BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780421|ref|YP_003064834.1| hypothetical protein
CLIBASIA_01530 [Candidatus Liberibacter asiaticus str. psy62]
         (218 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780421|ref|YP_003064834.1| hypothetical protein CLIBASIA_01530 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040098|gb|ACT56894.1| hypothetical protein CLIBASIA_01530 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 218

 Score =  131 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 218/218 (100%), Positives = 218/218 (100%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA
Sbjct: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL
Sbjct: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK
Sbjct: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK
Sbjct: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218


>gi|239831250|ref|ZP_04679579.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239823517|gb|EEQ95085.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 268

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 54/209 (25%), Positives = 100/209 (47%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +  +     + I+     +  +    + K +  G+ F  AL+L 
Sbjct: 51  VNEEIRSERAKQVWRNFGPLVIGAAVAIVLGTAGWVGYQHWTDSKASASGDKFLAALDLA 110

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +  K D+A ++   +       Y  L+ +  AS++  KGD   A + F  VA D+  P  
Sbjct: 111 SEGKNDEALAALADLEKTGYGSYPVLARLRAASVIADKGDAAGAVKAFDDVAADNAVPAP 170

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A  +LVD+ SY++++K ++ LS   NPM   A E LG++A K  +   A  +
Sbjct: 171 LRDVARLRAGYLLVDSGSYDDVAKRVETLSADGNPMRSSAREALGLAAWKAERFDDAVKL 230

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASD 213
           F+++A D+ +P  I  RS  +L  + ++ 
Sbjct: 231 FQQIANDSLAPANIRQRSNTMLDLMRSAG 259


>gi|153007832|ref|YP_001369047.1| hypothetical protein Oant_0487 [Ochrobactrum anthropi ATCC 49188]
 gi|151559720|gb|ABS13218.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 227

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 53/209 (25%), Positives = 102/209 (48%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +  +     + I+     +  +    + K +  G+ F  AL+L 
Sbjct: 10  VNEEIRSERAKQIWRNFGPLLIGGAVAIVLGTAGWVGYQHWVDSKASASGDKFLAALDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +  K D+A ++ + +       Y  L+ +  AS++  KGD   A + F +VA D+  P  
Sbjct: 70  SEGKNDEALTALDDLEKTGYGSYPVLARLRAASVIADKGDAAGAVKAFDEVAADNAVPAP 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A  +LVD+ SY++++K ++ LS   NPM   A E LG++A K  +   A  +
Sbjct: 130 LRDVARLRAGYLLVDSGSYDDVAKHVETLSADGNPMRSSAREALGLAAWKAERFDDAVKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASD 213
           F+++A D+ +P  I  R+  +L  + ++ 
Sbjct: 190 FQQIANDSLAPANIRQRANTMLDLMRSAG 218


>gi|150376650|ref|YP_001313246.1| hypothetical protein Smed_4513 [Sinorhizobium medicae WSM419]
 gi|150031197|gb|ABR63313.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
          Length = 222

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 62/211 (29%), Positives = 107/211 (50%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +  I   + ++I+   +    +D   E   +  G+ F  AL L 
Sbjct: 12  VNDELRSDQMKAVWTRFGSIIIGIAVLIVLGTVGKVGYDYWQESSSSQSGDTFLVALNLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             NK D+A ++   +  +    Y  L+ + +A++   KG+T  A + F  +  D   P A
Sbjct: 72  RENKSDEALAALTGLEKEGYGSYPVLAQLRLATLQAQKGETDAAVKAFSGIGRDTRIPTA 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R AA L+AA +L+D  +YE++S  +++L+ P N M   A E LG+SA K G   KAK+ 
Sbjct: 132 LRDAARLRAAYLLIDAGTYEQVSSEVEQLAVPQNAMRHSAREALGLSAYKAGDYAKAKSW 191

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
           F+++  D  SP G+  R+QM+L  I +S + 
Sbjct: 192 FQQIVDDTESPRGVMNRAQMLLDVIASSGKA 222


>gi|114704715|ref|ZP_01437623.1| hypothetical protein FP2506_07261 [Fulvimarina pelagi HTCC2506]
 gi|114539500|gb|EAU42620.1| hypothetical protein FP2506_07261 [Fulvimarina pelagi HTCC2506]
          Length = 390

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 46/200 (23%), Positives = 95/200 (47%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + + K     +      ++L+++     +  +      + N  G+ +  A +L     +
Sbjct: 15  RQDRLKSIWTRFGTAIVSVVLIVILATGAYVGWQRYSIAQANATGDRYLAAQDLVREGDI 74

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
           D A  +F  I    +  Y  L+ M IA+     G  ++A   +  VAND   P ++R  A
Sbjct: 75  DGAIEAFRAIAEDGSGAYPELAQMSIANAEAEAGRNEDAIASYEAVANDSSVPESLREMA 134

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L+AA +LVD  S +++    ++L+   NP+   A + +G++A K G  + A+ +++ + 
Sbjct: 135 DLRAAYLLVDHGSLDDVRARAERLTGDDNPLRYAARDAIGLAAWKAGDTETARDLYQSIL 194

Query: 190 KDNNSPFGISTRSQMILANI 209
           +  ++P GIS R+ +I   +
Sbjct: 195 EAGDAPNGISQRAGLITGLL 214


>gi|159185150|ref|NP_355258.2| hypothetical protein Atu2301 [Agrobacterium tumefaciens str. C58]
 gi|159140421|gb|AAK88043.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 223

 Score =  117 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 58/211 (27%), Positives = 102/211 (48%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      +       Y  +     ++++  A    +++  +  + +  G+ F  AL+L 
Sbjct: 12  VNEQIRSEQLSRFWGRYGIVVVGAAILVVVGAAGAGIYEYWNTSRASNSGDQFLAALKLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           + NK DDA  +F  + +  +  Y  L+    A++L  KGD   A   F  + ND  AP  
Sbjct: 72  SENKTDDALKAFADLETTGHGNYPVLAKFRSATLLSQKGDAAGAIAAFTAIGNDTSAPQV 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A ++AA +LVD  +Y+++  + + LS     M   A E LG++A K G   KAK  
Sbjct: 132 FRDTARVRAAWLLVDNGTYDQVVALAEPLSTDGQTMRASAREALGLAAYKAGDFAKAKQW 191

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
           FE++  D  +P  ++ R+Q++L NI AS + 
Sbjct: 192 FEQIMSDTQAPRNVTNRAQIMLDNITASGKA 222


>gi|16264870|ref|NP_437662.1| hypothetical protein SM_b20996 [Sinorhizobium meliloti 1021]
 gi|15141009|emb|CAC49522.1| HYPOTHETICAL PROTEIN SM_b20996 [Sinorhizobium meliloti 1021]
          Length = 222

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 62/211 (29%), Positives = 108/211 (51%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +  I   + ++I+   +    +D   E   +  G+ F  AL L 
Sbjct: 12  VNDELRSDQMKAVWTRFGGIIIGIAVLIVLGTVGKVGYDYWQESSSSQSGDTFLAALNLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             NK D+A ++  ++       Y  L+ + +A++   KG+T +A   F ++  D   P A
Sbjct: 72  RENKSDEALAALTELEKDGYGSYPVLAQLRVATLQAQKGETDSAVAAFSEIGRDTRIPAA 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R AA L+AA +L+D  +YE++S  +++L+ P N M   A E LG+SA K G   KAK+ 
Sbjct: 132 LRDAARLRAAYLLIDAGTYEQVSSEVEQLAVPQNAMRHSAREALGLSAYKAGDYAKAKSW 191

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
           F+++  D  SP GI  R+QM+L  I ++ + 
Sbjct: 192 FQQIVDDAQSPRGIMNRAQMLLDVIASTGKA 222


>gi|307307990|ref|ZP_07587708.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti BL225C]
 gi|306901394|gb|EFN31998.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti BL225C]
          Length = 222

 Score =  115 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 62/211 (29%), Positives = 107/211 (50%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +  I   + ++I+   +    +D   E   +  G+ F  AL L 
Sbjct: 12  VNDELRSDQMKAVWTRFGGIIIGIAVLIVLGTVGKVGYDYWQEASSSQSGDTFLAALNLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             NK D+A ++  ++       Y  L+ + +A++   KG+T +A   F  +  D   P A
Sbjct: 72  RENKSDEALAALTELEKDGYGSYPVLAQLRVATLQAQKGETDSAVAAFSGIGRDTRIPAA 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R AA L+AA +L+D  +YE++S  +++L+ P N M   A E LG+SA K G   KAK+ 
Sbjct: 132 LRDAARLRAAYLLIDAGTYEQVSSEVEQLAVPQNAMRHSAREALGLSAYKAGDYAKAKSW 191

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
           F+++  D  SP GI  R+QM+L  I ++ + 
Sbjct: 192 FQQIVDDAQSPRGIMNRAQMLLDVIASTGKA 222


>gi|90418691|ref|ZP_01226602.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336771|gb|EAS50476.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 360

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 49/202 (24%), Positives = 97/202 (48%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + + K     +       +++++ +      +D     + N  G+ +  AL+L    K 
Sbjct: 15  RQDRVKAIWTRFGTYILAAVILVVVITAAVVGWDRYQTAQANASGDAYLAALQLARDGKP 74

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
           D+A ++ + + +     Y  L+ M I  +  A+G    A   F KVA D  AP A+R  A
Sbjct: 75  DEAITALDALAADSYGAYPDLARMSIGGVYQAQGKFDEAVAAFDKVAADAGAPDALRDMA 134

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            ++AA +LVD  +  ++   +++L+  S  +   A E + ++A K    + A  +F++L 
Sbjct: 135 AVRAAYVLVDHGALSDVRSRVERLTGDSEALRFPAREAVALAAWKAEDTETATMLFQQLV 194

Query: 190 KDNNSPFGISTRSQMILANIIA 211
            D  +P GI +R++++L  I A
Sbjct: 195 DDPGAPNGIISRARLMLDLIAA 216


>gi|307319942|ref|ZP_07599365.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti AK83]
 gi|306894482|gb|EFN25245.1| Protein of unknown function DUF2133 [Sinorhizobium meliloti AK83]
          Length = 222

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 62/211 (29%), Positives = 106/211 (50%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +  I   + ++I+   +    +D   E   +  G+ F  AL L 
Sbjct: 12  VNDELRSDQMKAVWTRFGGIIIGIAVLIVLGTVGKVGYDYWQEASSSQSGDTFLAALNLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             NK D+A ++  ++       Y  L+ + +A++   KG+T  A   F  +  D   P A
Sbjct: 72  RENKSDEALAALTELEKDGYGSYPVLAQLRVATLQAQKGETDAAVAAFSGIGRDTRIPAA 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R AA L+AA +L+D  +YE++S  +++L+ P N M   A E LG+SA K G   KAK+ 
Sbjct: 132 LRDAARLRAAYLLIDAGTYEQVSSEVEQLAVPQNAMRHSAREALGLSAYKAGDYAKAKSW 191

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
           F+++  D  SP GI  R+QM+L  I ++ + 
Sbjct: 192 FQQIVDDAQSPRGIMNRAQMLLDVIASTGKA 222


>gi|222086679|ref|YP_002545213.1| hypothetical protein Arad_3292 [Agrobacterium radiobacter K84]
 gi|221724127|gb|ACM27283.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 227

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 55/211 (26%), Positives = 101/211 (47%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + +     +  +     ++I+     +  +     ++    G+ F  AL L 
Sbjct: 12  VNEELRSDQLRFVWRRFGRVIIGAAVLIVVGTAAYSGYRYWSGQQAGNSGDQFISALTLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           + NK D+A ++   I    +  Y  L+ +  A++   KGDT  A   F  +  +   P  
Sbjct: 72  DQNKTDEALAALAAIEKDGSGSYPLLARLRAATLQAQKGDTAGAVAAFSAIGKETGLPTV 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R AA L+AA +LVDT +Y++++   Q+L+ P+N     A ++LG++A K G   KA+  
Sbjct: 132 IRDAARLRAAYLLVDTGTYDQVAAEAQELAVPANTFRHSARDVLGLAAYKAGDFAKARQW 191

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
           F+ +  D  SP  +  R+QM+L  I AS + 
Sbjct: 192 FQAIVDDPQSPRNVGNRAQMLLDLITASGKA 222


>gi|315122135|ref|YP_004062624.1| hypothetical protein CKC_01925 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495537|gb|ADR52136.1| hypothetical protein CKC_01925 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 220

 Score =  112 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 139/218 (63%), Positives = 170/218 (77%), Gaps = 1/218 (0%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+SN D +S K  CK+ K  YK I PLLIL++LSLA W YL    ++ K    GE+F+QA
Sbjct: 1   MKSNKDTSSCKEGCKIKKYGYKLIVPLLILIVLSLASWLYLHGSYNKPKNP-AGEDFSQA 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           + L N+NKLDDAR +FEKILS DN+ Y+ ++NMYIASILV KGD K+A+E FLKV NDDL
Sbjct: 60  ISLLNNNKLDDARIAFEKILSYDNRSYDSIANMYIASILVTKGDVKSASEKFLKVGNDDL 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   VRY A L AA ILVDT SY++ISKILQKL +PSNPMH  ANEILGISA+K GK++K
Sbjct: 120 ALPVVRYTAILHAAWILVDTVSYDDISKILQKLIDPSNPMHPAANEILGISAMKCGKIEK 179

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           A++IFEE+ KD NSP GISTRSQ++LANIIAS++  KK
Sbjct: 180 ARSIFEEIVKDPNSPPGISTRSQIMLANIIASNKETKK 217


>gi|85716389|ref|ZP_01047361.1| hypothetical protein NB311A_02311 [Nitrobacter sp. Nb-311A]
 gi|85696746|gb|EAQ34632.1| hypothetical protein NB311A_02311 [Nitrobacter sp. Nb-311A]
          Length = 217

 Score =  112 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/212 (19%), Positives = 86/212 (40%), Gaps = 1/212 (0%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  D    + + +     Y  +    ++++++    +  +     +K       F  A  
Sbjct: 6   SEIDDELRREQVQKFWSRYWALIVAAVILVIAAVGGWRGYQYLQTQKAAEASSTFEAAAA 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L   NK  +A ++F K+       Y  LS +  A+          A +++  +A+D    
Sbjct: 66  LAAQNKHAEAEAAFTKLAETAPSGYRTLSRLRAAAEAARHDTNA-AVKLYDAIASDSGLS 124

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
            A R  A + AA +LVDT +Y  +   L+  + P       A E+L +SA   G    A+
Sbjct: 125 SAERDLARVSAARLLVDTETYNNMLPRLEPATAPEATYRHTARELLALSAWSNGDTTAAR 184

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
              + +++D  +P  +  R++ + A +    +
Sbjct: 185 KWLDMISEDGQTPSSLRRRAEALQALLPPVAK 216


>gi|222149420|ref|YP_002550377.1| hypothetical protein Avi_3303 [Agrobacterium vitis S4]
 gi|221736403|gb|ACM37366.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 223

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 51/212 (24%), Positives = 107/212 (50%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + +        +   + ++I+     + L+D   + + +  G+ F  A +L 
Sbjct: 12  VNDELRSEQMRRFWRRLGPVFIGIAVLIVVGTAGYRLYDYYTDDRASKSGDRFLAATKLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              K D A S  + +       Y  L+ +  AS++  KGD K A + F  +  D+  P  
Sbjct: 72  TDGKNDQALSDLQALEKDGFGAYPVLAKLRAASLMAEKGDAKAAIDAFTAIGKDNSVPQV 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A ++AA +L+D  +YE++S  ++ L+ P   +   A E LG++A K G+ ++A+  
Sbjct: 132 IRDVAHIRAAWLLIDNGTYEQVSTEVEALAVPGQGLRHSAREALGLAAYKAGQTERAREW 191

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           F+++ +D+ +P  ++ R+Q++L NI A+ + +
Sbjct: 192 FQQITEDSEAPRNVANRAQIMLDNIAAAGKAS 223


>gi|227822914|ref|YP_002826886.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
 gi|227341915|gb|ACP26133.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
          Length = 222

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 61/211 (28%), Positives = 110/211 (52%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +  +   +  +I+   +    +D   E   +  G+ F  AL+L 
Sbjct: 12  VNEELRSDQMKAIWTRFGGVIIGVAALIVLGTVGKVGYDYWQESSSSQSGDAFLVALDLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             N+ ++A  +  K+  +    Y  L+ +  A++   KG+T+ A   F ++  D+  P A
Sbjct: 72  KENRSEEALGALTKLEQEGYGSYPVLARLRAATLKAQKGETEAAFAAFSEIGKDNRIPAA 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R AA L+AA +L+DT +Y+++S  +++L+ P N M   A E LG++A K G   KAK  
Sbjct: 132 LRDAARLRAAYLLIDTGTYDQVSAEVEQLAVPQNAMRHSAREALGLAAFKAGDYAKAKGW 191

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
           F+++A D  SP G++ R+QM+L  I AS + 
Sbjct: 192 FQQIADDTESPRGVANRAQMLLDVIAASGKA 222


>gi|190892853|ref|YP_001979395.1| hypothetical protein RHECIAT_CH0003269 [Rhizobium etli CIAT 652]
 gi|190698132|gb|ACE92217.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
 gi|327189206|gb|EGE56386.1| hypothetical protein RHECNPAF_700018 [Rhizobium etli CNPAF512]
          Length = 227

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 56/211 (26%), Positives = 108/211 (51%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +     +  ++I+       L+D   + + +  G+ F  A++L 
Sbjct: 12  VNEELRSDQMKGAWRRFGRYIIVAAILIVVGTAGKVLYDYWDDSRSSGAGDQFLAAMKLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           + NK D+A ++ +K+  + +  Y  L+ M  A++   KGD   A   F ++  D+  P A
Sbjct: 72  DENKNDEALAALDKLEKEGHGAYPVLARMRAATVQAQKGDAAAAIAAFNEIGKDNGVPAA 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           VR AA ++A  +L++  SYE++S  +++++ P N     A E LG++A K G + +A+  
Sbjct: 132 VRDAARMRAGWLLIENGSYEQVSAAIEEMAVPGNAFRHSAREALGLAAYKAGNMAQARQW 191

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
           F+ +  D  SP  ++ R+QM+L  I AS + 
Sbjct: 192 FQSIIDDAESPRPVANRAQMMLDLITASGKA 222


>gi|23501278|ref|NP_697405.1| hypothetical protein BR0374 [Brucella suis 1330]
 gi|23347165|gb|AAN29320.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 223

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 102/213 (47%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +      + + ++     +  +    + K +  G+ F  AL+L 
Sbjct: 10  VNEELRSERAKQVWRNFGPALIGVAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            + K D+A ++F  +       Y  L+ + +AS+L  KGD   A + F +++ D+  P  
Sbjct: 70  AAGKTDEALAAFTDLEKTGYGSYPVLARLRVASVLADKGDAAAAVKAFDEISADNSVPEP 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +
Sbjct: 130 LRNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           F+ +A+D  +P     R+ ++L  + ++    +
Sbjct: 190 FKLVAEDGLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|306842333|ref|ZP_07474992.1| Hypothetical protein BIBO2_2108 [Brucella sp. BO2]
 gi|306845010|ref|ZP_07477591.1| Hypothetical protein BIBO1_1695 [Brucella sp. BO1]
 gi|306274642|gb|EFM56431.1| Hypothetical protein BIBO1_1695 [Brucella sp. BO1]
 gi|306287549|gb|EFM59008.1| Hypothetical protein BIBO2_2108 [Brucella sp. BO2]
          Length = 223

 Score =  110 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 101/213 (47%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +        + ++     +  +    + K +  G+ F  AL+L 
Sbjct: 10  VNEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  
Sbjct: 70  AAGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEP 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +
Sbjct: 130 LRNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAVKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           F+ +A+D+ +P     R+ ++L  + ++    +
Sbjct: 190 FKLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|163867848|ref|YP_001609052.1| hypothetical protein Btr_0618 [Bartonella tribocorum CIP 105476]
 gi|161017499|emb|CAK01057.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 223

 Score =  110 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/214 (26%), Positives = 113/214 (52%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +A   + K       Y +     +L+ + +   + ++  +  KK + VG+ F ++LEL 
Sbjct: 10  VNAEFRQEKALAFWRRYGFSMIGAVLLFILMITIYQIYHHTQIKKASYVGDAFVKSLELA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           ++   D A    E +       Y  L+ +  AS+L+ +GD   + EIF  VA D+ AP  
Sbjct: 70  DTRHFDKAIKQLENVRDSHFGGYPFLARLREASLLMEQGDFIKSVEIFDSVAADEKAPQI 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A ++AA +LVD+ + +++ K ++ ++   +PM   A E LG++A K GKV +A   
Sbjct: 130 LRKVAKIRAAYLLVDSGTLDDVKKRVKDMTSDIDPMRMSAREALGLAAYKAGKVDEAVDY 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           F++++++      I+ R++++L  + A  + NK+
Sbjct: 190 FQKISEEGVLRSNITDRARIMLELMQAEGKVNKE 223


