (5%)

Query: 54  GENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL 113
           G        L    K D+     E  L+        LS +      +  G+ + AAE++ 
Sbjct: 11  GRATETIYGLIRDGKHDECAKLLEIQLANAPDSRPALSLLGYCYYYL--GNFERAAEMYG 68

Query: 114 KVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
           ++A              +  A  L   S Y++  +  + +      + Q  +++  + A 
Sbjct: 69  QLAKLFPENEDY----AVHHAQSLYKASMYQDALRASRAIDSKDPAVRQKVSQLQALIAY 124

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTRSQMIL 206
           +   +   +   +E   D+  P  +   +  +L
Sbjct: 125 EEDDLAGCRARLDECPSDD--PDVVVNLACCML 155


>gi|325124480|gb|ADY84003.1| hypothetical protein BDGL_003417 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 232

 Score = 41.1 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 36/192 (18%), Positives = 69/192 (35%), Gaps = 8/192 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFD---GSHEKKKNIVGENF 57
           M  +++      K    K     I+ +LI +I +   W Y       S + +   V +  
Sbjct: 1   MSVSDEEQFDSLKSFAKKYGSAMISGILIALI-AFFGWEYWQKRNLASSQTETAKVQQLM 59

Query: 58  AQALELFNS-NKLDDARSSFEKILSQDNKLYNPL-SNMYIASILVAKGDTKNAAEIFLKV 115
            +A    ++ N L    +S +KI+  D      + +   +A +   K D   A +   KV
Sbjct: 60  DEANASADNPNALTSVTASADKIVKDDINSVQAIQTQFVLAKLAYEKQDYAAAEKALKKV 119

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
            N  +    +     L+ A   +  + Y+E  K L    +P         E+ G   +  
Sbjct: 120 ENSKVKDEGLIQVVKLRLADAQLAQNKYDEALKTLSGNVDP--AFKATVEELRGDIFVAK 177

Query: 176 GKVQKAKTIFEE 187
             +  AK  ++ 
Sbjct: 178 KDIDSAKKAYQA 189


>gi|294669239|ref|ZP_06734319.1| tetratricopeptide repeat protein [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308871|gb|EFE50114.1| tetratricopeptide repeat protein [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 390

 Score = 41.1 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 27/176 (15%), Positives = 57/176 (32%), Gaps = 10/176 (5%)

Query: 23  WIAPLLILMILSLAIWFYLFDGSHE--KKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
           W+   L+  I     W           K+   +   F  +LE         A     ++ 
Sbjct: 9   WVLIALLPFICFALGWVAARIDMKTVLKQAKSIPTGFYASLEALVDRNTGKAAHELAEVA 68

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
               + Y+   N+ +  +  ++G+   A  +   ++     P  V      +A   L  T
Sbjct: 69  DLQPQSYDL--NLTLGKLYRSRGENDKAIRLLKTLSE---LPDTVGD-KKQRALFELGKT 122

Query: 141 SSYEEISKILQK--LSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
                +    ++  L+  +  M + A E L     +    +KA    + L+ D  +
Sbjct: 123 YQSAGLVDRAEQIFLALQNGNMAKGAREHLLHIYQQDRDWEKAVETAQLLSHDEQT 178


>gi|253995883|ref|YP_003047947.1| hypothetical protein Mmol_0510 [Methylotenera mobilis JLW8]
 gi|253982562|gb|ACT47420.1| Tetratricopeptide TPR_2 repeat protein [Methylotenera mobilis JLW8]
          Length = 330

 Score = 41.1 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 41/119 (34%), Gaps = 9/119 (7%)

Query: 52  IVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEI 111
              +      +L +  +   A       ++ + K    L       +L  +G    A + 
Sbjct: 28  ASADELKDISKLADQGQTAVALDRINTFIAANPKNAQAL--FMKGVLLAEQGRRDEAIKS 85

Query: 112 FLKVAND-DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILG 169
           F +V       P      A L A     D   +++  K L+  +  ++P +  A+E LG
Sbjct: 86  FTEVTERFPNLPEPYNNLAVLYA-----DQGQFDKARKALET-AIKTHPSYATAHENLG 138


>gi|83309106|ref|YP_419370.1| thioredoxin domain-containing protein [Magnetospirillum magneticum
           AMB-1]
 gi|82943947|dbj|BAE48811.1| Thioredoxin domain-containing protein [Magnetospirillum magneticum
           AMB-1]
          Length = 310

 Score = 41.1 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 24/130 (18%), Positives = 48/130 (36%), Gaps = 8/130 (6%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           +  A+A  +        A + F +IL +     + ++ +    I V  G T  A  +  +
Sbjct: 140 DYIAEAKRVLEEGDPQTAATIFNQILQEAPDNASAMAGLLRCLIAV--GQTAQAESMLGR 197

Query: 115 VANDDLAPLAVRYAAT-LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
           +A +      +   AT L+ A          E+ + L      ++P    A   L ++  
Sbjct: 198 LAPEIARHPDITAVATALELARHAGGVGEAAELRRRLA-----ADPDDHQARYDLALAYY 252

Query: 174 KFGKVQKAKT 183
             G+V+ A  
Sbjct: 253 AAGEVETAVD 262


>gi|326575995|gb|EGE25918.1| hypothetical protein E9W_03505 [Moraxella catarrhalis CO72]
          Length = 277

 Score = 41.1 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/178 (11%), Positives = 55/178 (30%), Gaps = 22/178 (12%)

Query: 28  LILMILSLAIWFYLFDGSHEKKKNIVGENFAQA---------------LELFNSNKLDDA 72
            +L++L++   +  +  ++ K   +  + +                  L+      L + 
Sbjct: 30  AVLLVLAVFFGWQYYQKNYAKIDTVAADTYTSISVRDERLVQAYLNPQLDEATKQALAEE 89

Query: 73  RSSF-----EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRY 127
                      + +  N +Y   + M  A       D   A     +  + +L    +  
Sbjct: 90  EKRLFGDIDALVAAHGNTVYAWQALMIKARHQTNNNDLDGAVATLSQATSINLDDDGLIA 149

Query: 128 AATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
            A ++ A  ++          I  + + P+        E+LG       ++  AK+ +
Sbjct: 150 IAKIRHARAMLANGDTNGALSIANE-AMPT-AFEASRQELLGDIYHAKNEIDNAKSAY 205


>gi|145299529|ref|YP_001142370.1| hypothetical protein ASA_2597 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142852301|gb|ABO90622.1| conserved hypothetical protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 216

 Score = 41.1 bits (95), Expect = 0.11,   Method: Compositi