>gi|218516155|ref|ZP_03512995.1| hypothetical protein Retl8_22038 [Rhizobium etli 8C-3]
          Length = 227

 Score =  110 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 55/211 (26%), Positives = 108/211 (51%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +     +  ++I+       L++   + + +  G+ F  A++L 
Sbjct: 12  VNEELRSDQMKGAWRRFGRYIIVAAILIVVGTAGKVLYEYWDDSRSSGAGDQFLAAMKLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           + NK D+A ++ +K+  + +  Y  L+ M  A++   KGD   A   F ++  D+  P A
Sbjct: 72  DENKNDEALAALDKLEKEGHGAYPVLARMRAATVQAQKGDAAAAIAAFNEIGKDNGVPAA 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           VR AA ++A  +L++  SYE++S  +++++ P N     A E LG++A K G + +A+  
Sbjct: 132 VRDAARMRAGWLLIENGSYEQVSAAIEEMAVPGNAFRHSAREALGLAAYKAGNMAQARQW 191

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
           F+ +  D  SP  ++ R+QM+L  I AS + 
Sbjct: 192 FQSIIDDAESPRPVANRAQMMLDLITASGEA 222


>gi|110633048|ref|YP_673256.1| hypothetical protein Meso_0691 [Mesorhizobium sp. BNC1]
 gi|110284032|gb|ABG62091.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 223

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 101/209 (48%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + + ++    Y  IA  L  +++     +  +D     + N  G+ FAQALEL 
Sbjct: 10  VNEELRQDQMRVLWRRYGPIAIGLAALLVLGMAAWVAYDHWWTSRANESGDRFAQALELA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
                 +A    E++ +     Y  L+ +  A+ L    D   A   F +VAND   P A
Sbjct: 70  EEGNSQEALQLLEELENSGAGAYPVLARLRAATTLADSDDIDGAITKFDEVANDAAVPAA 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+AA +LVD  SY +++  ++ LS  +NPM   A E + ++A K G  + A ++
Sbjct: 130 IRDVARLRAALLLVDHGSYADVAARVETLSADTNPMRHIARETMALAAWKEGNRENALSL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASD 213
           F E+A D  +P G   R++M++  I  + 
Sbjct: 190 FGEIADDEQAPAGARQRAEMMMDLISGTA 218


>gi|86358710|ref|YP_470602.1| hypothetical protein RHE_CH03109 [Rhizobium etli CFN 42]
 gi|86282812|gb|ABC91875.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 227

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 56/211 (26%), Positives = 110/211 (52%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +     ++ ++I+       L++   + + +  G+ F  A++L 
Sbjct: 12  VNEELRSDQMKGVWRRFGRYIIVVAILIVLGTAGKVLYEYWDDTRSSGAGDQFLAAMKLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           + NK D+A ++ EK+  + +  Y  L+ M  A++   KGD   A   F ++  D+  P A
Sbjct: 72  DENKNDEALAALEKLEKEGHGAYPVLARMRAATVQAQKGDAGAAIAAFNEIGKDNSVPAA 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           VR  A ++A  +L++  SYE++S ++++++ PSN     A E LG++A K G + +A+  
Sbjct: 132 VRDVAKMRAGWLLIENGSYEQVSAVIEEMAVPSNAFRHSAREALGLAAYKAGNMAQARQW 191

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
           F+ +  D  SP  ++ R+QM+L  I AS + 
Sbjct: 192 FQSIVDDAGSPRPVANRAQMMLDLITASGKA 222


>gi|161618353|ref|YP_001592240.1| hypothetical protein BCAN_A0382 [Brucella canis ATCC 23365]
 gi|254703734|ref|ZP_05165562.1| hypothetical protein Bsuib36_07392 [Brucella suis bv. 3 str. 686]
 gi|260567012|ref|ZP_05837482.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261754379|ref|ZP_05998088.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|161335164|gb|ABX61469.1| Hypothetical protein BCAN_A0382 [Brucella canis ATCC 23365]
 gi|260156530|gb|EEW91610.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261744132|gb|EEY32058.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 223

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 102/213 (47%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +        + ++     +  +    + K +  G+ F  AL+L 
Sbjct: 10  VNEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            + K D+A ++F  +       Y  L+ + +AS+L  KGD   A + F +++ D+  P  
Sbjct: 70  AAGKTDEALAAFTDLEKTGYGSYPVLARLRVASVLADKGDAAAAVKAFDEISADNSVPEP 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +
Sbjct: 130 LRNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           F+ +A+D+ +P     R+ ++L  + ++    +
Sbjct: 190 FKLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|225626892|ref|ZP_03784931.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|254701189|ref|ZP_05163017.1| hypothetical protein Bsuib55_10067 [Brucella suis bv. 5 str. 513]
 gi|254709530|ref|ZP_05171341.1| hypothetical protein BpinB_04507 [Brucella pinnipedialis B2/94]
 gi|254713053|ref|ZP_05174864.1| hypothetical protein BcetM6_06734 [Brucella ceti M644/93/1]
 gi|254716594|ref|ZP_05178405.1| hypothetical protein BcetM_09268 [Brucella ceti M13/05/1]
 gi|254718561|ref|ZP_05180372.1| hypothetical protein Bru83_03299 [Brucella sp. 83/13]
 gi|256031024|ref|ZP_05444638.1| hypothetical protein BpinM2_10279 [Brucella pinnipedialis
           M292/94/1]
 gi|256060516|ref|ZP_05450685.1| hypothetical protein Bneo5_09218 [Brucella neotomae 5K33]
 gi|256368831|ref|YP_003106337.1| hypothetical protein BMI_I379 [Brucella microti CCM 4915]
 gi|260168156|ref|ZP_05754967.1| hypothetical protein BruF5_07294 [Brucella sp. F5/99]
 gi|261218393|ref|ZP_05932674.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261317056|ref|ZP_05956253.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261320758|ref|ZP_05959955.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261324510|ref|ZP_05963707.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261751726|ref|ZP_05995435.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261757614|ref|ZP_06001323.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265983536|ref|ZP_06096271.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265988094|ref|ZP_06100651.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|294851759|ref|ZP_06792432.1| hypothetical protein BAZG_00674 [Brucella sp. NVSL 07-0026]
 gi|306837297|ref|ZP_07470180.1| Hypothetical protein BROD_0083 [Brucella sp. NF 2653]
 gi|225618549|gb|EEH15592.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|255998989|gb|ACU47388.1| hypothetical protein BMI_I379 [Brucella microti CCM 4915]
 gi|260923482|gb|EEX90050.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293448|gb|EEX96944.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296279|gb|EEX99775.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261300490|gb|EEY03987.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261737598|gb|EEY25594.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261741479|gb|EEY29405.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|264660291|gb|EEZ30552.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264662128|gb|EEZ32389.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294820348|gb|EFG37347.1| hypothetical protein BAZG_00674 [Brucella sp. NVSL 07-0026]
 gi|306407610|gb|EFM63806.1| Hypothetical protein BROD_0083 [Brucella sp. NF 2653]
          Length = 223

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 101/213 (47%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +        + ++     +  +    + K +  G+ F  AL+L 
Sbjct: 10  VNEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  
Sbjct: 70  AAGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEP 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +
Sbjct: 130 LRNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           F+ +A+D+ +P     R+ ++L  + ++    +
Sbjct: 190 FKLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|17987834|ref|NP_540468.1| hypothetical protein BMEI1551 [Brucella melitensis bv. 1 str. 16M]
 gi|225851917|ref|YP_002732150.1| hypothetical protein BMEA_A0411 [Brucella melitensis ATCC 23457]
 gi|256044099|ref|ZP_05447010.1| hypothetical protein Bmelb1R_06372 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112897|ref|ZP_05453813.1| hypothetical protein Bmelb3E_09470 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256264571|ref|ZP_05467103.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260563457|ref|ZP_05833943.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265990511|ref|ZP_06103068.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994339|ref|ZP_06106896.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17983562|gb|AAL52732.1| hypothetical membrane associated protein [Brucella melitensis bv. 1
           str. 16M]
 gi|225640282|gb|ACO00196.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|260153473|gb|EEW88565.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|262765452|gb|EEZ11241.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001295|gb|EEZ13870.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094936|gb|EEZ18644.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408415|gb|ADZ65480.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538129|gb|ADZ86344.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 223

 Score =  108 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 50/213 (23%), Positives = 100/213 (46%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +        + ++     +  +    + K +  G+ F  AL+L 
Sbjct: 10  VNEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  
Sbjct: 70  AAGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEP 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A L+A  +LVD  SY+++++ ++ LS   NPM   A E LG++A K  +   A  +
Sbjct: 130 SRNIARLRAGYLLVDNGSYDDVAERVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           F+ +A+D+ +P     R+ ++L  + ++    +
Sbjct: 190 FKLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|163842661|ref|YP_001627065.1| hypothetical protein BSUIS_A0405 [Brucella suis ATCC 23445]
 gi|163673384|gb|ABY37495.1| Hypothetical protein BSUIS_A0405 [Brucella suis ATCC 23445]
          Length = 223

 Score =  108 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 101/213 (47%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +        + ++     +  +    + K +  G+ F  AL+L 
Sbjct: 10  VNEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  
Sbjct: 70  AAGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEP 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +
Sbjct: 130 LRNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKGERFDDAAKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           F+ +A+D+ +P     R+ ++L  + ++    +
Sbjct: 190 FKLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|62289365|ref|YP_221158.1| hypothetical protein BruAb1_0400 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699290|ref|YP_413864.1| hypothetical protein BAB1_0404 [Brucella melitensis biovar Abortus
           2308]
 gi|189023619|ref|YP_001934387.1| hypothetical protein BAbS19_I03740 [Brucella abortus S19]
 gi|237814854|ref|ZP_04593852.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254688682|ref|ZP_05151936.1| hypothetical protein Babob68_00559 [Brucella abortus bv. 6 str.
           870]
 gi|254693166|ref|ZP_05154994.1| hypothetical protein Babob3T_00550 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696809|ref|ZP_05158637.1| hypothetical protein Babob28_03613 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254707886|ref|ZP_05169714.1| hypothetical protein BpinM_13191 [Brucella pinnipedialis
           M163/99/10]
 gi|254729716|ref|ZP_05188294.1| hypothetical protein Babob42_00560 [Brucella abortus bv. 4 str.
           292]
 gi|256256929|ref|ZP_05462465.1| hypothetical protein Babob9C_06139 [Brucella abortus bv. 9 str.
           C68]
 gi|260545881|ref|ZP_05821622.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260754158|ref|ZP_05866506.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260757378|ref|ZP_05869726.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761202|ref|ZP_05873545.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883183|ref|ZP_05894797.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261213404|ref|ZP_05927685.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261315377|ref|ZP_05954574.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|297247780|ref|ZP_06931498.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
 gi|62195497|gb|AAX73797.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615391|emb|CAJ10360.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|189019191|gb|ACD71913.1| hypothetical protein BAbS19_I03740 [Brucella abortus S19]
 gi|237789691|gb|EEP63901.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260097288|gb|EEW81163.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260667696|gb|EEX54636.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671634|gb|EEX58455.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674266|gb|EEX61087.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260872711|gb|EEX79780.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915011|gb|EEX81872.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261304403|gb|EEY07900.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|297174949|gb|EFH34296.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
          Length = 223

 Score =  108 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 50/213 (23%), Positives = 101/213 (47%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +        + ++     +  +    + K +  G+ F  AL+L 
Sbjct: 10  VNEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  
Sbjct: 70  AAGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEP 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A  +LVD  SY+++++ ++ LS   NPM   A E LG++A K  +   A  +
Sbjct: 130 LRNIARLRAGYLLVDNGSYDDVAERVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           F+ +A+D+ +P     R+ ++L  + ++    +
Sbjct: 190 FKLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|85708007|ref|ZP_01039073.1| hypothetical protein NAP1_02190 [Erythrobacter sp. NAP1]
 gi|85689541|gb|EAQ29544.1| hypothetical protein NAP1_02190 [Erythrobacter sp. NAP1]
          Length = 256

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/214 (20%), Positives = 86/214 (40%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    +   K     Y     L I ++L+    FY +DG +E       E    AL+  
Sbjct: 27  IDEAVRQDDTKEFFQKYGVPLGLAISLLLAGMFGFYFWDGRNEAALERQSEQIISALDSV 86

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           + N  + A    + ++ + +      +    A+  + +G+   A E++  +A D   P  
Sbjct: 87  DVNDFEGASEKVDGLVDEGSIGARTSAKFLQAAAALEEGNPAKAVELYASIAADPETPGP 146

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A ++  S   D     ++   L  L+ P NP    A E+  I+ L+ G   +A  +
Sbjct: 147 LRNLAVIREVSTNFDERDPADVIAKLSDLAVPGNPYFGSAGELTAIAHLEAGNRDEAGAL 206

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           F E+A D   P  + +R++ +   +      + +
Sbjct: 207 FAEMANDEALPETLRSRARQMAGLLGVDAIEDVE 240


>gi|319899215|ref|YP_004159308.1| hypothetical protein BARCL_1057 [Bartonella clarridgeiae 73]
 gi|319403179|emb|CBI76738.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 223

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/214 (23%), Positives = 113/214 (52%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + K       Y ++    I++ + +  ++ ++      K + VG+ F ++L+L 
Sbjct: 10  VNEELRQEKFYAFWKRYGFLIIGAIIVFVLMIAFYQIYHHQQMNKASNVGDKFIKSLDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +++  D+A    E +   D   Y  L+ +  AS+ + +GD   + ++F  +  ++ AP  
Sbjct: 70  DAHHFDEAIKQLESVKKSDFGGYPFLAGLREASLWMERGDAVKSVKMFDVIVANERAPQI 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A ++AA ILVD  +++++ + ++ ++   +PM   A E LG++A K  K++ A   
Sbjct: 130 LRKVAKIRAAYILVDIGTFDDVIQRVKDMANDIDPMRMSAREALGLAAYKANKMENAVYY 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           F+++ ++    F I+ R++++L  I AS + NK+
Sbjct: 190 FQKIVEEGAIGFKITDRAKIMLELIQASGKVNKE 223


>gi|256159078|ref|ZP_05456907.1| hypothetical protein BcetM4_09251 [Brucella ceti M490/95/1]
 gi|256254427|ref|ZP_05459963.1| hypothetical protein BcetB_09088 [Brucella ceti B1/94]
 gi|261221595|ref|ZP_05935876.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265997558|ref|ZP_06110115.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260920179|gb|EEX86832.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262552026|gb|EEZ08016.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 223

 Score =  107 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 101/213 (47%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +        + ++     +  +    + K +  G+ F  AL+L 
Sbjct: 10  VNEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWAGYQHWTDSKASASGDKFLAALDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  
Sbjct: 70  AAGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEP 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +
Sbjct: 130 LRNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           F+ +A+D+ +P     R+ ++L  + ++    +
Sbjct: 190 FKLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|49475206|ref|YP_033247.1| hypothetical protein BH04070 [Bartonella henselae str. Houston-1]
 gi|49238011|emb|CAF27216.1| hypothetical protein BH04070 [Bartonella henselae str. Houston-1]
          Length = 223

 Score =  107 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 52/216 (24%), Positives = 108/216 (50%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  +A   + K       Y        ++ + + + + ++     KK   +G+ F + L+
Sbjct: 8   SEVNAEFRQEKALAFWRRYGLWVVFAAIIFVLMIVIYQIYHHVQMKKAGHIGDAFIEVLD 67

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             ++   D+A    E + + +   Y  L+ +  AS+L+ +GD   + E+F  +A D+ AP
Sbjct: 68  FADTRHFDEAMKRLEDVKASNFGGYPFLARLREASLLMEQGDAVKSVEVFDSIAADEKAP 127

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +R  A ++AA ILVDT S +++ K ++ ++     M   A E LG++A K  K+ +A 
Sbjct: 128 PILRAVAKIRAAYILVDTGSLDDVKKRVKDMANDLGSMRMSAREALGLAAYKADKMDEAV 187

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
             F +++K+      I+ R++++L  + A  + N++
Sbjct: 188 DYFRKISKEGALGSKITERARIMLELMQAEGKANRE 223


>gi|304391251|ref|ZP_07373195.1| putative tetratricopeptide repeat protein [Ahrensia sp. R2A130]
 gi|303296607|gb|EFL90963.1| putative tetratricopeptide repeat protein [Ahrensia sp. R2A130]
          Length = 228

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 55/214 (25%), Positives = 96/214 (44%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      +       +  I   L + I+     +   + S  K+    G+ F  A+ L 
Sbjct: 10  VNDELRSERASEFWKRFGTIIIALAVAIVLAVSVWRYMEYSAAKEAAASGDAFMSAVALA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              K ++A ++ EK+ ++    Y  ++ +  AS L  +G  K A   +  V  D++A   
Sbjct: 70  EDGKTEEAIAALEKLEAEHGGAYGAMAQLRAASELAKQGQKKEAIAAYDVVVADNMADED 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A  ++VD  + E++S  +  LS P  P    A E LG++  K G + KA   
Sbjct: 130 LRSIARLRAGYLMVDEGTVEDVSSRVTSLSAPGAPYRSSALEALGLAYFKAGDLDKAFAQ 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           F+E+AKD N+P  I  R  ++L  I A     + 
Sbjct: 190 FDEIAKDANAPASIGQRVTIMLDVIAARGGPTRD 223


>gi|94495670|ref|ZP_01302250.1| hypothetical protein SKA58_06460 [Sphingomonas sp. SKA58]
 gi|94425058|gb|EAT10079.1| hypothetical protein SKA58_06460 [Sphingomonas sp. SKA58]
          Length = 232

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/206 (18%), Positives = 79/206 (38%), Gaps = 1/206 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    + +       Y  I  +++++ L+    +  +    + +   V E     L+  
Sbjct: 15  VDDAVRQDQLTTFWQRYGRILIVVLVVGLAAFGGWLYWQHHQKTQSEAVSEQMDTLLDTA 74

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
                 D       +       Y   + +  A +   KGD K A   +  +A DD     
Sbjct: 75  VGGGTPD-PKQLAALTKASQPGYRASALLVQAGVAARKGDAKAAIAAYRAIAADDSLDQP 133

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A ++  S+  D+   E++   L+ L+    P    A E++ ++ +K GK   A  +
Sbjct: 134 YRDLALIRQTSLEFDSLKPEQVVDRLKPLAVEGAPWFGSAGELVAVAYMKMGKNDLAGPM 193

Query: 185 FEELAKDNNSPFGISTRSQMILANII 210
           F  +AKD+  P  I +R++ +   + 
Sbjct: 194 FAAMAKDDKVPQSIRSRARQMAGVMG 219


>gi|332185317|ref|ZP_08387066.1| hypothetical protein SUS17_235 [Sphingomonas sp. S17]
 gi|332015041|gb|EGI57097.1| hypothetical protein SUS17_235 [Sphingomonas sp. S17]
          Length = 222

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/208 (18%), Positives = 82/208 (39%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  D    + +       +  +   ++L+ L+    +  +     ++    GE    A +
Sbjct: 2   SEVDDELRRERLTSFWTRWGLVIGAVLLIGLAAFGGYLYWQHRQHEQAGADGEQLQAAYD 61

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
               + +  A++    +   +   Y  L++   A IL+ + D K AA  F  +AND    
Sbjct: 62  ALGQSDVKTAQAKLAPLAQSNVDAYRALASFTQADILLQRNDLKGAAARFAAIANDASLA 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  A ++      DT   E +   L  ++ P N     A E++ ++ L+  K  +A 
Sbjct: 122 QPFRDLALVRQTMAEYDTLKPEAVISRLGSMAVPGNAWFGSAGEMVAVAYLRQNKRAQAG 181

Query: 183 TIFEELAKDNNSPFGISTRSQMILANII 210
            +F ++A D + P  +  R+  +   + 
Sbjct: 182 RLFGQIASDKDVPDTLRQRAVQMAGVLG 209


>gi|148559135|ref|YP_001258405.1| hypothetical protein BOV_0389 [Brucella ovis ATCC 25840]
 gi|148370392|gb|ABQ60371.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 223

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 100/213 (46%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K              + ++     +  +    + K +  G+ F  AL+L 
Sbjct: 10  VNEELRSERAKQVWRNSGPALIGAAVAVVLGTAGWVGYQHWTDSKASASGDKFLAALDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            + K D+A ++F  +       Y  L+ +  AS+L  KGD   A + F +++ D+  P  
Sbjct: 70  AAGKTDEALAAFTDLEKTGYGSYPVLARLRAASVLADKGDAAAAVKAFDEISADNSVPEP 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A  +LVD  SY++++K ++ LS   NPM   A E LG++A K  +   A  +
Sbjct: 130 LRNIARLRAGYLLVDNGSYDDVAKRVEPLSADGNPMRTSAREALGLAAWKAERFDDAAKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           F+ +A+D+ +P     R+ ++L  + ++    +
Sbjct: 190 FKLVAEDSLAPANARQRANIMLDLMHSAGVAAQ 222


>gi|298291069|ref|YP_003693008.1| hypothetical protein Snov_1069 [Starkeya novella DSM 506]
 gi|296927580|gb|ADH88389.1| Protein of unknown function DUF2133 [Starkeya novella DSM 506]
          Length = 235

 Score =  105 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 82/201 (40%), Gaps = 1/201 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + +       Y      L ++I+     +  ++    ++    G  F  AL+L 
Sbjct: 8   IDEDLRRERFNRLWTRYGAYVIGLAVLIVLAVAGWRGYEWWKLQRDQAAGAKFEAALQLA 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              K  +A ++F+ +       Y  LS    A+ L        A   +  +A D      
Sbjct: 68  ADGKAAEAEAAFQALEKDGTSGYRVLSRFRAATELAKTD-AAKAVAEYDSLAKDPSISPL 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           ++  A ++AA +LVDT+   ++   ++ L  P       A EI+G++  K G  + A   
Sbjct: 127 MQNVAQVRAALLLVDTAPLADVEGRMKPLDTPEGAFRHSAREIIGLAQYKAGDFKAATDT 186

Query: 185 FEELAKDNNSPFGISTRSQMI 205
           F  +  D  +P G+  R++++
Sbjct: 187 FSAILNDGQTPPGLRRRAELM 207


>gi|240850056|ref|YP_002971449.1| hypothetical protein Bgr_04400 [Bartonella grahamii as4aup]
 gi|240267179|gb|ACS50767.1| hypothetical protein Bgr_04400 [Bartonella grahamii as4aup]
          Length = 223

 Score =  104 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 55/214 (25%), Positives = 110/214 (51%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +A   + K       Y +      ++ + + + + ++     KK   +G+ F ++L+  
Sbjct: 10  VNAEFRQEKALAFWRRYGFSIIGAAILFILMIVAYQIYHHQQIKKAGYIGDAFVKSLDFA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           ++   D A    E + +     Y  L+ +  AS+L+ KGD   + EIF  VA D+ AP  
Sbjct: 70  DTRHFDKAIKQLETVKTSHFGGYPFLARLREASLLMEKGDIIKSVEIFDSVAADEKAPEI 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           ++  A ++AA ILVDT +  ++ K ++ ++  ++PMH  A E LG++A K  K+ +A   
Sbjct: 130 LQKVAKIRAAYILVDTGTLADVEKRIKDMTSDTDPMHMSAREALGLAAYKADKMDEAVYY 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           F+++++       I+ R++++L  I A  + NK+
Sbjct: 190 FKKISEKGALGSKITDRARIMLELIQAEGKANKE 223


>gi|319784771|ref|YP_004144247.1| hypothetical protein Mesci_5097 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170659|gb|ADV14197.1| Protein of unknown function DUF2133 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 221

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 56/212 (26%), Positives = 106/212 (50%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + + +     +     ++ ++++     F  +    E + N  G+ F+QAL+L 
Sbjct: 10  VNDEIRREQAQALWDRFGPALIVVAILVVLGTAAFVGYRYWDETRANRSGDAFSQALKLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           N  K D+A ++ +++       Y  L+ M  A++   KGD   A + F +VA D   P +
Sbjct: 70  NDGKNDEALTALDQLEKDGYGAYPLLARMRGATVKANKGDVPAAVKDFDEVAADTAIPQS 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+AA +LVD  S+ ++S  ++ L+  +N +   A E LG+SA K GK Q A  +
Sbjct: 130 IRDMARLRAALLLVDHGSFADVSSRVEALTSDTNTLRHTAREALGLSAWKEGKTQDALKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           F+++A D+ +P     R+ ++   I  S   +
Sbjct: 190 FDQIAADDGAPRNTRERATLMSELIRGSGSAS 221


>gi|260460375|ref|ZP_05808627.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259034020|gb|EEW35279.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 221

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 58/212 (27%), Positives = 105/212 (49%), Gaps = 1/212 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
           ND        K+    +     +  ++++     F  +    E + N  G+ F+QAL+L 
Sbjct: 11  NDEMRRDQAQKLW-DRFGPALLVAAILVVLGTAAFVGYRYWDETRANRSGDAFSQALKLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           N  K D+A ++ +++       Y  L+ M  A++  +KGD   A + F +VA D   P  
Sbjct: 70  NDGKNDEALAALDQLEKDGYGAYPLLARMRAATVKASKGDVDAAVKDFDEVAADTAIPQG 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+AA +LVD  S+ ++S  ++ L+  +N +   A E LG++A K GK Q A  +
Sbjct: 130 IRDMARLRAALLLVDHGSFADVSSRVEALTSDTNTLRHTAREALGLAAWKEGKTQDALKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           F+++A D+ +P     R+ ++   I  S   +
Sbjct: 190 FDQIASDDGAPRNTRERATLMSELIRGSGNAS 221


>gi|49473956|ref|YP_031998.1| hypothetical protein BQ03100 [Bartonella quintana str. Toulouse]
 gi|49239459|emb|CAF25810.1| hypothetical protein BQ03100 [Bartonella quintana str. Toulouse]
          Length = 223

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 51/214 (23%), Positives = 107/214 (50%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +A   + K       Y +   +  ++ + +     ++     KK   +G+ F + L+  
Sbjct: 10  VNAEFRQEKALAFWRRYGFSVIVAAIIFVLIIAIHQIYHYEQMKKAGHIGDAFMKVLDFA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           ++   D+A    + + + +   Y  L+ M+ AS+L+ +GD   + E F  VA D+ AP  
Sbjct: 70  DTRHFDEAMKQLKNVKASNFGGYPFLARMHEASLLMEQGDAVKSVEAFDSVAADEKAPPI 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A ++AA ILVDT + +++ K ++ +    +PM   A E LG++A K  K+ +A   
Sbjct: 130 LRKVAKIRAAYILVDTGTLDDVKKRVKDMENDIDPMRMSAREALGLAAYKADKMDEAVDY 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           F +++K+       + R++++L  + A  + +K+
Sbjct: 190 FRKISKEGVLGSKATERARIMLELMQAEGKADKE 223


>gi|319794356|ref|YP_004155996.1| hypothetical protein Varpa_3701 [Variovorax paradoxus EPS]
 gi|315596819|gb|ADU37885.1| Protein of unknown function DUF2133 [Variovorax paradoxus EPS]
          Length = 230

 Score =  102 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 22/203 (10%), Positives = 59/203 (29%), Gaps = 2/203 (0%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     Y  +   ++L++    + +  +      K       + +      S  ++ 
Sbjct: 14  DQLKHFWNTYGTLITWVVLLVAGAFVAWNGWQYFQRNKAAQAAALYDEVERSTQSGDVER 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            +     +  +            +A+  + +      +   L            +  A L
Sbjct: 74  IQRVLGDMKERFAGTAYAQQAGLLAAKTLYEKGKVEESRAALGWVAQSAVDPGYQAIAKL 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A+ L+D  SY+E  K L               +  G   +  GK  +A+  + +    
Sbjct: 134 RLAAELLDGKSYDEALKQLDG--NVPKEFEPLVADRKGDIYMAQGKRDEAQQEYRKAWTG 191

Query: 192 NNSPFGISTRSQMILANIIASDQ 214
             +        ++ L  +    +
Sbjct: 192 LGATSDYRRLVEIKLNAVGVDPK 214


>gi|170740823|ref|YP_001769478.1| hypothetical protein M446_2605 [Methylobacterium sp. 4-46]
 gi|168195097|gb|ACA17044.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 236

 Score =  102 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 43/212 (20%), Positives = 88/212 (41%), Gaps = 5/212 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E N D    + +       Y  +   + ++++     +  +    + +       F +A+
Sbjct: 9   EVNED--YRRDRAAEIWKRYSGVFIGIAVLVVIGVGGWRFWQHEQQVQAEAASRRFDEAV 66

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
              + +K  +A  +FE + +     Y  L+  + A+    K D    A  +  +A D   
Sbjct: 67  RA-SKDKGGEAAKAFETLAADSPHGYRILA-QFRAAAEAGKADPAAGARAYAAIAADTGV 124

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              +R AA L+ A + +D+    E    LQ L+   N     A E+LG++A++ G  + A
Sbjct: 125 GPGLRDAARLRGALLRLDSDDP-EALNTLQGLAASGNAFRHTAREMLGLTAMRKGDFEGA 183

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASD 213
              F+++A D  +P G+  R ++ +A      
Sbjct: 184 GRWFDQIAADRETPPGLRQRLEVYVALAAGGP 215


>gi|254456153|ref|ZP_05069582.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207083155|gb|EDZ60581.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 214

 Score =  102 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/203 (15%), Positives = 72/203 (35%), Gaps = 1/203 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            ++N+   + +      K    +++L I+ + I  Y FD     +K  +   F     + 
Sbjct: 8   INSNTRNERVRNFFVKNKSKIIVILLAIMIVLIAAYSFDKYKTNQKIEISNKFNSTTLMH 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +    +    +  +I+++ +  Y+PLS  +I    +         E F  +  +      
Sbjct: 68  SDKNKESTIKNLVEIINKKDPTYSPLSLYFILDKKLISDR-AKINEYFDLLIENTPLDKE 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +      + A    D +   ++  IL  L    +     A  ++        + QK+K  
Sbjct: 127 INNLVIYKKALFNADQAQESDLLNILNPLINSESVWRSHALYLMAEFFYSKDQKQKSKEF 186

Query: 185 FEELAKDNNSPFGISTRSQMILA 207
           F ++    N    I  +++  L 
Sbjct: 187 FNQIISLENPNSDIKLQAEKRLN 209


>gi|13476157|ref|NP_107727.1| hypothetical protein mlr7403 [Mesorhizobium loti MAFF303099]
 gi|14026917|dbj|BAB53513.1| mlr7403 [Mesorhizobium loti MAFF303099]
          Length = 221

 Score =  102 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 60/212 (28%), Positives = 106/212 (50%), Gaps = 1/212 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
           ND    +   K+    +      + ++++     F  +    E + N  G+ F+QAL+L 
Sbjct: 11  NDEMRREQAQKLW-DRFGPALLGIAILVVLGTAAFVGYRYWDETRANRSGDAFSQALKLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           N  K DDA ++ +++       Y  L+ M  A++  +KGDT  A + F  VA D   P  
Sbjct: 70  NDGKNDDALAALDQLEKDGYGAYPLLARMRAATVKASKGDTAAAVKDFDDVAADTAIPQG 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+AA +LVD  S+ ++S  ++ L+  +N +   A E LG++A K GK Q A  +
Sbjct: 130 IRDMARLRAALLLVDHGSFADVSSRVEALTSDTNTLRHTAREALGLAAWKEGKTQDALKL 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           F+++A D+ +P     R+ ++   I  S   +
Sbjct: 190 FDQIAADDGAPRNTRERATLMSELIRGSGNAS 221


>gi|114328957|ref|YP_746114.1| hypothetical protein GbCGDNIH1_2293 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317131|gb|ABI63191.1| hypothetical membrane associated protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 227

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 45/215 (20%), Positives = 83/215 (38%), Gaps = 8/215 (3%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            + +    + K     Y   A  L+L+++  A  +  +     ++     E F       
Sbjct: 13  VEEDLRAERAKKLLVRYGGPAVGLVLLVILGAAGWQGWLWYKHRQDATAAERFLALTRNP 72

Query: 65  NSN--------KLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
                             +         + Y  L+ +  A++L A G+ K A  I+  V+
Sbjct: 73  VDPLAPPVHIVPDAKTEQALTAFAKDSPENYATLARLRAAALLTAGGNKKGAEAIYGTVS 132

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
           ND+ A  A+R  ATLQ+    +D      +   L  L    NP   FA E   +  ++ G
Sbjct: 133 NDNAALPALRDLATLQSVWNRIDDGDPATLRGQLAPLLADGNPWQPFAREGTALLDIRQG 192

Query: 177 KVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           ++  A+   + L++D N+P G+  R+  +LA    
Sbjct: 193 RMDDARRGLQTLSQDENAPPGVRNRATGLLAKFGG 227


>gi|90423780|ref|YP_532150.1| hypothetical protein RPC_2277 [Rhodopseudomonas palustris BisB18]
 gi|90105794|gb|ABD87831.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 217

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 47/212 (22%), Positives = 96/212 (45%), Gaps = 1/212 (0%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  D    + + K     Y  +  +  ++I++    +  +     KK    G  F QA E
Sbjct: 6   NEVDEELRREQLKRLWDRYSLLIIVGAILIIAGVGGWRGYQYFEAKKAAEAGAAFNQASE 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L   NK  +A + F K+ +     Y  L+     +  +A  D + AA+ + ++A D   P
Sbjct: 66  LSEQNKHAEAEAVFAKLATTAPAGYRTLA-RLRNAAEIATRDPQAAAKAYDEIAADRAVP 124

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  A ++AA +L++T+SY ++ + L+  +         A E+L +SA + G    A+
Sbjct: 125 AVDRDLAKVRAAGLLLETASYSDLLQRLEPATTADGTYRHTARELLALSAWRGGDATAAR 184

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
              E ++ D  +P  + +R+ ++ A +  + +
Sbjct: 185 KWLELISTDAETPSSLRSRADVLQALLPPAAK 216


>gi|220924492|ref|YP_002499794.1| hypothetical protein Mnod_4624 [Methylobacterium nodulans ORS 2060]
 gi|219949099|gb|ACL59491.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 236

 Score =  101 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 41/207 (19%), Positives = 86/207 (41%), Gaps = 3/207 (1%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + +       Y  +   + ++++     +  +    + +       F +A+   
Sbjct: 10  VNEEYRRDRAAEIWKRYSGVFIGIAVLVVLGIGGWRFWQHEQQVQAEAASRRFDEAVRTA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             +K  DA  +FE + +     Y  L+ +  A+           A+ +  +A+D+     
Sbjct: 70  -KDKGADAAKTFEAVAADAPGGYRVLARLRAAAEAGKVE-PAAGAKAYAAIADDNAVGQG 127

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+ A + +D     E    LQ L+ P+N     A E+LG+SAL+ G    A   
Sbjct: 128 LRDVARLRGALLRLDADDP-EALNTLQGLATPTNAFRHTAREMLGLSALRKGDFDGAGRW 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIA 211
           F+++A D  +P G+  R ++ +A +  
Sbjct: 187 FDQIAADRETPQGLRQRLEVYIALVAG 213


>gi|121602031|ref|YP_988692.1| hypothetical protein BARBAKC583_0373 [Bartonella bacilliformis
           KC583]
 gi|120614208|gb|ABM44809.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 223

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 110/214 (51%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + K       + ++  +  ++ +   + + ++      +   +G+ F ++L L 
Sbjct: 10  VNEEFRQEKVYAFLKRHGFLVIVAAIIFILAIVGYQVYSHKKMNEARNIGDIFIKSLSLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +S+  D A +  E + + +   Y  L+ +  AS+L  +GD   A E+F  VA D+ AP  
Sbjct: 70  DSHDFDQAMNQLELVKASNFAGYPFLARLREASLLSEQGDAVRAVEMFDTVAFDEKAPQI 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           ++  A +QAA ILVD  + +++ K +Q ++   +PM   A E LG++A K  K+ +A   
Sbjct: 130 LQKVAKIQAAYILVDIGTLDDVKKRVQDIANDIDPMRISAREALGLAAYKADKMDEAVYY 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           F++++++ N    I  R++++L  I A  + NK+
Sbjct: 190 FQKISEEGNLGIKIVERAKIMLELIQAEGKVNKE 223


>gi|328544036|ref|YP_004304145.1| hypothetical protein SL003B_2418 [polymorphum gilvum SL003B-26A1]
 gi|326413780|gb|ADZ70843.1| hypothetical protein SL003B_2418 [Polymorphum gilvum SL003B-26A1]
          Length = 229

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/205 (20%), Positives = 88/205 (42%), Gaps = 1/205 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + K +     +     +L ++I++    +  +    + K    G+ F +A+ L 
Sbjct: 8   VDEDIRQEKYRRLWDRFGLWIIVLAVVIVAGTGGYRGWSYWQQTKAREAGDMFLRAVALA 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            S +  +A+  F ++       Y  L+ +  A+ L   G+ + A   F  +A D      
Sbjct: 68  ESGQHLEAQELFGRL-ETATGGYPVLARLRGATDLAVAGNPEEAIARFDAIAADRSVDSL 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A+L+A  + +D+  +  +   L+ ++  +NP    A EIL  SA K G    A+  
Sbjct: 127 MRDLASLRAGYLALDSLDHAAVQDRLEGVAGDANPWRFAAREILAFSAWKAGDTAAARDW 186

Query: 185 FEELAKDNNSPFGISTRSQMILANI 209
            + +  D  +P  +S R  ++   I
Sbjct: 187 IDRIVDDAAAPADVSGRVGILNELI 211


>gi|296284227|ref|ZP_06862225.1| hypothetical protein CbatJ_11411 [Citromicrobium bathyomarinum
           JL354]
          Length = 267

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 51/215 (23%), Positives = 92/215 (42%), Gaps = 2/215 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D      + +     Y      ++L+ L        F G  E  +    E    AL+  
Sbjct: 31  VDDAVRTDQYRHVWTRYGIYIIGVVLLGLLAFAAVLFFSGQSEGNRESESETLVTALDQV 90

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            +  LD A  +   +           + M  A I + +G  K AAE+F +VA D+  P +
Sbjct: 91  EAGNLDQADEALAPLAEDGRGGGKTQAQMLRAGIALEQGRAKEAAELFGQVAADEDVPQS 150

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A     D+    E+ + L  L++P  P +  A EIL ++ L+ G  ++A  +
Sbjct: 151 IRDLAELRAVVAGYDSMKPAEVIRRLTPLAQPDQPYYGSAGEILAMAYLEGGDKERAGKL 210

Query: 185 FEELAKDNNSPFGISTRSQMILANII--ASDQRNK 217
           F E+A D++ P  I  R++ + + +   A    ++
Sbjct: 211 FGEIAMDDDVPDTIRGRARQMASVLGVDAVGDVDE 245


>gi|144898967|emb|CAM75831.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 227

 Score =  100 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/210 (20%), Positives = 86/210 (40%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  +   +     Y  +     + I+        +      +       F +A ++ 
Sbjct: 17  VDDDLRQENLEKAWKKYGGLFIGGAVAIVLAVAGAQAWQTWRHGQNLQASLRFTEASQML 76

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +         + + +++     Y  LS + +A + +A GD   AA ++ ++A D      
Sbjct: 77  DKGDKAKGTEALQALVASGPSGYKLLSELKLAQVKLADGDAAAAAALYDRIAADGGVDDI 136

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A L++A I ++T     + K +  L+  S      A EIL + ALK G   KA  +
Sbjct: 137 YRDMAVLKSAYIKLETGDIALVEKSVAPLAVESGAWRHSAREILALLALKAGDNAKAMDL 196

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQ 214
             ++A D  +P GI  R+  +LA + ++ +
Sbjct: 197 LRKVADDVAAPAGIRGRAAELLAALESAAK 226


>gi|218532300|ref|YP_002423116.1| hypothetical protein Mchl_4412 [Methylobacterium chloromethanicum
           CM4]
 gi|218524603|gb|ACK85188.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 236

 Score = 99.3 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/209 (21%), Positives = 87/209 (41%), Gaps = 1/209 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + +       Y  +   L +++++    +  +  +   +       F QA  L 
Sbjct: 11  VDEDYRRDQIANIWKRYNALIITLAVLLVAGVGGYNYWRHAERTRAEAASVRFDQANRLA 70

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              K ++A   F  I +     Y  L+   +A+    +     A     K+A D     A
Sbjct: 71  KDGKAEEADRDFAAIQADGPGGYALLARFRLAAEATKRDAAAGADAY-DKLAADTGIGDA 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+AA + +D +        LQ L+ P+N     A E+LG++ALK G ++ A   
Sbjct: 130 LRDLARLRAALLRLDGTDPNAALTSLQGLAAPTNAFRHTAREMLGLTALKRGDIEGAGRW 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASD 213
           F++++ D  +P G+  R ++  A +    
Sbjct: 190 FDQISADGETPQGLRQRVEIYQALVAGGA 218


>gi|209885508|ref|YP_002289365.1| hypothetical protein OCAR_6387 [Oligotropha carboxidovorans OM5]
 gi|209873704|gb|ACI93500.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 214

 Score = 99.3 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 54/212 (25%), Positives = 101/212 (47%), Gaps = 4/212 (1%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  D    + + K     Y     + +++I++ A  + L+     +K    G+ F  AL 
Sbjct: 6   SEIDDELRREQLKKIWDRYSIHIIIAVVLIVAAAGGWRLYQHFETQKAEEAGKAFQSALA 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L        A ++FEKI +   + Y+ L+ + +A   V +   K A   +  +AND    
Sbjct: 66  LT---DPAQAEAAFEKIAASKARGYSMLARLQVAGEAVKQD-PKKAIAAYDVIANDGSLD 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             VR  A ++AA++++DT+SY+EI K LQ  +  +N     A E+L +SA +   V+ A+
Sbjct: 122 APVREIARIRAANLMLDTASYDEIEKRLQGDATGTNTFRHSAREVLALSAWRANNVEAAR 181

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
              + +  D  SP  +  R++ + A +  + +
Sbjct: 182 RWIDMIGNDPQSPATLRRRAEALGALLPTAAK 213


>gi|163853440|ref|YP_001641483.1| hypothetical protein Mext_4042 [Methylobacterium extorquens PA1]
 gi|163665045|gb|ABY32412.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 236

 Score = 98.9 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 44/209 (21%), Positives = 87/209 (41%), Gaps = 1/209 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + +       Y  +   L +++++    +  +  +   +       F +A  L 
Sbjct: 11  VDEDYRRDQIANIWKRYNALIITLAVLLVAGVGGYNYWRHAERTRAEAASVRFDKANRLA 70

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              K ++A   F  I +     Y  L+   +A+    +     A     K+A D     A
Sbjct: 71  KDGKAEEADRDFAAIQADGPGGYALLARFRLAAEATKRDAAAGADAY-DKLAADTGIGDA 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+AA + +D +        LQ L+ P+N     A E+LG++ALK G ++ A   
Sbjct: 130 LRDLARLRAALLRLDGTDPNAALTSLQGLAAPTNAFRHTAREMLGLTALKRGDIEGAGRW 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASD 213
           F++++ D  +P G+  R ++  A +    
Sbjct: 190 FDQISTDGETPQGLRQRVEIYQALVAGGA 218


>gi|240140860|ref|YP_002965340.1| hypothetical protein MexAM1_META1p4432 [Methylobacterium extorquens
           AM1]
 gi|254563369|ref|YP_003070464.1| hypothetical protein METDI5036 [Methylobacterium extorquens DM4]
 gi|240010837|gb|ACS42063.1| hypothetical protein MexAM1_META1p4432 [Methylobacterium extorquens
           AM1]
 gi|254270647|emb|CAX26651.1| hypothetical protein METDI5036 [Methylobacterium extorquens DM4]
          Length = 236

 Score = 98.5 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 44/209 (21%), Positives = 87/209 (41%), Gaps = 1/209 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + +       Y  +   L +++++    +  +  +   +       F +A  L 
Sbjct: 11  VDEDYRRDQIANIWKRYNALIITLAVLLVAGVGGYNYWRHAERTRAEAASVRFDKANRLA 70

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              K ++A   F  I +     Y  L+   +A+    +     A     K+A D     A
Sbjct: 71  KDGKAEEADRDFAAIQADGPGGYALLARFRLAAEATKRDAAAGADAY-DKLAADTGIGDA 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+AA + +D +        LQ L+ P+N     A E+LG++ALK G ++ A   
Sbjct: 130 LRDLARLRAALLRLDGTDPNAALTSLQGLAAPTNAFRHTAREMLGLTALKRGDIEGAGRW 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASD 213
           F++++ D  +P G+  R ++  A +    
Sbjct: 190 FDQISADGETPQGLRQRVEIYQALVAGGA 218


>gi|188583712|ref|YP_001927157.1| hypothetical protein Mpop_4524 [Methylobacterium populi BJ001]
 gi|179347210|gb|ACB82622.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 237

 Score = 98.5 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 46/209 (22%), Positives = 92/209 (44%), Gaps = 1/209 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + +       Y  +     +++++    +  +  +   +     E F +A  L 
Sbjct: 11  VDEDYRRDQIAKIWKRYNALIITGAILLVAGVGGYNYWRHAERTRAEAASEQFDRANRLA 70

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              K ++A   F  I ++    Y  L+   +A+   AK D    A+ +  +AND     +
Sbjct: 71  KDGKAEEADRDFAAIRAEAPGGYALLARFRLAAEA-AKRDAAAGAQAYDGLANDTGIGDS 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+AA + +D +        LQ L+ P+N     A E+LG++ALK G ++ A   
Sbjct: 130 LRDLARLRAALLRLDGTDPNPALTSLQGLAAPTNAFRHTAREMLGLTALKRGDIEGAGRW 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASD 213
           F++++ D  +P G+  R ++  A +    
Sbjct: 190 FDQISADAETPQGLRQRVEVYEALVAGGP 218


>gi|126732582|ref|ZP_01748379.1| hypothetical protein SSE37_25043 [Sagittula stellata E-37]
 gi|126706866|gb|EBA05935.1| hypothetical protein SSE37_25043 [Sagittula stellata E-37]
          Length = 218

 Score = 98.5 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 43/203 (21%), Positives = 77/203 (37%), Gaps = 4/203 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WIA L++L+++    W      S E      G+     L+  + N  
Sbjct: 16  KRDRLFAMMKRYGWIAVLIVLLLVGGTAWREYQISSRETAAQAFGD---SVLDAMDVNDA 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
               ++ E + S        L  M  A    + G+T  A      VA D   P   R  A
Sbjct: 73  AAKAAALEDLSSDTPSARAVL-EMLTADAEQSSGETPAAVARLQGVAADTAVPNIYRQIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           + +A  +  D    EE    L+ L+ P  P+   A E L +  ++ G+ + A T  + + 
Sbjct: 132 SYKAMMLGFDVLPVEERRAGLEALAVPGQPLRLLAEEQLALVEIEVGEREAALTRLQAML 191

Query: 190 KDNNSPFGISTRSQMILANIIAS 212
            D+    G+  R+  ++  +   
Sbjct: 192 DDSEITAGLRRRASQLIVALGGE 214


>gi|56697189|ref|YP_167553.1| hypothetical protein SPO2330 [Ruegeria pomeroyi DSS-3]
 gi|56678926|gb|AAV95592.1| hypothetical protein SPO2330 [Ruegeria pomeroyi DSS-3]
          Length = 258

 Score = 97.8 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 37/204 (18%), Positives = 74/204 (36%), Gaps = 4/204 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +  +    + WI  L ++ I+  A W          K   +G+    A+    S   
Sbjct: 51  RRDRMFLLLKRWGWIGGLAVVAIVGGAAWNEYSKAQATAKAQGLGD----AVIAALSAND 106

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             AR+     ++ D+     +  +  A+    KGDT  A      +A     P   R  A
Sbjct: 107 AAARAEALGAITPDSTGGAAVLALLTAAADSGKGDTAAAVARLETLAAQGDLPPVYRQIA 166

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             +A  +  DT    +  +  + L++P  P+   A E L +  +  G  + A    + + 
Sbjct: 167 AFKALLLQADTLPVSDRRQQFEALAQPGAPLRLLALEQLALIDIAEGDTEAALARLQSIR 226

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
           +D      +  R+  ++  + A  
Sbjct: 227 EDAEVSTDLQQRATQLMVALGADP 250


>gi|294012483|ref|YP_003545943.1| hypothetical protein SJA_C1-24970 [Sphingobium japonicum UT26S]
 gi|292675813|dbj|BAI97331.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 232

 Score = 97.8 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/206 (16%), Positives = 79/206 (38%), Gaps = 1/206 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    + +       +       +++ L+    +  +    + +   V E   + +   
Sbjct: 15  VDEAVRQDQLLTFWQRFGRWIVAAVIIGLAAFAGWLYWQHYTKTQSQAVSEEMDKVIATA 74

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
                 +A+   +K+       +   + +  A     KGD+K A   +  +A+D      
Sbjct: 75  VGGGTPEAKE-LDKLTQASQPGFRASALLVKAGTAARKGDSKAAIAAYKAMADDASLDRP 133

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A ++  ++  +T   +++   L+ L+    P    A E++ I+ +K  K   A  +
Sbjct: 134 YRDLALIRQTTLEFETLQPQQVVDRLKPLAVEGAPWFGSAGELVAIAYMKMRKPDLAGPL 193

Query: 185 FEELAKDNNSPFGISTRSQMILANII 210
           F  +AKD + P  I +R++ +   + 
Sbjct: 194 FAAMAKDKDVPQSIRSRARQMAGLLG 219


>gi|170750286|ref|YP_001756546.1| hypothetical protein Mrad2831_3889 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656808|gb|ACB25863.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 236

 Score = 97.4 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 45/209 (21%), Positives = 86/209 (41%), Gaps = 2/209 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + +       Y  +   L +++++    +  +         +    F  A  L 
Sbjct: 11  VDEDYRRDRILQIWKRYSGVIIALAVLVVAGVAGWRYWQAQQRAAAEVASVRFDDANRLA 70

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              K+ +A  +FE + +Q    Y  L   + A+    K D    A  F K+A+D      
Sbjct: 71  KDGKVAEADKAFETLEAQGPAGYR-LLARFRAAAETGKRDPAAGAAEFDKLADDTGLGDG 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+AA + +D  + +     LQ L+    P    A E+LG++ALK G  + A   
Sbjct: 130 LRDLARLRAALLRLDGPNPDPALANLQGLAA-GTPFRHTAREMLGLAALKKGDYEDASRW 188

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASD 213
           F+++  D ++P  +  R ++  A +    
Sbjct: 189 FDQIVADPDTPRNLRERIEVYAAIVAGGP 217


>gi|118588126|ref|ZP_01545536.1| hypothetical protein SIAM614_11133 [Stappia aggregata IAM 12614]
 gi|118439748|gb|EAV46379.1| hypothetical protein SIAM614_11133 [Stappia aggregata IAM 12614]
          Length = 227

 Score = 97.4 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/211 (20%), Positives = 93/211 (44%), Gaps = 1/211 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + K +     +      + ++I+     +  +    E++    G+ F +A++L 
Sbjct: 8   VDEDIRQEKYRRLWDRFGPWVLGVAVLIVVGTGGYRGWLYWQEQQSQSAGDTFFEAVKLS 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            +   ++A + + ++ +                +    G T+ A   F  ++ D     A
Sbjct: 68  EAQNYEEAAALYGELDNALGGYPALAKLRQATDL-SNSGKTEEALAEFDALSRDSSIMEA 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+AA + VDT SY +I+  ++KL+  + P    A E+L +SA K G ++ AK  
Sbjct: 127 LRDVAALRAAYLAVDTQSYGDIADRIEKLTGDTGPFRAAARELLALSAWKAGDIETAKQW 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
              + +D  +P  +S R  ++   I +S+  
Sbjct: 187 ISAIEEDTETPADVSRRVSILGDVIRSSNGE 217


>gi|182679274|ref|YP_001833420.1| hypothetical protein Bind_2318 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635157|gb|ACB95931.1| conserved hypothetical protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 254

 Score = 97.4 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/207 (18%), Positives = 83/207 (40%), Gaps = 1/207 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + +       ++++   +IL+IL+ A+ + +       +   +G  +  A++L 
Sbjct: 8   VDEDVRRERILQFLGRFRFLIGGVILLILAGAVGWRITVSHRLAEAEAMGARYQAAIDLA 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              +   A ++ + +  +  + Y  L+ +      VA      AA  +  +A D   P  
Sbjct: 68  QQGEGAQALAALKTLSEEAPQGYATLARLRAIDETVASD-PVAAAGAYAALAEDSRYPAI 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A L+A  + VD    +        L++        A E+L ++ALK      A   
Sbjct: 127 FRDLAHLRALYLQVDQLDPKVFEDKAAALAKSDFAFRNSARELLALAALKRKDFDAAGHW 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIA 211
            +E+  D  +P  +  R++  L  + A
Sbjct: 187 LDEIVVDPAAPASMRQRAEAFLGLVQA 213


>gi|239815180|ref|YP_002944090.1| hypothetical protein Vapar_2189 [Variovorax paradoxus S110]
 gi|239801757|gb|ACS18824.1| conserved hypothetical protein [Variovorax paradoxus S110]
          Length = 230

 Score = 97.0 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/211 (11%), Positives = 61/211 (28%), Gaps = 2/211 (0%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + D      + K     Y  +   ++L++    + +  +      K       + +    
Sbjct: 6   DLDEQEQLDQLKHFWNTYGTLITWVVLLVAGAFVAWNGWQYFQRNKAAQAAALYDEVERS 65

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             S  ++  +     +  +            +A+  + +     A+   L          
Sbjct: 66  TQSGDVERIQRVLGDMKERFAGTAYAQQAGLLAAKALYEKGNAEASRAALGWVAQSAVDP 125

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
             +  A L+ A+ L+D+ SY+E  K L    +          +  G   +  GK  +A+ 
Sbjct: 126 GYKAVAKLRLAAELLDSKSYDEALKQLSG--DVPKEFEPLVADRKGDIYMAQGKRAEAQA 183

Query: 184 IFEELAKDNNSPFGISTRSQMILANIIASDQ 214
            + +               +  L       +
Sbjct: 184 EYRKAWTGLGPASDYRRLVEFKLNAAGVDPK 214


>gi|325293657|ref|YP_004279521.1| hypothetical protein AGROH133_07947 [Agrobacterium sp. H13-3]
 gi|325061510|gb|ADY65201.1| hypothetical protein AGROH133_07947 [Agrobacterium sp. H13-3]
          Length = 223

 Score = 96.6 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 55/175 (31%), Positives = 93/175 (53%)

Query: 41  LFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILV 100
           +++  +  + +  G+ F  AL+L + NK D+A  +F  + +  +  Y  L+    A++L 
Sbjct: 48  IYEYWNTSRASNSGDQFIAALKLASDNKTDEALKAFADLETSGHGNYPVLAKFRSATLLS 107

Query: 101 AKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM 160
            KGD   A   F  + ND  AP   R  A ++AA +LVD  +Y+++  + + LS     M
Sbjct: 108 QKGDAAGAIAAFTAIGNDTSAPQVFRDTAKVRAAWLLVDNGTYDQVVALAEPLSGEGQTM 167

Query: 161 HQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
              A E LG++A K G   KAK  FE++  D  +P  ++ R+Q++L NI AS + 
Sbjct: 168 RASAREALGLAAYKAGDFTKAKQWFEQIVSDAQAPRNVTNRAQIMLDNITASGKA 222


>gi|149186033|ref|ZP_01864348.1| hypothetical protein ED21_24906 [Erythrobacter sp. SD-21]
 gi|148830594|gb|EDL49030.1| hypothetical protein ED21_24906 [Erythrobacter sp. SD-21]
          Length = 259

 Score = 96.6 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/212 (21%), Positives = 92/212 (43%), Gaps = 3/212 (1%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    +G  +     Y      ++ + L+    +  +D   E      GE     L+  
Sbjct: 30  VDDAVRQGDFESFMSSYGKPLLGVVALGLAAFGGYLYWDQQQESTMERSGEELVTILDQL 89

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            +  +D A    +    + +   +    +  A I   +G+T+ AA +F +VA+D+ AP A
Sbjct: 90  EAGNIDTATGQLDGFDGEGSPAISA--KLLRAGIAADEGETQKAATLFGEVADDENAPEA 147

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A ++  +++ D    +E+   ++ L+ P  P    A E++  + L   K  +A  +
Sbjct: 148 LRNLALVRRTALMFDEMGPDEVIAAMKPLAVPGEPFFTSAGELVAHAYLAQDKRAEAGAL 207

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           F E+A+D N+P     R  + +A I+  D  +
Sbjct: 208 FAEIARDENTPEVARAR-MLNMAGILGVDAVD 238


>gi|307294127|ref|ZP_07573971.1| Protein of unknown function DUF2133 [Sphingobium chlorophenolicum
           L-1]
 gi|306880278|gb|EFN11495.1| Protein of unknown function DUF2133 [Sphingobium chlorophenolicum
           L-1]
          Length = 232

 Score = 96.6 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/206 (17%), Positives = 79/206 (38%), Gaps = 1/206 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    + +       +      L++  L L   F  +    + +   V E   + +   
Sbjct: 15  VDEAVRQDQLLTFWQRFGRWIVALVVGGLLLFGAFLYWQHYTKTQSQAVSEEMDKVISTA 74

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
                 DA+   +K+       +   + +  A     KGD+K A   +  +A+D      
Sbjct: 75  VGGGTPDAKE-LDKLTQASQPGFRASALLVKAGTAARKGDSKAAIAAYKAMADDASLDQP 133

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A ++  ++  ++   +++   L+ L+    P    A E++ I+ +K  K   A  +
Sbjct: 134 YRDLALIRQTTLEYESLQPQQVVDRLKPLAVEGAPWFGSAGELVAIAYMKMRKPDLAGPL 193

Query: 185 FEELAKDNNSPFGISTRSQMILANII 210
           F  +AKD N P  I +R++ +   + 
Sbjct: 194 FAAMAKDKNVPQSIRSRARQMAGLLG 219


>gi|87198965|ref|YP_496222.1| hypothetical protein Saro_0943 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134646|gb|ABD25388.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 253

 Score = 96.2 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 48/206 (23%), Positives = 87/206 (42%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    + +       Y       I+  L     +  ++  +       GE   +AL+  
Sbjct: 30  VDDALREDQVFTAVQKYGKPVGAAIIAGLLGLAGWLWYENHNNAVAGEQGEVLTKALDQL 89

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            +  L  A      +    N+ Y   S M  A IL  +G T  AA+ F  +A D  AP A
Sbjct: 90  ETRNLKAAADELGPLAKDGNEGYRATSRMLEAGILAEQGKTAEAAKAFAAIAADGGAPQA 149

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  AT++  ++  D  + +++ + L+ L+ P N     A E++G++ LK GK   A  +
Sbjct: 150 YRDLATIREVALDFDKLAPDKVVERLKPLAVPGNAWFGNAGELVGVAYLKQGKNDLAGAL 209

Query: 185 FEELAKDNNSPFGISTRSQMILANII 210
           F ++AK+   P  +  R++ +   + 
Sbjct: 210 FAQIAKEKTVPDSLRRRARQMAGMLG 235


>gi|163761003|ref|ZP_02168081.1| hypothetical protein HPDFL43_03169 [Hoeflea phototrophica DFL-43]
 gi|162281784|gb|EDQ32077.1| hypothetical protein HPDFL43_03169 [Hoeflea phototrophica DFL-43]
          Length = 223

 Score = 96.2 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 56/179 (31%), Positives = 92/179 (51%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
               ++   E      G+ F  ALEL      D A + F+++ +  +  Y  L+ M  A+
Sbjct: 45  GLRGWEYWQESTAAKSGDAFLAALELARDGNTDAALAGFQELEATGHGSYPVLARMRAAT 104

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
           +L  +GD+  A   F  +  D   P A+R AA ++AA +LVD  SY+++S  ++ L+ P 
Sbjct: 105 VLADQGDSAAAISAFSSIGKDASQPTAIRDAARMRAAYLLVDHGSYDDVSAEVEVLAVPG 164

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           N     A E LG++A K G + KA   F E+  DN +P G++ R+++IL  I A    +
Sbjct: 165 NAARHAAREALGLAAFKAGDLAKASEWFNEVINDNQTPRGVANRARVILDLIAARGGAS 223


>gi|158425954|ref|YP_001527246.1| hypothetical protein AZC_4330 [Azorhizobium caulinodans ORS 571]
 gi|158332843|dbj|BAF90328.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 238

 Score = 95.8 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 92/201 (45%), Gaps = 1/201 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + +       +     L ++ +++    +  +    +++       F  A++L 
Sbjct: 8   IDEDLRRERLSRLWNRFGIYVILFVVAVIAGTAAYSGWRWWQQREAQATSVRFEAAVKLA 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +  K  +A ++F  +       Y  L+    A+ L  +     A   F  +A D     A
Sbjct: 68  DEGKHQEAEAAFNALAKDAPAGYRALARFRAATELATRDKAA-AVAAFDTLAADTGLTAA 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A ++AA ILVDT +  ++ + +Q L++ ++P+   A E++ +S  K G ++ A T 
Sbjct: 127 ERDLARIRAAMILVDTGAVADVKQRVQALADGTSPLRHSARELIALSQYKAGDLKGANTT 186

Query: 185 FEELAKDNNSPFGISTRSQMI 205
              + +D  +P+G+ +R+++I
Sbjct: 187 ASLILEDQETPYGVRSRAELI 207


>gi|319408189|emb|CBI81842.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 223

 Score = 95.8 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 50/213 (23%), Positives = 110/213 (51%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + K +     Y ++  +  ++ +     + ++      K + +G+ F  +L L 
Sbjct: 10  VNEELRQEKVRAFWGRYSFLIIVSAIIFVLAIAVYQIYHYGQMNKASKIGDTFITSLNLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +S + D+A +  E + + D   Y  L+ +  AS+L+ +G+   + E+F  VA D  AP  
Sbjct: 70  DSLQFDEAMNQLESVKTSDFGGYPFLARLREASLLMQQGNAVKSVEVFDAVAADKNAPQI 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           ++  A ++A+ ILVD  +++++ K +  ++   +PM   A E+LG++A K  K+  A   
Sbjct: 130 LQRVAKIRASYILVDIGTFDDVKKRVNDMANDIDPMRMSAREVLGLAAYKANKIDDAIYY 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           F++++++N     I  R++++L  I +  + NK
Sbjct: 190 FQKISEENVLGLKIIDRAKIMLELIQSERKVNK 222


>gi|312114897|ref|YP_004012493.1| hypothetical protein Rvan_2169 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220026|gb|ADP71394.1| hypothetical protein Rvan_2169 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 239

 Score = 95.5 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 95/213 (44%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + +  +    Y     +  L+I +    +              G+    A+ L 
Sbjct: 11  VNEEHRRRQTAVFFKKYGIYIGIAALVIAAGVGGYKWDQARRAADAARGGDALVTAITLH 70

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              K  +A  +   +       Y  L+ ++ AS  +A+     AAE +  VA+D+ AP  
Sbjct: 71  EDGKEAEAEKALADLAGSGPGAYRVLARLHAASESLAQKKYDQAAEDYRGVASDENAPAT 130

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A +Q A++ VD  SYE +S+ L      ++     A ++LGI+A K GK  +A+ I
Sbjct: 131 LRDFARVQIAALSVDKESYESLSQTLAPYRSGTSEWRFAAKDVLGIAAFKEGKRDEAERI 190

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           F E+A D  +P G+  R+Q++LA +    +  +
Sbjct: 191 FGEIASDGAAPAGMRQRAQIMLALLFDQPKAAQ 223


>gi|288958552|ref|YP_003448893.1| hypothetical protein AZL_017110 [Azospirillum sp. B510]
 gi|288910860|dbj|BAI72349.1| hypothetical protein AZL_017110 [Azospirillum sp. B510]
          Length = 214

 Score = 95.5 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 82/209 (39%), Gaps = 2/209 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + + +     Y        +++++    +  +     +K+         A+   
Sbjct: 8   VDEDLRRDRAEHLFKRYGGAMIAAAVLVVAGTAGYSFWRNWQAQKRQEQTVALVTAISQS 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
                +    +        +     L+    A++L+ +G   +AA ++  +A     P+ 
Sbjct: 68  GQG-PEKGIEALAAFAGSADPSLAALAQFNAAALLIRQGKPADAATVYDGIAGHGSVPVE 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  ATL A           +++  L  L+  ++P    A E+  + A + G  +KA+T+
Sbjct: 127 YRDLATLLAVMQRAGDGDAAQLTAKLLPLTAETSPWRFTARELTAMLAARSGDTEKARTL 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASD 213
           +++LA D  +P G+  R+   LA++    
Sbjct: 187 YKQLADDQLAPSGVRGRAAD-LASLYGKG 214


>gi|319404572|emb|CBI78178.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 223

 Score = 95.1 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 54/214 (25%), Positives = 114/214 (53%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + K       Y ++    +++ +   I + ++      K N VG+ F  +L+L 
Sbjct: 10  VNEELRQEKFYNFWKRYGFLVIGAVIIFVLTIIVYQIYQQQQINKANNVGDIFITSLDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +++  D+A    E +   +   Y  L+ +  AS+   +GD   + +IF  +A D+ AP  
Sbjct: 70  DAHHFDEAIKKLESVKQSNFGGYPFLAGLLEASLWTQRGDNAKSVKIFDMIAADEKAPQI 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A ++AA IL+D  +++++ + +++++   +PM   A E LG++A K  K++KA   
Sbjct: 130 LREVAKIRAAYILIDIGTFDDVMQRVKEMANDIDPMRMSAREALGLAAYKANKMEKAVYY 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           F+++ ++N   F I+ R++++L  I AS + NK+
Sbjct: 190 FKKIVEENALGFKITDRAKIMLELIQASGKVNKE 223


>gi|89901083|ref|YP_523554.1| hypothetical protein Rfer_2305 [Rhodoferax ferrireducens T118]
 gi|89345820|gb|ABD70023.1| conserved hypothetical transmembrane protein [Rhodoferax
           ferrireducens T118]
          Length = 240

 Score = 95.1 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 24/199 (12%), Positives = 61/199 (30%), Gaps = 2/199 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     Y       ++++L     +  +      +       + +   +  S     
Sbjct: 14  DQLKHFWKSYGNAITWALILVLGAFASWNFYQYWQRNQATQAAAMYDEVERVVTSADTAK 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
              +F  +  +            + +          AA+  L    D  +    +  A L
Sbjct: 74  IDRAFADMKDRFASTTYAHQAGLLVAKYYYSVGNAQAAKSALGWVVDKSSDPGYQAIAKL 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L+D+ +++E  + L               +  G   L  GK + A   +E+  K+
Sbjct: 134 RLAGLLMDSKAFDEALQQLSG--SFPASFEALVADRKGDILLLQGKKKDAIAEYEKAFKN 191

Query: 192 NNSPFGISTRSQMILANII 210
            +         ++ L ++ 
Sbjct: 192 FDQRTEYRRLVEVKLNSLG 210


>gi|260433295|ref|ZP_05787266.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417123|gb|EEX10382.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 223

 Score = 95.1 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 73/205 (35%), Gaps = 4/205 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +  M    + W+   L+++I+  A +          +   +G+    A+    +N  
Sbjct: 16  RRDRLYMLLRRWGWVGVALVVLIVGGAAFNEYRKARSASQAQELGDAILAAM---ANNDP 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
            +  ++ + + +        +    ++  L   G    A E    +A     P   R  A
Sbjct: 73  SERAAALQAVSAHTAGGDAVVG-FLLSGALTEAGSIPEAVERLNAIAAQGDLPEIYRAIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           + ++  +  DT    +  +  + L+    P+   A E L +  +  G  Q A    + L 
Sbjct: 132 SFKSLLLQADTLPAADRRQQFEALAAAGAPLRLLAEEQLALIDVAEGDTQAALDRLQALR 191

Query: 190 KDNNSPFGISTRSQMILANIIASDQ 214
           +D  +   I  R+  ++  +  +  
Sbjct: 192 QDAEAGIEIRQRAGQLIVALGGTPD 216


>gi|326386675|ref|ZP_08208297.1| hypothetical protein Y88_2569 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208990|gb|EGD59785.1| hypothetical protein Y88_2569 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 262

 Score = 95.1 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 49/206 (23%), Positives = 92/206 (44%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    +         Y   A + I+++L+    +  +           GE  A AL+  
Sbjct: 43  VDDALREDSTLALFKRYGGPAGMAIVLVLAGVGGWLAWTNHVATLTGQRGEQMAIALDQV 102

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            + + D AR+S  +I +     +   S +    I + +  + +AA+ F  VA D  AP  
Sbjct: 103 EAGRYDAARTSLAQIAATGGAGFRAASQLVTGGIALDQHKSADAAKAFGAVAADGSAPQV 162

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  AT++  +   DT   +++   L+ L+ P NP    A E+LG++ +K GK  +A ++
Sbjct: 163 YRDLATVREVAAQFDTMQPQQVVDRLKPLAVPGNPWFGSAGEMLGVAYMKMGKNDQAASL 222

Query: 185 FEELAKDNNSPFGISTRSQMILANII 210
           F  +AKD + P  +  R + +  ++ 
Sbjct: 223 FAAIAKDKSVPDSLRGRIRQLAVHLG 248


>gi|319407563|emb|CBI81213.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 223

 Score = 94.7 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 115/214 (53%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + K       Y ++    +++ +   I + ++      K N VG+ F  +L+L 
Sbjct: 10  VNEELRQEKFYNFWKRYGFLVIGAVIIFVLTIIIYQIYQQQQINKANNVGDIFMTSLDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +++  D+A    E +   +   Y  L+ +  AS+ + +GD   + ++F  +A D+ AP  
Sbjct: 70  DAHHFDEAIKKLESVKQSNFGGYPFLAGLREASLWMERGDNAKSVKMFDMIAADEKAPQI 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A ++AA ILVD  +++++ + +++++   +PM   A E LG++A K  K++KA   
Sbjct: 130 LREVAKIRAAYILVDIGTFDDVMQRVKEIANDIDPMRMSAREALGLAAYKENKMEKAVYY 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           F+++ ++N   F I+ R++++L  I A+ + NK+
Sbjct: 190 FKKIVEENALGFKITDRAKIMLELIQANGKVNKE 223


>gi|254451631|ref|ZP_05065068.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198266037|gb|EDY90307.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 229

 Score = 94.7 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 80/206 (38%), Gaps = 5/206 (2%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            K K       Y WIA L +L+I+    +              VG+    ALE+ +    
Sbjct: 16  RKDKLFGYMRKYGWIAVLAVLLIVGGTAYSEFRKAQTTGAAQAVGDEILAALEIDDDEGR 75

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             A  + +      +     ++ +  A+ L    D   A      VA D  AP   R  A
Sbjct: 76  AAALQAID-----VSGPAAAITGLLTAANLTETDDIAGAVGALEAVALDADAPQVYRDLA 130

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L++  +  DT S E+   +L  L+    P    A E L + +++ G ++ A T F  LA
Sbjct: 131 VLKSVMVQGDTLSIEDRRALLAGLAMAGGPFRVLAQEQLALISVEAGDIETAVTQFVALA 190

Query: 190 KDNNSPFGISTRSQMILANIIASDQR 215
           +D  +  G+  R+  ++  +    + 
Sbjct: 191 QDAEATRGLRERAFSMIVALGGDIEA 216


>gi|254489034|ref|ZP_05102239.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214045903|gb|EEB86541.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 243

 Score = 94.7 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 40/210 (19%), Positives = 77/210 (36%), Gaps = 4/210 (1%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + +       Y WIA L I++I+  A W          K   +G+    AL L 
Sbjct: 17  VNDEVRRDRFYFMLKRYGWIAVLAIVLIVGAAAWNEYQKAQARSKAEALGDAAFAALTLQ 76

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           ++     A S+ E     D+     +     A+  V  GD   A E    +A +   P  
Sbjct: 77  DTEGRAAALSAVE----TDSPRAAAVLGFLTAAEQVEAGDKSAAIETLNAIAVNGEVPAI 132

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A L++ ++    +   +    L+ L++P N +   A E L +  ++    Q A   
Sbjct: 133 YREIAQLKSVTLQGTETPVSDRRLALEALAQPGNTLRLLAEEQLALIEIEENNPQGAIDR 192

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQ 214
           ++ +  D      +  R+  ++  +     
Sbjct: 193 YQAILLDAEVTADLQQRALQVIVALGGEPD 222


>gi|84503433|ref|ZP_01001493.1| hypothetical protein OB2597_03749 [Oceanicola batsensis HTCC2597]
 gi|84388220|gb|EAQ01172.1| hypothetical protein OB2597_03749 [Oceanicola batsensis HTCC2597]
          Length = 205

 Score = 94.3 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 36/200 (18%), Positives = 72/200 (36%), Gaps = 4/200 (2%)

Query: 18  KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFE 77
              Y WIA L+IL+I+  A W+         +    G+    ALE     +  +  ++  
Sbjct: 5   FKRYGWIAVLVILLIVGGAAWYEYDRSRETAQARAFGDAILAALE---QGEPLERATALS 61

Query: 78  KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
            I +          +M  A      GD + A  +   VA +    L  R  A  +A ++ 
Sbjct: 62  AIEAGTPDARAV-RDMLEAGERSTAGDREGALTLLTGVAENPELQLIYRSLAKFRALALS 120

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
            D     E     + L+   +P+   A E + ++ ++ G   +A      +  +      
Sbjct: 121 TDDMGPAERRAEYEDLAGAGSPLRLLAKEQIAVTHIEEGNRDEALRQLNAMLDEAGMTQD 180

Query: 198 ISTRSQMILANIIASDQRNK 217
           +  R   ++ ++  +   N 
Sbjct: 181 LLRRVSQLIVSLGGTPGENG 200


>gi|126736008|ref|ZP_01751752.1| hypothetical protein RCCS2_02198 [Roseobacter sp. CCS2]
 gi|126714565|gb|EBA11432.1| hypothetical protein RCCS2_02198 [Roseobacter sp. CCS2]
          Length = 218

 Score = 94.3 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 40/201 (19%), Positives = 69/201 (34%), Gaps = 7/201 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + K       Y WI    +L+++  A W    +          G+    ALE     + 
Sbjct: 16  RREKLYGYLRRYGWIGVAAVLLLVGGAAWNEYSNAQARSAAEATGDALMSALE-----EN 70

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
           D    +      + +     ++ +  A+     GD   AA+    V  +   P   R  A
Sbjct: 71  DPTVRAAAMAQVEGDGAAAAVTLLLRAATEQEAGDNAAAAQTLNDVTTNPDVPEMYRDVA 130

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L+AA +  D          L+ LS+P  P    A E +    L  G    A  +  E+ 
Sbjct: 131 ALKAAMLPSD--DVAARRANLEALSQPGQPFRLLALEQIAYMTLGEGDADGAIAVMREIV 188

Query: 190 KDNNSPFGISTRSQMILANII 210
           +D     G+  R Q ++  + 
Sbjct: 189 EDAGVTRGLRERVQTLMVALG 209


>gi|209550426|ref|YP_002282343.1| hypothetical protein Rleg2_2847 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536182|gb|ACI56117.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 227

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 51/181 (28%), Positives = 99/181 (54%)

Query: 35  LAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMY 94
                 L++   + + +  G+ F  A++L + NK D+A ++ +K+  + +  Y  L+ M 
Sbjct: 42  GTAGKVLYEYWDDTRSSGAGDQFLAAMKLADENKNDEALAALDKLEKEGHGAYPVLARMR 101

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLS 154
            A++   KGD   A   F ++  D+  P AVR AA ++A  +L++  SYE++S  +++++
Sbjct: 102 AATVQAQKGDAAAAIAAFNEIGKDNGVPAAVRDAAKMRAGWLLIENGSYEQVSAAIEEMA 161

Query: 155 EPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
            P N     A E LG+++ K G + +A+  F+ +  D +SP  ++ R+ M+L  I AS +
Sbjct: 162 VPGNAFRHSAREALGLASYKAGNMAQARQWFQSIVDDTDSPRNVTNRAHMMLDLITASGK 221

Query: 215 R 215
            
Sbjct: 222 A 222


>gi|241764497|ref|ZP_04762518.1| conserved hypothetical protein [Acidovorax delafieldii 2AN]
 gi|241366081|gb|EER60678.1| conserved hypothetical protein [Acidovorax delafieldii 2AN]
          Length = 240

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 19/203 (9%), Positives = 56/203 (27%), Gaps = 2/203 (0%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     +  +   +++++      +  +     ++       F        +     
Sbjct: 29  DQLKHFWNTWGTLISTVVVLVFGSVAVWNGYQYWQNRQAIQASALFDAVDVAARAGDQGR 88

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
              +F  + S+              +  +        A+  L    +       +  A L
Sbjct: 89  MEQAFADLRSKYAGTTQAAQAGLTLAKSMLDAGNAKGAKEALTWVAEKAGDDGYKALARL 148

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + +S+L+D    +E    +               +  G   ++ GK   A   + +  K 
Sbjct: 149 RLSSVLMDQKELDEALAQVSG--TFPAEFDAVVADRKGDILMQQGKQDAAIAEYSKAFKA 206

Query: 192 NNSPFGISTRSQMILANIIASDQ 214
            +         ++ L ++    Q
Sbjct: 207 FDDRLEYRRLVEVKLNSLGVRPQ 229


>gi|316933669|ref|YP_004108651.1| hypothetical protein Rpdx1_2327 [Rhodopseudomonas palustris DX-1]
 gi|315601383|gb|ADU43918.1| Protein of unknown function DUF2133 [Rhodopseudomonas palustris
           DX-1]
          Length = 218

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 95/214 (44%), Gaps = 1/214 (0%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  D    + + +     Y        ++I+     +  ++    K+       FA A E
Sbjct: 6   NEVDEELRRERLRKLWEKYSIYIVGAAILIVVGVGAWRGYEYYEAKQAAEASTAFAAAAE 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L   NK  +A ++F+KI +     Y  +     A+  VA  D   A + + ++A D   P
Sbjct: 66  LAEQNKHAEAEAAFDKIAASAPSGYR-MLARLRAAAEVATRDPALAVKRYDEIAADRRLP 124

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  A ++AA +++DT++Y ++ + L+ ++   +     A E+L +SA +   V   +
Sbjct: 125 APYRDLAGIRAAGLVMDTANYNDLVQRLEPIATADSAFRHTARELLALSAWRANNVAATR 184

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
              +++  D  +P  + +R+ ++ A +  +  ++
Sbjct: 185 QWIDKITTDAETPGSLRSRADVLQALLPPTASKS 218


>gi|258542807|ref|YP_003188240.1| hypothetical protein APA01_17320 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633885|dbj|BAH99860.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636944|dbj|BAI02913.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639997|dbj|BAI05959.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256643053|dbj|BAI09008.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256646108|dbj|BAI12056.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256649161|dbj|BAI15102.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256652148|dbj|BAI18082.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655205|dbj|BAI21132.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 231

 Score = 93.9 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 45/223 (20%), Positives = 81/223 (36%), Gaps = 13/223 (5%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D      + +M    Y      LI+ +L+    +     S + +       +  AL   
Sbjct: 9   VDEEMQAERLRMAAKRYAGAGIGLIVAVLAGIGAWSWHVSSQKSQALEATGTYLTALRQT 68

Query: 65  N-------------SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEI 111
           +             +       +S +K+ S D K    L+ +    +  A+GD K A   
Sbjct: 69  DHLPSTPSSGTVDLTTTAQAGLASLQKLASSDAKGVAVLARLQEGGVQAARGDVKGALAA 128

Query: 112 FLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGIS 171
           +  V  D  A  A+R  ATL      +DT     +   L  L+    P +  A E L + 
Sbjct: 129 WDAVQKDPNADSALRDLATLLWCQKQLDTGEPATLRSRLALLTGKGKPWNGLAMEALAVL 188

Query: 172 ALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
            ++ G V +A+  F  L    + P G+  R+Q ++  +  +  
Sbjct: 189 DVREGHVAEARQKFAALQAAQDVPQGVRNRAQDMMQALDPTAG 231


>gi|27379161|ref|NP_770690.1| hypothetical protein blr4050 [Bradyrhizobium japonicum USDA 110]
 gi|27352311|dbj|BAC49315.1| blr4050 [Bradyrhizobium japonicum USDA 110]
          Length = 217

 Score = 93.9 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 45/210 (21%), Positives = 100/210 (47%), Gaps = 1/210 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    + + K     Y      L+++I++    +  +     KK    G  F +A+EL 
Sbjct: 8   VDEEVRREQLKKLWEKYSIYFIALMVLIVAAVGGWRGYQYLEAKKAAEAGAAFEKAVELS 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             +K  +A ++F ++ ++    Y  L+ +  A+   ++   K AA+++  +A D      
Sbjct: 68  EQDKHAEAETAFTELAAKAPSGYRTLARLRAAAEAASRD-PKAAAKMYDDIAADRGVGGE 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            +  A ++AA +LVD++SY ++ + L+  + P +     A E+L +SA +      A+  
Sbjct: 127 WQDLAKIRAAGLLVDSASYADMQQRLEASATPKSTFRHSARELLALSAWRNNDTTAARKW 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQ 214
            + +A+D  +P G+ +R++ + A +    +
Sbjct: 187 LDAIAEDGETPPGLRSRAEALQALLPPVAK 216


>gi|85703429|ref|ZP_01034533.1| hypothetical protein ROS217_21847 [Roseovarius sp. 217]
 gi|85672357|gb|EAQ27214.1| hypothetical protein ROS217_21847 [Roseovarius sp. 217]
          Length = 257

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 68/201 (33%), Gaps = 5/201 (2%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WIA L ILM++  A W              +G+    AL   +    
Sbjct: 44  RRDRLFALMRRYGWIAVLAILMLVGGAAWNEWRKAQDRAAAQALGDAMLAALATEDRAAR 103

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
            DA ++ E                 +A+   A    + AAE  L +A+        R  A
Sbjct: 104 ADALNAIE-----VQNPQTEAVIALLAAAEAAAETPETAAERLLALADRPDVDAVYRNLA 158

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           TL+A  +       E     L  L+     +   A E L +  L+ G   +A      +A
Sbjct: 159 TLKAVMLPGSGLDAEARRTRLNGLALSGGVLRLLAEEQLALIDLETGNRTEAVARLTAIA 218

Query: 190 KDNNSPFGISTRSQMILANII 210
            D  +  G+  R   ++  + 
Sbjct: 219 TDAEATTGLRRRVTQVIVALG 239


>gi|46201386|ref|ZP_00055151.2| COG2976: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 227

 Score = 92.8 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 45/171 (26%), Positives = 85/171 (49%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
            +  + G   K++      + +   L    K D+A     K+ ++  K Y  L+++  A 
Sbjct: 50  GWQAWQGWDAKQRQAASARYLETSSLIEQGKKDEAAEVLGKLSAEGPKGYRLLADLRRAD 109

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
           + +  GD   AA ++ KVA D       R  A ++AA + +D   +  + K ++ L+  +
Sbjct: 110 MALQAGDAAGAAALYGKVAADTSVDKVYRDMAVIRAAYLTLDGGDFATMEKSVEPLAAEA 169

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILAN 208
           +P    A EIL ++ALK G+  +A  +F ++A+D  +P G+ TR+  +LA 
Sbjct: 170 SPWRHSAREILALAALKRGETPRAAELFAKIAEDAAAPQGLRTRAAEMLAA 220


>gi|296116362|ref|ZP_06834977.1| hypothetical protein GXY_11204 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977062|gb|EFG83825.1| hypothetical protein GXY_11204 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 220

 Score = 92.8 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 39/213 (18%), Positives = 72/213 (33%), Gaps = 12/213 (5%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN---- 65
              + +     Y  +A ++++ I      +        +      + +  AL+       
Sbjct: 2   RAERLRALARRYMMLAGVIVVAICIGGGAWQYNAWRVHQADQASADAYFAALKNATTAHS 61

Query: 66  --------SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
                   + +   A      +          LS M  A++LV  GDT  A  ++ +V  
Sbjct: 62  PDGQPAPLNAQQKTALEQLATLEKTARPPLRALSRMERAALLVNSGDTARALALWAQVNA 121

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
           D  A   +   A L      +DT+    +   L  L     P    A E   +  L+ G 
Sbjct: 122 DQGADPTISSLAGLLWVQHQIDTADPAMLRSRLALLDGAQQPWRGLALECEALLDLRQGH 181

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
             +A+   E L+ D N   G+ TR+  +L  + 
Sbjct: 182 DDEARRRLERLSMDMNVSDGVRTRADGLLQTLG 214


>gi|82703490|ref|YP_413056.1| hypothetical protein Nmul_A2375 [Nitrosospira multiformis ATCC
           25196]
 gi|82411555|gb|ABB75664.1| conserved hypothetical protein [Nitrosospira multiformis ATCC
           25196]
          Length = 212

 Score = 92.8 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/209 (11%), Positives = 67/209 (32%), Gaps = 2/209 (0%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      + K     Y  +  +++ + ++       ++   ++K     E +   L++
Sbjct: 5   NPEEQENIDQLKSWWNTYGTLVIVIVAVFIAGIAGAQAWNYYKKQKTEQALELYDSVLQV 64

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             S        +   ++              I++            +  L+   D+    
Sbjct: 65  QGSGDAKKISDAAGLVMESFPSSGYASRAALISAQASFNAGDLQNTKNRLQWVLDNSGEE 124

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            ++  A L+   +L+D   Y+E  ++L+   +          +  G      GK  +A+ 
Sbjct: 125 ELKDMARLRLTGVLLDEEKYDEALRLLE--VKHGESFDGLYADRRGDVLTATGKFGEARA 182

Query: 184 IFEELAKDNNSPFGISTRSQMILANIIAS 212
            ++      +         QM L  + ++
Sbjct: 183 AYQMALARISPGSTYYDIVQMKLDALPSA 211


>gi|259419239|ref|ZP_05743156.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259345461|gb|EEW57315.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 229

 Score = 92.8 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 73/209 (34%), Gaps = 4/209 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +  +    Y WI  + +L+I+  A W              VG+  + AL   ++   
Sbjct: 23  RRDRLFLMLKRYGWIGAVAVLLIVGGATWREYSRAKAVSAAQDVGDQISAALTANDAADR 82

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             A +               + +   A+ L   G+ + AA +   VA     P   R  A
Sbjct: 83  AVALADISA----GEVGAKAVVDFAQAAALADAGEPEKAASLLDAVAQQSELPQVYRDIA 138

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             ++  +  +T   E+    L+ L+     +   A+E L +  ++ G    A    +E+A
Sbjct: 139 AFKSVILQAETMPVEDRRLRLETLAAAGGSLQFLASEQLALLDIEAGDTDAALARLKEIA 198

Query: 190 KDNNSPFGISTRSQMILANIIASDQRNKK 218
                   +  R   ++  +  S +   +
Sbjct: 199 ASAGVSRDLQERVSQVIVALGGSPEAEAQ 227


>gi|254460969|ref|ZP_05074385.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206677558|gb|EDZ42045.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 224

 Score = 92.8 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/206 (18%), Positives = 71/206 (34%), Gaps = 2/206 (0%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WIA L IL ++  A W          +    G     ALE  +  + 
Sbjct: 16  RRDRLYGYMRRYGWIAVLAILSLVGGAAWNEYSKSQARAEAQSAGNAILAALEADDPQER 75

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             +  + +       +    + ++  A+   A  D   A      +A D   P   R  A
Sbjct: 76  VKSLEALQ--SEDITEGAKAVVSLMQAAEQSAGDDPAGAQTALEAIAVDGSLPEIYRQIA 133

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           + ++A+    + S E+    L  LS P   +   A E L +  ++ G    A    + + 
Sbjct: 134 SFKSATKSGGSLSMEDRRLRLDALSAPGTSLRLLATEQLAMLDIEAGDTAAALEKLQGIV 193

Query: 190 KDNNSPFGISTRSQMILANIIASDQR 215
            D     G+  R+  ++  + A    
Sbjct: 194 VDAEVTAGLRQRATQLIVALGAEPDV 219


>gi|254440175|ref|ZP_05053669.1| hypothetical protein OA307_5045 [Octadecabacter antarcticus 307]
 gi|198255621|gb|EDY79935.1| hypothetical protein OA307_5045 [Octadecabacter antarcticus 307]
          Length = 229

 Score = 92.8 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 50/202 (24%), Positives = 80/202 (39%), Gaps = 5/202 (2%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            K K       Y WIA L++LMI+    +        E     VG+    ALE+ +    
Sbjct: 16  RKDKLLGYMRKYGWIAVLVVLMIVGGTAFSEFRKAQSEGAAQAVGDEILVALEIDDDQGR 75

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             A  + + I          ++ +  A+ L    D   AA     VA D   P   R  A
Sbjct: 76  AAALQAIDVI-----GPAAAVTGLLTAANLTEIDDISGAAGALDAVALDADIPQVYRDLA 130

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L++  I  DT S E+   +L  L+    P    A E L + +++ G +  A T F  LA
Sbjct: 131 ALKSVMIKGDTLSIEDRRTMLADLAVAGAPFRVVAQEQLALISVEAGDIDTAVTQFAALA 190

Query: 190 KDNNSPFGISTRSQMILANIIA 211
           +D  +  G+  R+  ++  +  
Sbjct: 191 QDAEATRGLRERAFSMIVALGG 212


>gi|116253296|ref|YP_769134.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257944|emb|CAK09042.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 227

 Score = 92.4 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 55/181 (30%), Positives = 101/181 (55%)

Query: 35  LAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMY 94
                 L+D   + + +  G+ F  A++L + NK D+A ++ +K+  + +  Y  L+ M 
Sbjct: 42  GTAGKVLYDYWDDNRSSGTGDQFLAAMKLADENKNDEALAALDKLEKEGHGAYPVLARMR 101

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLS 154
            A++ V KGDT  A   F ++  D+  P AVR AA ++A  +L++  +YEE+S  +++++
Sbjct: 102 AATVQVQKGDTVAAIAAFNEIGKDNAVPAAVRDAAKMRAGWLLIENGTYEEVSAAIEEMA 161

Query: 155 EPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
            P N     A E LG++A K G + +A+  F+ +  D +SP  ++ R+ M+L  I AS +
Sbjct: 162 VPGNAFRHSAREALGLAAYKAGNMAQARQWFQSIVDDTDSPRNVANRAHMMLDLITASGK 221

Query: 215 R 215
            
Sbjct: 222 A 222


>gi|124267183|ref|YP_001021187.1| hypothetical protein Mpe_A1994 [Methylibium petroleiphilum PM1]
 gi|124259958|gb|ABM94952.1| conserved hypothetical transmembrane protein [Methylibium
           petroleiphilum PM1]
          Length = 228

 Score = 92.4 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 60/195 (30%), Gaps = 2/195 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y  +   ++++ L     F  +      +       F +  +   +   D 
Sbjct: 14  DSIKHFWKQYGNLITWVLIIALGGFAAFNGWQWMQRDRSVKASVLFDELDKAVIAGDTDK 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A   F  +  +            +A+    +    +AA   L+    + +       A L
Sbjct: 74  AARVFSDMKDRYGSTAFAGQAGLLAAKAQFEKGQNDAARASLEWVIGNASDKEYAVLARL 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L+D   Y+E  K L   ++P       A +  G      GK  +A+T ++     
Sbjct: 134 RLAGVLLDEKKYDEALKAL--PTDPPQSFAGLAADRRGDILTAQGKPAEARTAYQAAFDA 191

Query: 192 NNSPFGISTRSQMIL 206
                      +  L
Sbjct: 192 MPPTLDYRRLVEAKL 206


>gi|319406080|emb|CBI79710.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 223

 Score = 92.4 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 55/214 (25%), Positives = 115/214 (53%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + K       Y       +++ + + I + ++      K N VG+ F   L+L 
Sbjct: 10  VNEELRQEKFYTFWKRYGSFVIGAVIIFVLMIIIYQIYQQQQINKANNVGDTFITGLDLA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +++  D+A   F+ +   D   Y  L+++  AS+   +GDT  + ++F  +A D+ AP  
Sbjct: 70  DAHHFDEAIKKFKSVKKSDFGGYPFLADLREASLWTERGDTAKSVKMFDMIAADEKAPQI 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A ++AA ILVD  +++++ + +++++   +PM   A E+LG++A K  K++ A   
Sbjct: 130 LRKIAKIRAAYILVDIGTFDDVMQRVKEMANDIDPMRMSAREVLGLAAYKADKMENAVYY 189

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           F+++ ++N   F I+ R++++L  I AS + NK+
Sbjct: 190 FQKIVEENALGFKITDRAKIMLELIQASGKVNKE 223


>gi|75676212|ref|YP_318633.1| hypothetical protein Nwi_2022 [Nitrobacter winogradskyi Nb-255]
 gi|74421082|gb|ABA05281.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 217

 Score = 92.4 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 89/212 (41%), Gaps = 1/212 (0%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  D    + + K     Y  +    ++++L     +  +     +K       F  A  
Sbjct: 6   SEIDDELRRERLKKIWGQYSALIIAAVILVLVAVGGWRGYQYLQTQKAAEASSAFEAAAA 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L + NK  +A+++F K+       Y  LS +  A+          A +++  +A +    
Sbjct: 66  LADQNKHAEAQAAFAKLAETAPLGYRNLSRLRAAAEAARHD-INAAVKLYDAIATEGGFS 124

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  A ++AA++LVD+ +Y  + + L+  + P       A E+L +SA +      A+
Sbjct: 125 SVERDFARVRAAALLVDSETYNNMLQRLEPAAAPEATFRHSARELLALSAWRSDDATAAR 184

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
              + +++D+ +P  +  R++ + A +    +
Sbjct: 185 KWLDMISEDSQTPSSLRGRAEALQALLPPVAK 216


>gi|254420734|ref|ZP_05034458.1| hypothetical protein BBAL3_3044 [Brevundimonas sp. BAL3]
 gi|196186911|gb|EDX81887.1| hypothetical protein BBAL3_3044 [Brevundimonas sp. BAL3]
          Length = 248

 Score = 92.0 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 46/209 (22%), Positives = 95/209 (45%), Gaps = 1/209 (0%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
              +      + K     +  +  +++++ L  A+ ++ +D  +  K     E + + +E
Sbjct: 6   EQVEEELRSDRYKRLARTWLPVVGVILVVALVAALGWWGWDSLNSSKAAKGAEAYDRGME 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
              + K  +AR +FE+ + + N  Y  L+    A + V      +A  +F + A    + 
Sbjct: 66  ALRAEKPAEARLAFEETVKEGNDAYKVLALQQQAGLAVTADKIPDAVRLFDQ-AAKTSSD 124

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   A  +AA +++DT+   +I   L  L+E   P+H FA E L ++ L+ GK ++A+
Sbjct: 125 PILSDPAAFKAALLIMDTAPLADIEARLTPLAEDKRPLHAFAQEALALARLQHGKTKEAR 184

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIA 211
             F  L    + P  +  R+ + +A I A
Sbjct: 185 EAFVLLQLGQDVPDDVRQRANIAVATIDA 213


>gi|241205815|ref|YP_002976911.1| hypothetical protein Rleg_3116 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859705|gb|ACS57372.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 227

 Score = 92.0 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 100/181 (55%)

Query: 35  LAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMY 94
                 L+D   + + +  G+ F  A++L + NK D+A ++  K+  + +  Y  L+ M 
Sbjct: 42  GTAGKVLYDYWDDNRSSGTGDQFLAAMKLADENKNDEALAALNKLEKEGHGAYPVLARMR 101

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLS 154
            A++ V KGDT  A   F ++  D+  P AVR AA ++A  +L++  +YE++S  +++++
Sbjct: 102 AATVQVQKGDTAAAITAFNEIGKDNAVPAAVRDAAKMRAGWLLIENGTYEQVSAAIEEMA 161

Query: 155 EPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
            P N     A E LG++A K G + +A+  F+ +  D +SP  ++ R+ M+L  I AS +
Sbjct: 162 VPGNAFRHSAREALGLAAYKAGNMAQARQWFQSIVDDTDSPRNVANRAHMMLDLITASGK 221

Query: 215 R 215
            
Sbjct: 222 A 222


>gi|146278198|ref|YP_001168357.1| hypothetical protein Rsph17025_2162 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556439|gb|ABP71052.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 215

 Score = 92.0 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 31/206 (15%), Positives = 67/206 (32%), Gaps = 7/206 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WIA ++++ I+  A +       H  +    G+          +   
Sbjct: 16  RRERLFGYFRRYGWIALVIVVAIVGGAAFVEWQKAQHRAESQAFGDA-------LLAALE 68

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
               ++    +       +  +   + +     GD   A     +VA D       R  A
Sbjct: 69  APDAAARRAAVEAVPAAGDRAALRDLMAASDPAGDRAAAMAALERVAADATLSPVYRDLA 128

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L+   +        +    L  ++EP  P    A E +    ++ G+  +A      L 
Sbjct: 129 VLRRVILGGAELPVADRRAALDGIAEPGRPYRALALEQMAYLEIEAGEPARAIETLRSLT 188

Query: 190 KDNNSPFGISTRSQMILANIIASDQR 215
           +D  +P G+  R++  +  +    Q 
Sbjct: 189 QDQEAPQGLRRRAEQTITALGGGTQA 214


>gi|119385152|ref|YP_916208.1| hypothetical protein Pden_2425 [Paracoccus denitrificans PD1222]
 gi|119374919|gb|ABL70512.1| conserved hypothetical protein [Paracoccus denitrificans PD1222]
          Length = 246

 Score = 91.6 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 79/224 (35%), Gaps = 13/224 (5%)

Query: 1   MESNNDA-------NSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIV 53
           M + ND+       +  + +       Y WIA L+IL I+  A W        E +    
Sbjct: 16  MANQNDSFIDEVTEDLRRDRLFALFRRYGWIALLVILGIVGGAAWREYSSSQAETRARAW 75

Query: 54  GENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL 113
           G+    A       + DD  ++   +    +     LS M  A      G  + AAE   
Sbjct: 76  GDAIMAA------RQGDDPITALSAVDPAGSAGRKVLSEMLAAGAEAQAGLPQKAAERLK 129

Query: 114 KVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
             A        +   A L+A  +        E  ++L  LS+P  P    A E   ++ +
Sbjct: 130 AAAAGLQNDPVLHDLALLKAVMVAGPAMDAAERDRLLADLSKPGAPFELLALEQKAVALI 189

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
             G+ + A  +  ++ + +     +  R   ++  +    + ++
Sbjct: 190 GAGRTEDAVMLIGQIQQKDGLSEPLRRRLSEMMITLGVEPEPSE 233


>gi|83943021|ref|ZP_00955481.1| hypothetical protein EE36_12608 [Sulfitobacter sp. EE-36]
 gi|83846029|gb|EAP83906.1| hypothetical protein EE36_12608 [Sulfitobacter sp. EE-36]
          Length = 237

 Score = 91.2 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 77/210 (36%), Gaps = 4/210 (1%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + +       Y WIA L +++++  A W          +   +G+    AL   
Sbjct: 11  VNEEVRRDRFYFMLKRYGWIAVLAVILLVGGAAWNEYQKAQARAEAETLGDAMFAALS-- 68

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            +       ++FEKI + + +    +  +  A+     G+T  A      +  D   P  
Sbjct: 69  -AEDTAARAAAFEKIEATNPRAGA-MLGLLTAAEQAQAGETDAAVATLNGIGLDADVPAI 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A  +A ++        E    L+ L++P + +   A E L +  ++    + A   
Sbjct: 127 YREIAQFKAITLQGSDMPANERRLALENLAQPGSSLRLLAQEQLAMIDIEEDAPEAAIER 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQ 214
           ++ +  D +    +  R+  ++  +    Q
Sbjct: 187 YQGILNDADVTSDLQQRALQVIVALGGDPQ 216


>gi|83310441|ref|YP_420705.1| hypothetical protein amb1342 [Magnetospirillum magneticum AMB-1]
 gi|82945282|dbj|BAE50146.1| Uncharacterized protein [Magnetospirillum magneticum AMB-1]
          Length = 227

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 95/204 (46%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + +       +  +     L ++     +  + G   K++      +++   L 
Sbjct: 17  VDEDLRQEELNRLWKKHGGLFAAAALALVLAVAGWQGWQGWEAKQRQAASARYSETAALI 76

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              K D+A     K+ ++  K Y  L+++  A +    GD   AA ++ K+A D      
Sbjct: 77  EQGKKDEAVEVLNKLSAEGPKGYRLLADLRKADMAQQAGDFTGAAALYGKIAADTSVDKV 136

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  +T++AA +++D+     I K ++ L+  ++     A EIL ++ALK G+  +A  +
Sbjct: 137 YRDMSTIRAAYLVLDSGDVAAIEKSVEPLAAEASSWRHSAREILALAALKRGETPRAAEL 196

Query: 185 FEELAKDNNSPFGISTRSQMILAN 208
           F ++A+D  +P G+ TR+  +LA 
Sbjct: 197 FAKIAEDAAAPQGLRTRAAEMLAA 220


>gi|323138583|ref|ZP_08073651.1| Protein of unknown function DUF2133 [Methylocystis sp. ATCC 49242]
 gi|322396217|gb|EFX98750.1| Protein of unknown function DUF2133 [Methylocystis sp. ATCC 49242]
          Length = 254

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 40/213 (18%), Positives = 81/213 (38%), Gaps = 3/213 (1%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + K       Y+    ++  +I++    +  +    +K        F  A+ L 
Sbjct: 8   VDEDVRRDKAADFWRRYQTPIFVVAFLIVAATGAWSYYQDKRQKTAEAANARFEAAVALA 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           N  K  +A ++F+ I     K Y  L+         A+ D   A      +  D      
Sbjct: 68  NEGKNAEAAAAFDAIAKDGPKGYAALA---RIRAAEARPDKTQALAELNAIGEDPTVDKL 124

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           ++  A L+AA ++++    E++ + L  L   +      A E  G+ AL      +A+ +
Sbjct: 125 MQEVALLRAALLVMEGGDREKLERALGPLMTSNGAFRFSAQEWNGLDALANDDFDEAERV 184

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           FE++  D ++P  +  R+      + A     K
Sbjct: 185 FEQVLADRDAPQSMRQRASAYKGLLHAKRGPKK 217


>gi|302383645|ref|YP_003819468.1| hypothetical protein Bresu_2537 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194273|gb|ADL01845.1| Protein of unknown function DUF2133 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 267

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 43/203 (21%), Positives = 83/203 (40%), Gaps = 2/203 (0%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
              + K     +  +   ++ + L  A+ ++ +      + N     + + +E   S   
Sbjct: 13  RSERLKRLARTWLPVVGGILAVALVAALAWWGWQSFQTSQANKASVAYQRGIESLQSGDT 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             A S+F +     N  Y  L+    A + V      +A ++F   A    +   +   A
Sbjct: 73  TAAESAFAEAEKAGNGAYKALALQQRAGLAVQANRIPDAIKLFDD-AAKADSDPMLADPA 131

Query: 130 TLQAASILVDTS-SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
             +AA +L+D   +  ++   L  L+E   PM  FA E LG++ L+F K  +A+  F  L
Sbjct: 132 RYKAALLLMDNGGTLADLEARLLPLTEDDRPMRPFAQEALGLTRLQFNKPAEAREQFVLL 191

Query: 189 AKDNNSPFGISTRSQMILANIIA 211
               + P  +  R+Q  ++ I A
Sbjct: 192 TLGQDVPESVRQRAQAAISMIDA 214


>gi|114762904|ref|ZP_01442336.1| hypothetical protein 1100011001359_R2601_26321 [Pelagibaca
           bermudensis HTCC2601]
 gi|114544514|gb|EAU47521.1| hypothetical protein R2601_26321 [Roseovarius sp. HTCC2601]
          Length = 218

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 42/207 (20%), Positives = 77/207 (37%), Gaps = 4/207 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WIA LL+++++  A W    +         +G+    ALE       
Sbjct: 16  RRDRLFAAMKRYGWIAVLLVILLVGGAAWREYSNAQSRSAAQALGDEILAALEA----DE 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             AR +    +         L  M  AS      D + AA     VA +   P   R  A
Sbjct: 72  AQARVAALSEIDAPTPGAEALIAMLTASEAARAEDMEAAALSLESVAANGEVPEIYREIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           + +A S      S +E    L+ L+ P  P+   A E L +  ++ G    A+     + 
Sbjct: 132 SYKAMSQAGSGLSIDERRAGLESLAVPGKPLRLLAEEQLALLDIEAGDRLAAEERLRRIV 191

Query: 190 KDNNSPFGISTRSQMILANIIASDQRN 216
           +D+ +  G+  R+  ++  +  +   +
Sbjct: 192 EDSEATAGLRQRASQMIIALGGALDAS 218


>gi|154246484|ref|YP_001417442.1| hypothetical protein Xaut_2543 [Xanthobacter autotrophicus Py2]
 gi|154160569|gb|ABS67785.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 237

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 43/201 (21%), Positives = 88/201 (43%), Gaps = 1/201 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            + +  + + +     +  +    I++++  A  +  +     ++       F  A+ LF
Sbjct: 8   IEEDLRRERLRKLWDRFGGLIIAAIVLVVVGAAGWSGYKYWRHQQAVTASAAFQSAISLF 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           ++ K  +A ++F  +       Y  L+    A+   A+         F  +A D   P  
Sbjct: 68  DAGKFPEAEAAFAAVAKDGPAGYRTLALFRGAAAAAARDKA-AGVAAFDAIAADAGLPSL 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           VR  A L+AA ILVDT+   E+ + +  ++  + P+   A E L ++ LK G    A   
Sbjct: 127 VRELAQLRAALILVDTAGLAEVKQRVAAIAAGTGPLRNAAREALALAELKAGDAAAANKT 186

Query: 185 FEELAKDNNSPFGISTRSQMI 205
             E+  D+ +P G+ +R+++I
Sbjct: 187 ATEITSDSETPPGVRSRAELI 207


>gi|89068272|ref|ZP_01155682.1| hypothetical protein OG2516_02384 [Oceanicola granulosus HTCC2516]
 gi|89046189|gb|EAR52247.1| hypothetical protein OG2516_02384 [Oceanicola granulosus HTCC2516]
          Length = 234

 Score = 90.4 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 75/211 (35%), Gaps = 6/211 (2%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + +       Y WIA L++++I+  A W        + +   +G+    A E+ 
Sbjct: 11  VNEEVRRDRLYGYLRRYGWIAALVVVLIVGGAAWSEWSRAREQARAQELGDALLAAAEME 70

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +         +              ++ M  A      GD+  A      +A+D   P  
Sbjct: 71  D-----AEARAAALEALAPEGPAVAVAGMLAAEAQAEAGDSAAATATLAALADDPEVPPL 125

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A L+ A +L +T S  E +    +L+ P  P    A E   ++ +  G  + A   
Sbjct: 126 YRDLAALK-ALMLDETMSPAERAAAFGELARPGAPFRMVALEQQALAEVAAGDAETALDT 184

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
              + +D +    +  R+  ++  +    + 
Sbjct: 185 LARIIRDADVSQDLRDRATTLMVALGGEPET 215


>gi|121604776|ref|YP_982105.1| hypothetical protein Pnap_1874 [Polaromonas naphthalenivorans CJ2]
 gi|120593745|gb|ABM37184.1| conserved hypothetical protein [Polaromonas naphthalenivorans CJ2]
          Length = 230

 Score = 90.4 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 60/204 (29%), Gaps = 2/204 (0%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     Y  +    ++++L     +  +      +       F +      S +   
Sbjct: 14  DELKHFWKQYGNLITWALIVVLGAFAAWNGYQYWQRSQAAQASVMFDEIERAVQSGETAR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
              +   +  +            +A+         +AA   L    D  A    +  A L
Sbjct: 74  IDRALADMKERFGSTAYAQQAGLLAAKAHYDKGNVDAARAALTWVADKAADPGYQAVAKL 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A IL++  +Y+E  + +               +  G   +  GK  +AK  +E+  K 
Sbjct: 134 RLAGILLEKKAYDEALQQVSGAFPKD--FSGLVADRRGDILMAQGKKTEAKAEYEKAYKA 191

Query: 192 NNSPFGISTRSQMILANIIASDQR 215
            +         ++ L  +      
Sbjct: 192 LDERAEYRRLVEVKLNALGVDPAA 215


>gi|217976949|ref|YP_002361096.1| hypothetical protein Msil_0763 [Methylocella silvestris BL2]
 gi|217502325|gb|ACK49734.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 328

 Score = 90.4 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 84/208 (40%), Gaps = 3/208 (1%)

Query: 5   NDANSYKGKC-KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
            D +  + +  K+      W     +L++ + A W  ++   H +     G  +  AL L
Sbjct: 8   VDEDYRRERLAKIWTKYQGWFIGAAVLLVAATAGWR-IYQHFHLQAAEAAGARYEAALRL 66

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
               K  +A + F++I +   K Y  L+++     +V +     A   +  +  D     
Sbjct: 67  SQDGKSAEAEAEFKEIAASGPKGYATLAHLRAVDEIVGRD-PAAAIAAYDALGADPTFDQ 125

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           + + AA  +AA + VD    +   +    L++PS   H    E+L ++A K    + A  
Sbjct: 126 SFKEAAQTRAAVLRVDRDDPKAFEEKYGALAQPSFTYHDTIRELLALAAFKREDFEAAGR 185

Query: 184 IFEELAKDNNSPFGISTRSQMILANIIA 211
             + +  D  +P  +  R++  L  + A
Sbjct: 186 WLDMIVGDPRAPGPLRQRAEAFLGLVQA 213


>gi|283856260|ref|YP_162184.2| hypothetical protein ZMO0449 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775255|gb|AAV89073.2| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 254

 Score = 90.4 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 89/201 (44%), Gaps = 1/201 (0%)

Query: 18  KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFE 77
           +C    IA +L+++ +     +       E   +  G+  A A+            ++ +
Sbjct: 40  RCITAAIAVILLVVGVGGIGCWSYHRHKQEAINSR-GDALAAAIAPVIQGGQVKDVATLD 98

Query: 78  KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
           K+++ ++ +Y  L     A IL  KGD K+A  ++  V ND  A   +   ATL  ++I 
Sbjct: 99  KLIASNDPVYANLGRFLKAGILSDKGDVKSATALYQTVLNDPAAGDILHAVATLHLSAIE 158

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
           +DT   E + K LQ L  P +     A E+   + LK  K ++A  I++ +  D + P  
Sbjct: 159 LDTVPPENVIKRLQPLVAPGSRWLGSAGEMQAAAYLKENKPEQAVKIYQRIYSDTSVPED 218

Query: 198 ISTRSQMILANIIASDQRNKK 218
           I  R++ +  +       NK+
Sbjct: 219 IRERAKSLANSYTDIVGNNKE 239


>gi|237745513|ref|ZP_04575993.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229376864|gb|EEO26955.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 215

 Score = 90.4 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 68/210 (32%), Gaps = 2/210 (0%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K     +      +++++L     +  +     K+     + + + 
Sbjct: 1   MAYDLEEQEQLESIKAWWKKHGNWITWVLIIVLGCYAVYAYWGYYQRKQTAQASQLYYEM 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                S   + A    +    +            +A+ +  +    + A+  LK   D+ 
Sbjct: 61  QSAVLSGDSERALRVAKDTQEKFGGTAYAPMVTLVAARMAYEEKDADTAKSQLKWIVDNG 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                +  A ++ A IL+D  +Y+E  K+L        P    A +  G   +   K+ +
Sbjct: 121 KQDGYKAIARIRLAGILLDEKAYDEGMKLLS--VSFPEPFASLAEDRKGDFLVAQNKLAE 178

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  ++   +            Q+ L  I 
Sbjct: 179 ARIAYQTALEKALPDDPGKQLIQLKLEEIG 208


>gi|83954196|ref|ZP_00962916.1| hypothetical protein NAS141_17859 [Sulfitobacter sp. NAS-14.1]
 gi|83841233|gb|EAP80403.1| hypothetical protein NAS141_17859 [Sulfitobacter sp. NAS-14.1]
          Length = 237

 Score = 90.1 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 72/210 (34%), Gaps = 4/210 (1%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + +       Y WIA L +++++  A W          +   +G+    AL   
Sbjct: 11  VNEEVRRDRFYFMLKRYGWIAVLAVILLVGGAAWNEYQKAQARAEAETLGDAMFAALSAE 70

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           ++     A    E      N     +  +  A+     G+T  A      V  D   P  
Sbjct: 71  DTAARASAFEKIEA----TNPRAGAMLGLLTAAEQAQAGETDAAVATLNGVGLDADVPAI 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A  +A ++        E    L+ L++P + +   A E L +  ++    + A   
Sbjct: 127 YREIAQFKAITLQGSDMPANERRLALENLAQPGSSLRLLAQEQLAMIDIEEDAPEAAIER 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQ 214
           ++ +  D +    +  R+  ++  +    Q
Sbjct: 187 YQGILNDADVTSDLQQRALQVIVALGGDPQ 216


>gi|103487686|ref|YP_617247.1| hypothetical protein Sala_2205 [Sphingopyxis alaskensis RB2256]
 gi|98977763|gb|ABF53914.1| conserved hypothetical protein [Sphingopyxis alaskensis RB2256]
          Length = 253

 Score = 90.1 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 42/211 (19%), Positives = 82/211 (38%), Gaps = 3/211 (1%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
              D    K +       Y       +L IL     +  ++   +  +    E    AL+
Sbjct: 13  QEVDEAVRKDRLDTIMQRYGRWIIGGVLAILLAFGGYLYWNHRQDVARGEQAEELIAALD 72

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
              +N+   A S  EKI +     Y   + M +A++    GD K AA +  KVA D    
Sbjct: 73  KLEANQPRAATSELEKIAAAGTPAYRAAATMQLANVKAGAGDLKAAAALMAKVAADTQVD 132

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNP---MHQFANEILGISALKFGKVQ 179
            ++R  A ++  +   DT   E +   ++ + +  +P       A E+   +  + G+  
Sbjct: 133 RSLRDLALIRQTAFEYDTLKPEAVIARMKPIVDARDPASSWFASAAELSASAHYRLGQFD 192

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMILANII 210
           +A  ++  +AK  + P  + +RS  +   + 
Sbjct: 193 RAGALYGRIAKLPDLPKSLQSRSVQMAGMLG 223


>gi|241760998|ref|ZP_04759087.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241374617|gb|EER64078.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 254

 Score = 90.1 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 47/201 (23%), Positives = 89/201 (44%), Gaps = 1/201 (0%)

Query: 18  KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFE 77
           +C    IA +L+++ +     +       E   +  G+  A A+            ++ +
Sbjct: 40  RCITAAIAVILLVVGVGGIGCWSYHRHKQEAINSR-GDALAAAIAPVIQGGQVKDVATLD 98

Query: 78  KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
           K+++ ++ +Y  L     A +L  KGD K+A  ++  V ND  A   +   ATL  ++I 
Sbjct: 99  KLIASNDPVYANLGRFLKAGVLSDKGDVKSATALYQTVLNDPAAGDILHAVATLHLSAIE 158

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
           +DT   E + K LQ L  P +     A E+   + LK  K ++A  I++ +  D + P  
Sbjct: 159 LDTVPPENVIKRLQPLVAPGSRWLGSAGEMQAAAYLKENKPEQAVKIYQRIYSDTSVPED 218

Query: 198 ISTRSQMILANIIASDQRNKK 218
           I  R++ +  +       NK+
Sbjct: 219 IRERAKSLANSYADIVGNNKE 239


>gi|83945264|ref|ZP_00957613.1| hypothetical protein OA2633_00815 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851434|gb|EAP89290.1| hypothetical protein OA2633_00815 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 253

 Score = 90.1 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 42/206 (20%), Positives = 90/206 (43%), Gaps = 1/206 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + +       +          I+     +   + S +++ +   E +  A EL+
Sbjct: 8   VEEELRQERYNALLRKWGPWVGGAAAAIVLGVGAYQFMEWSSKQRADAASEQYQAAAELY 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            +  L  A S F+ ++    + Y  L+ M  A I +++GD + AA +F   A +      
Sbjct: 68  EAGNLLQADSQFQALVESGPRGYETLALMRRAEIALSQGDAEEAARLFN-RAGEISPEPL 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A  QAA    D  SY++++  L+ L+E + P+   A E++  +AL+  +  +A+  
Sbjct: 127 IRDLARYQAALAQFDQLSYDDLANRLEPLTEGAAPVGLLARELMAAAALRDQRWDEARQR 186

Query: 185 FEELAKDNNSPFGISTRSQMILANII 210
           ++ L+   + P  +S R     + + 
Sbjct: 187 YQLLSVALDLPQAMSQRVMQAQSYLD 212


>gi|39936160|ref|NP_948436.1| hypothetical protein RPA3097 [Rhodopseudomonas palustris CGA009]
 gi|39650015|emb|CAE28538.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 229

 Score = 90.1 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 43/211 (20%), Positives = 97/211 (45%), Gaps = 1/211 (0%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  D    + + K     Y  +     L+I+     +  ++    KK    G  FA A +
Sbjct: 17  NEVDEELRRERLKRLWDKYSLVIVGGALLIVVGVGAWRGYEYYEAKKAAEAGAAFAAAAD 76

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L   NK  +A ++F+KI +     Y  L+    A+  +   D + A + + ++A D    
Sbjct: 77  LAEQNKHAEAEAAFDKIAASAPAGYRTLA-RLRAAAEIGTRDAQAAVKRYDEIAADRSLA 135

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  A+++AA+++++T+SY ++ + L+ ++  +      A E+L +SA +   V   +
Sbjct: 136 APFRELASIRAANLVLETASYNDLVQRLEPVASGNGAFRHTARELLALSAWRANNVAATR 195

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASD 213
              +++  D  +P  + +R+ ++ A +  + 
Sbjct: 196 QWIDKITTDAETPGSLRSRADVLQALLPPTA 226


>gi|326316282|ref|YP_004233954.1| hypothetical protein Acav_1465 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323373118|gb|ADX45387.1| Protein of unknown function DUF2133 [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 221

 Score = 89.7 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/207 (10%), Positives = 66/207 (31%), Gaps = 2/207 (0%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     +  +   ++++I      +  +     ++                      
Sbjct: 14  DQLKHFWNAWGTLISGVMVVIFGGVAAWNGYQYWQNRQSGQAAALSDAVQVAVQGGDAAR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A  +F+ + S+            +A+  +      + A+  L+   D+ +    +  A+L
Sbjct: 74  ATQAFDDLKSRYGGTVQAAQAGLLAAKAMVDSGNPDGAKPILQWLADNASDEGYKAIASL 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L+D  +Y++    L    +          +  G      GK  +A   +++  K 
Sbjct: 134 RLAGLLIDQKAYDQALARLSG--KFPPQFDPMIADRKGDVLALQGKKAEAIAEYQKAYKG 191

Query: 192 NNSPFGISTRSQMILANIIASDQRNKK 218
                      ++ L ++    + + +
Sbjct: 192 LEDGTEYRRVVEVKLGSLGVQARADGE 218


>gi|167646458|ref|YP_001684121.1| TPR repeat-containing protein [Caulobacter sp. K31]
 gi|167348888|gb|ABZ71623.1| Tetratricopeptide TPR_2 repeat protein [Caulobacter sp. K31]
          Length = 254

 Score = 89.7 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 44/195 (22%), Positives = 79/195 (40%), Gaps = 3/195 (1%)

Query: 23  WIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQ 82
           W+  L  + IL  A W   +    + + N   E +  AL          +  +FE I   
Sbjct: 27  WVGALAAVAILGTAGWA-GWSSYQQNQTNKASEAYQAALVSAGKIGPAGSFPAFEAISKD 85

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSS 142
               Y  L+ + + +I +    T +A   F + A        +   A L +A  L+DT+ 
Sbjct: 86  GPPAYKTLALLQMGAIRLEADKTADAVAYFDQ-AAKLAPNPVLGDLARLNSALALLDTAP 144

Query: 143 YEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA-KDNNSPFGISTR 201
           Y+++   L  L    +P    A E L  + L+ G +  A+  F  L+   +NS   +  R
Sbjct: 145 YKDVEARLTPLMGEKSPYRVQAKEALAFAKLRAGDLAGARGDFSVLSTALDNSSEEVRQR 204

Query: 202 SQMILANIIASDQRN 216
           +Q  +A I +   ++
Sbjct: 205 AQGAIAMIDSGSAKD 219


>gi|332558126|ref|ZP_08412448.1| hypothetical protein RSWS8N_03705 [Rhodobacter sphaeroides WS8N]
 gi|332275838|gb|EGJ21153.1| hypothetical protein RSWS8N_03705 [Rhodobacter sphaeroides WS8N]
          Length = 215

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/206 (14%), Positives = 65/206 (31%), Gaps = 7/206 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WIA + ++ ++  A +          +    G+    ALE       
Sbjct: 16  RRERLFGYFRRYGWIALVAVIALVGGAAYIEWQKSQDAAESQAFGDAILTALEA------ 69

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
               ++    ++         +   +        D   +      VA +     A R  A
Sbjct: 70  -PDAAARRAAVAAIPAEGARAALRDLMVASDPAADRAASLRALEGVAANATLDPAFRDLA 128

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L+   +        +    L +++ P  P    A E +    ++ GK  +A      L 
Sbjct: 129 VLRRVILAGAEMPVADRRAALDEIAAPGRPYRTLALEQMAYLDVETGKPAEAIQTLRNLV 188

Query: 190 KDNNSPFGISTRSQMILANIIASDQR 215
           +D  +  G+  R++ ++  +    Q 
Sbjct: 189 QDQEATQGLRRRAEQMITALGGDTQA 214


>gi|86138477|ref|ZP_01057051.1| hypothetical protein MED193_05216 [Roseobacter sp. MED193]
 gi|85825002|gb|EAQ45203.1| hypothetical protein MED193_05216 [Roseobacter sp. MED193]
          Length = 223

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 71/203 (34%), Gaps = 4/203 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +  +    Y WI  L +++I+  A +              +G+    AL        
Sbjct: 16  RRDRLFVMLKRYGWIGGLAVVLIVGGAAFSEYNKAKDLAAAQTLGDEMIAALSSDEGQPR 75

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
            +A +               +  M  A  L   G  + A      VA D   PL  R+ A
Sbjct: 76  AEALNEISA----KTPGGAAVLAMLQAGALADAGQPEEAVARLQTVALDGDLPLIYRHIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           + +A  +  D+ S  E       L++P  P+   A E + +  ++ G  + A    + + 
Sbjct: 132 SFKALGLQQDSLSTAERRLQFDALAQPGAPLALLAAEQIALLDIEEGNAEAAIDRLKAIV 191

Query: 190 KDNNSPFGISTRSQMILANIIAS 212
           +D      +  R+  ++  +  +
Sbjct: 192 EDAGVTADLKERATQVIVALGGA 214


>gi|92117232|ref|YP_576961.1| hypothetical protein Nham_1684 [Nitrobacter hamburgensis X14]
 gi|91800126|gb|ABE62501.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 217

 Score = 89.3 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 45/212 (21%), Positives = 92/212 (43%), Gaps = 1/212 (0%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  D    + + K     Y  +     ++I++    +  +     +K    G  F  A  
Sbjct: 6   SEIDDELRREQVKRVWSRYSGLIVAAAILIVAAVGGWRGYLYLQTQKSAEAGSAFEAAAT 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L + NK  +A ++F K+ +     Y  LS +  A+  V +   K A +++  +A D    
Sbjct: 66  LADQNKYAEAEAAFTKLAATAPPGYRNLSRLRAAAEAVKRD-PKEAVKLYDAIAADSGFG 124

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
            A R  A ++AA +L+DT +Y  + + L+  + P       A E+L +SA +      A+
Sbjct: 125 SAERDLARVRAAGLLLDTETYNNMLQRLEPATAPQAAFRHTARELLALSAWRANDTTAAR 184

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
              + + +D  +P  + +R++ + A +    +
Sbjct: 185 KWLDMIGEDGQTPSSLRSRAEALQALLPPVAK 216


>gi|260753036|ref|YP_003225929.1| hypothetical protein Za10_0798 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258552399|gb|ACV75345.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 254

 Score = 89.3 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 47/201 (23%), Positives = 89/201 (44%), Gaps = 1/201 (0%)

Query: 18  KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFE 77
           +C    IA +L+++ +     +       E   +  G+  A A+            ++ +
Sbjct: 40  RCITAAIAVILLVVGVGSIGCWSYHRHKQEAINSR-GDALAAAIAPVIQGGQVKDVATLD 98

Query: 78  KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
           K+++ ++ +Y  L     A +L  KGD K+A  ++  V ND  A   +   ATL  ++I 
Sbjct: 99  KLIASNDPVYANLGRFLKAGVLSDKGDVKSATALYQTVLNDPAAGDILHAVATLHLSAIE 158

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
           +DT   E + K LQ L  P +     A E+   + LK  K ++A  I++ +  D + P  
Sbjct: 159 LDTVPPENVIKRLQPLVAPGSRWLGSAGEMQAAAYLKENKPEQAVKIYQRIYSDTSVPED 218

Query: 198 ISTRSQMILANIIASDQRNKK 218
           I  R++ +  +       NK+
Sbjct: 219 IRERAKSLANSYADIVGNNKE 239


>gi|126462122|ref|YP_001043236.1| hypothetical protein Rsph17029_1354 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103786|gb|ABN76464.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 215

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/206 (13%), Positives = 65/206 (31%), Gaps = 7/206 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WIA + ++ ++  A +          +    G+    ALE       
Sbjct: 16  RRERLFGYFRRYGWIALVAVIALVGGAAYIEWQKSQDAAESQAFGDAILTALEA------ 69

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
               ++    ++         +   +        D   +      VA +     A R  A
Sbjct: 70  -PDAAARRAAVAAIPAEGARAALRDLMVASDPAADRAASLRALEGVAANATLDPAFRDLA 128

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L+   +        +    L +++ P  P    A E +    ++ G+  +A      L 
Sbjct: 129 VLRRVILAGAEMPVADRRAALDEIAAPGRPYRTLALEQMAYLDVEAGRPAEAIQTLRSLV 188

Query: 190 KDNNSPFGISTRSQMILANIIASDQR 215
           +D  +  G+  R++ ++  +    Q 
Sbjct: 189 QDQEATQGLRRRAEQMITALGGDTQA 214


>gi|221066036|ref|ZP_03542141.1| conserved hypothetical protein [Comamonas testosteroni KF-1]
 gi|220711059|gb|EED66427.1| conserved hypothetical protein [Comamonas testosteroni KF-1]
          Length = 225

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 21/204 (10%), Positives = 61/204 (29%), Gaps = 3/204 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     +  +   +++++      +  +    +++            E   +     
Sbjct: 14  EQLKHFWNSWGTLITSVLVVVFLGLAGWNGWQYWQKRQATQASALEFAVDEALTAKDAAR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A  +F ++  +            + +         + A+  L    +       +  A +
Sbjct: 74  ADQAFGELRDKYAGTAQAAQTALLMAKASVDAGKFDDAKAQLSWVAEKG-DEGFKALARI 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + +S+L    SY+E  K+L+              +  G      GK  +A   ++   K 
Sbjct: 133 RLSSVLEQQKSYDEGLKVLEA--SMPESYAGLQADRRGDLYGALGKPAEAIAQYQAAYKA 190

Query: 192 NNSPFGISTRSQMILANIIASDQR 215
            +         +  L  + A+ + 
Sbjct: 191 LDKDLDYRHLVEFKLNALGAAPET 214


>gi|114569752|ref|YP_756432.1| hypothetical protein Mmar10_1201 [Maricaulis maris MCS10]
 gi|114340214|gb|ABI65494.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 261

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 41/205 (20%), Positives = 87/205 (42%), Gaps = 1/205 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    + K +     +   A    L +++ ++ +  FD      +    + F  A+   
Sbjct: 8   VDEELRRDKYQDLLRQWGPWALGAALAVIAGSVAWQSFDAWQTGGRQTASDAFIAAMTHS 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            S +L  A +  E +       Y  L+ +   ++ + +GD   A   F + A        
Sbjct: 68  ESGELALAAAGLETLAENGTPGYVSLALIQRGNVAIEQGDNAAATGFFEQAAAQAS-DPL 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A ++A     D+ S+ +I   L +L    +P    A E +  +AL+   +++A+T 
Sbjct: 127 LRDMAEIRAVWSSWDSLSFSDIDLRLSRLVNADSPYRHIARETIAAAALRADNIERARTQ 186

Query: 185 FEELAKDNNSPFGISTRSQMILANI 209
           ++ L+  +++P G+  R+Q  +A I
Sbjct: 187 YQFLSFSSDAPAGVQRRAQEAMALI 211


>gi|159043713|ref|YP_001532507.1| hypothetical protein Dshi_1164 [Dinoroseobacter shibae DFL 12]
 gi|157911473|gb|ABV92906.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 217

 Score = 88.9 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 34/202 (16%), Positives = 65/202 (32%), Gaps = 7/202 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WI  L +++I+  A +               G+    ALE       
Sbjct: 16  RRDRMSRLMRKYGWIGVLAVVLIVGGAAFNEYRKAQEIAAAQAFGDAVYDALE-----GS 70

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
            +             ++  PL    + +   + GD   AAEI   V  D   P   +  A
Sbjct: 71  SEQTRLLALQEVNAPEVGAPLLG--LITAAESTGDPAEAAEILQSVITDPETPPIYQDLA 128

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L+   +        E   +L  L   S P    A E   +  ++ G+ + A    +E+ 
Sbjct: 129 RLRLVLLGDAALPATERRALLDMLILGSGPFRLLALEQRALLEVEAGETEAAIATLQEVI 188

Query: 190 KDNNSPFGISTRSQMILANIIA 211
           +   +      R+  ++  +  
Sbjct: 189 RAAGASLAQQQRAAQLVVALGG 210



 Score = 36.5 bits (82), Expect = 2.7,   Method: Composition-based stats.
 Identities = 16/105 (15%), Positives = 31/105 (29%), Gaps = 3/105 (2%)

Query: 114 KVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
                  A       A   A    ++ SS +        L E + P        L  +A 
Sbjct: 43  AFNEYRKAQEIAAAQAFGDAVYDALEGSSEQTRL---LALQEVNAPEVGAPLLGLITAAE 99

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
             G   +A  I + +  D  +P      +++ L  +  +     +
Sbjct: 100 STGDPAEAAEILQSVITDPETPPIYQDLARLRLVLLGDAALPATE 144


>gi|260575152|ref|ZP_05843153.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259022774|gb|EEW26069.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 215

 Score = 88.9 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 39/207 (18%), Positives = 70/207 (33%), Gaps = 7/207 (3%)

Query: 7   ANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNS 66
               + +       Y WI  LL+++++  A +      S        G+    ALE  + 
Sbjct: 13  DEVRRDRLFATFRKYGWIGILLVVLVVGGAAFSEWNKASKRAAAQAFGDAVLAALEAPD- 71

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
                AR +    +         L+ M  +     +     A     KVA D   P+A R
Sbjct: 72  ---PAARRAALAAVPASGDRAAILNLMLASDPATDR---AGALAALDKVAADTTLPVAYR 125

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             A L+   +     +  +    L  ++ P  P    A E L    ++ G    A T  +
Sbjct: 126 DLAVLRRVVLAGADMAVADRRAALDPIAAPGRPFRPLALEQLAYLQIEAGDTAAAITALQ 185

Query: 187 ELAKDNNSPFGISTRSQMILANIIASD 213
            L  D  +P G+  R+  ++  +    
Sbjct: 186 ALTVDQEAPSGLRQRAVQVIVALGGDA 212


>gi|74316614|ref|YP_314354.1| hypothetical protein Tbd_0596 [Thiobacillus denitrificans ATCC
           25259]
 gi|74056109|gb|AAZ96549.1| putative membrane protein [Thiobacillus denitrificans ATCC 25259]
          Length = 213

 Score = 88.9 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 25/211 (11%), Positives = 72/211 (34%), Gaps = 2/211 (0%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           + D      + K     +  ++ + + ++++ A  +  +      +       + Q    
Sbjct: 5   DLDEQERLDELKAWWKRWGSVSMIGLAVLIAAAAGWRYWQNRTVTQSLEAAAVYDQLARS 64

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             +N++  AR +   ++ +            + + L        +A+  L+ A       
Sbjct: 65  VAANEVKGAREAGAMLIDKYKDTAYAPRAALLLARLNVGAKDAKSAQTQLEWAASHSKEP 124

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+R  A L+ A++ +D   Y+   K L      S+      +++ G   +   K   A+ 
Sbjct: 125 AIRDLARLRLAAVQLDQKQYDVALKTLAA--RHSDAFGPRFDDLRGDVLVAQNKPADARK 182

Query: 184 IFEELAKDNNSPFGISTRSQMILANIIASDQ 214
            ++      ++        ++ L  +    +
Sbjct: 183 AYQAALGAMSADNPYRNVVELKLDGVGGEAK 213


>gi|192291878|ref|YP_001992483.1| hypothetical protein Rpal_3507 [Rhodopseudomonas palustris TIE-1]
 gi|192285627|gb|ACF02008.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 218

 Score = 88.5 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 43/211 (20%), Positives = 97/211 (45%), Gaps = 1/211 (0%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  D    + + K     Y  +     L+I+     +  ++    KK    G  FA A +
Sbjct: 6   NEVDEELRRERLKRLWDKYSLVIVGGALLIVVGVGAWRGYEYYEAKKAAEAGAAFAAAAD 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L   NK  +A ++F+KI +     Y  L+    A+  +   D + A + + ++A D    
Sbjct: 66  LAEQNKHAEAEAAFDKIAASAPAGYRTLA-RLRAAAEIGTRDAQAAVKRYDEIAADRSLA 124

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  A+++AA+++++T+SY ++ + L+ ++  +      A E+L +SA +   V   +
Sbjct: 125 APFRELASIRAANLVLETASYNDLVQRLEPVASGNGAFRHTARELLALSAWRANNVAATR 184

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASD 213
              +++  D  +P  + +R+ ++ A +  + 
Sbjct: 185 QWIDKITTDAETPGSLRSRADVLQALLPPTA 215


>gi|221639111|ref|YP_002525373.1| hypothetical protein RSKD131_1012 [Rhodobacter sphaeroides KD131]
 gi|221159892|gb|ACM00872.1| Hypothetical Protein RSKD131_1012 [Rhodobacter sphaeroides KD131]
          Length = 215

 Score = 88.5 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 29/206 (14%), Positives = 65/206 (31%), Gaps = 7/206 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WIA + ++ ++  A +          +    G+    ALE       
Sbjct: 16  RRERLFGYFRRYGWIALVAVIALVGGAAYIEWQKSQDAAESQAFGDAILTALEA------ 69

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
               ++    ++         +   +        D   +      VA +     A R  A
Sbjct: 70  -PDAAARRAAVAAIPAEGARAALRDLMVASDPAADRAASLRALEGVAANAALDPAFRDLA 128

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L+   +        +    L +++ P  P    A E +    ++ GK  +A      L 
Sbjct: 129 VLRRVILAGAEMPVADRRAALDEIAAPGRPYRTLALEQMAYLDVEAGKPAEAIQTLRNLV 188

Query: 190 KDNNSPFGISTRSQMILANIIASDQR 215
           +D  +  G+  R++ ++  +    Q 
Sbjct: 189 QDQEATQGLRRRAEQMITALGGDTQA 214


>gi|315499683|ref|YP_004088486.1| hypothetical protein Astex_2696 [Asticcacaulis excentricus CB 48]
 gi|315417695|gb|ADU14335.1| hypothetical protein Astex_2696 [Asticcacaulis excentricus CB 48]
          Length = 243

 Score = 88.5 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 42/191 (21%), Positives = 87/191 (45%), Gaps = 1/191 (0%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
               + + L  A+ F+ +      + +   E +  A E    N    A++ F+K++    
Sbjct: 28  VGGALAVALIGALGFWGYTSWDASRVSKASEAYVAAQEALTKNDKAAAKADFQKVVDAGA 87

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             Y  L+   +A + V    T  A ++ L+ A+   +   +   ATL+A  +++D +S+E
Sbjct: 88  PGYKALALSQLAGLAVEDNKTDEAVKL-LEEASKTSSDPLIADLATLKATFLIMDKASFE 146

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
           ++ K L  L++   P    A E L ++ ++ G +Q A+   + LA   ++   +  R+QM
Sbjct: 147 DVEKRLTPLTKEGRPYAPLAKEALAMAKIQKGDIQGARGDLQALAFSLDASDPLKQRAQM 206

Query: 205 ILANIIASDQR 215
            +A I +    
Sbjct: 207 AVALIDSGGAE 217


>gi|307132058|ref|YP_003884074.1| hypothetical protein Dda3937_03707 [Dickeya dadantii 3937]
 gi|306529587|gb|ADM99517.1| conserved protein [Dickeya dadantii 3937]
          Length = 206

 Score = 88.1 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 72/211 (34%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +  N      +           + +++ +   + +  +    E         + Q 
Sbjct: 1   MEVYSTENEQVEAIRRFFIENGKALAIGVVLGIGALVGWRFWQNHQESNAMAASAAYQQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E  ++   +    + EK ++ D+  Y  L+++ +A   V K D   A +   +  +   
Sbjct: 61  TESLSAGTPEGVAGA-EKFVTGDHGNYGALASLALAHQFVEKNDIAKAEQQLRQALSQ-S 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A +L+     +E  K L  +            ++ G      G  Q 
Sbjct: 119 KDGDLQALINLRLARVLLQQKKPDEALKTLDAIKLEG--WTAMVADVRGDVLASKGDNQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +         G+ +  ++ L N+ +
Sbjct: 177 ARDAYNKGMA-AKPSQGLQSLLRIKLNNLPS 206


>gi|254466513|ref|ZP_05079924.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206687421|gb|EDZ47903.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 223

 Score = 88.1 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 40/208 (19%), Positives = 82/208 (39%), Gaps = 4/208 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +  +    Y WI  + + +I+  A +              +G+    AL++  S   
Sbjct: 16  RRDRLFLMLKRYGWIGGVAVALIVGGAAFREYNKAQERAAAEDLGDQITAALKVEGSEDQ 75

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             A ++    ++      + ++ M   + L   G T  AA     VA D   PL  R+ A
Sbjct: 76  AAALAA----VTAPGAGGHAIAAMLEVAALAEAGKTAEAAARLEAVAIDGELPLIYRHIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           + +A S+  +T S  +     + L++P  P+   A+E L +  ++ G    A     E+A
Sbjct: 132 SFKALSLQAETLSVADRRLQYEALAQPGAPLALLASEQLALLDIEDGNNDAAIARLREIA 191

Query: 190 KDNNSPFGISTRSQMILANIIASDQRNK 217
            D      +  R+  ++  +  S + + 
Sbjct: 192 ADAAVSGDLKDRASQVIVALGGSLEGDA 219


>gi|91977475|ref|YP_570134.1| hypothetical protein RPD_3007 [Rhodopseudomonas palustris BisB5]
 gi|91683931|gb|ABE40233.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 217

 Score = 88.1 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 48/212 (22%), Positives = 97/212 (45%), Gaps = 1/212 (0%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  D    + + K     Y        ++I++    +  ++    KK    G  F  A +
Sbjct: 6   NEVDEEVRREQLKRLWEKYSIFIVAGAILIIAGVGAWRGYEYYEAKKAAEAGAAFTAAAD 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L   NK  +A ++F KI +  +  Y  L+    A+  VA+ D K A +++  +A D   P
Sbjct: 66  LAEQNKHAEAEAAFNKIAATTSTGYRTLA-RLRAAAEVAQRDPKEAVKLYDAIAADRSVP 124

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  AT++AA +L+D++ Y ++ + L+ +S  +      A E+L +SA +   V   +
Sbjct: 125 AQDRDLATIRAAQLLMDSAGYTDLQQRLEPISGANGAYRHTAREMLALSAWRANNVAATR 184

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
              E +  D  +P  +  R++++ A +  + +
Sbjct: 185 QWIEMINTDAETPASLRNRAEVLQALLPPAAK 216


>gi|254474487|ref|ZP_05087873.1| conserved hypothetical protein [Ruegeria sp. R11]
 gi|214028730|gb|EEB69565.1| conserved hypothetical protein [Ruegeria sp. R11]
          Length = 223

 Score = 88.1 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 34/205 (16%), Positives = 77/205 (37%), Gaps = 4/205 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +  +    Y WI  + + +I+  A +        +     +G+    AL+  +S   
Sbjct: 16  RRDRLFLMLKRYGWIGGVAVALIVGGAAYREYDRAQTQAAAEQLGDQMIAALDSDDSAAR 75

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
            +A S         +   + +  +  A  L   G+   A      +  +   PL  R+ A
Sbjct: 76  AEALSQITA----GSAGGDTVLKLLQAGALADAGERDAAIAALNAIGGNGDVPLIYRHIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           T +A  +  D+    +     + L++P  P+   A E L +  ++ GK ++A +   ++ 
Sbjct: 132 TFKALGLQQDSLPAADRRIQFEALAQPGAPLDLLAREQLALIDIEEGKTEEAISKLRDII 191

Query: 190 KDNNSPFGISTRSQMILANIIASDQ 214
                   +  R+  ++  +  S Q
Sbjct: 192 NAATVTSDLQDRASQVIVALGGSLQ 216


>gi|146340693|ref|YP_001205741.1| hypothetical protein BRADO3744 [Bradyrhizobium sp. ORS278]
 gi|146193499|emb|CAL77515.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 217

 Score = 87.7 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 90/210 (42%), Gaps = 1/210 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    + + K     Y      + ++I++    +  +     +K    G  F +ALEL 
Sbjct: 8   VDEEVRREQLKKLWDRYSIFIIAVAVLIIAGVGGWRGYQYLEAQKAAEAGAAFNKALELS 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             NK  +A  +F  + +     Y  L+  + A+    +     A +++  +A D      
Sbjct: 68  EQNKHAEAEKAFADVAATAPSGYRMLARFHQAAEAAVRDKAA-AVKLYDDLAADRGIGAE 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            +  A L+AA +LVDT+ Y ++   L+  +    P    A E+L +SA K      A+  
Sbjct: 127 QQSMARLRAAGLLVDTAPYADLKPRLEGETAAGAPFRHAARELLALSAWKANDAAAARQW 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQ 214
            + +A D  +P G+ +R++ + A + A  +
Sbjct: 187 LDMIALDGETPPGLRSRAEALQALLPAVAK 216


>gi|114332131|ref|YP_748353.1| hypothetical protein Neut_2166 [Nitrosomonas eutropha C91]
 gi|114309145|gb|ABI60388.1| conserved hypothetical protein [Nitrosomonas eutropha C91]
          Length = 212

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/207 (12%), Positives = 70/207 (33%), Gaps = 3/207 (1%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +      + K           L I++  ++ +   L++    ++     + +    + 
Sbjct: 5   NFEEQEKIDRLKAWWSANGATLLLTIVVFAAVVVGTRLWNHYKGEQARQAADLYTVLQQQ 64

Query: 64  FNSN-KLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
                + +    + + ++              IA+    +     +A   L+   D    
Sbjct: 65  VEKGSEFEKITDAAQLLIQGFPGSGYASRAALIAAHSAVQAGNNQSARDMLQWVLDHTEE 124

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             V+  A ++ A++LVD   Y++   +L    +          ++ G +    GK+ +A+
Sbjct: 125 PEVKDLARIRLANVLVDEGKYDQALSLLNA--QHGASFTGLYADLRGDALAASGKIDEAR 182

Query: 183 TIFEELAKDNNSPFGISTRSQMILANI 209
             +++     ++        QM L  +
Sbjct: 183 AAYQKALDSLDTQGAYRNVVQMKLDAL 209


>gi|307729251|ref|YP_003906475.1| hypothetical protein BC1003_1206 [Burkholderia sp. CCGE1003]
 gi|307583786|gb|ADN57184.1| Protein of unknown function DUF2133 [Burkholderia sp. CCGE1003]
          Length = 209

 Score = 87.4 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/207 (13%), Positives = 60/207 (28%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +      ++L+ L  A  +  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWTQWGNATTWIVLVALVAAAGWNGWNFWQRRQAAEAAVLYDQVQQAVA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           S            +  + ++          A+  +     +  A+  L+   D       
Sbjct: 65  SGDKAKIARVAADMEDKFSRTAYAQMTALAAAKALYAAGDEGGAKAQLQWTIDHAKDDEF 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y++   +L +    S P         G      GK   A+  +
Sbjct: 125 KQVAKLRLASLLLDEKAYDQGLALLAE--PQSEPFKGIVANGRGDLLAAQGKRDDARAAY 182

Query: 186 EELAKDNNSPFGI-STRSQMILANIIA 211
           +                 Q  L  +  
Sbjct: 183 KLALDALPKNDTSTRQLIQFKLDALGG 209


>gi|264679421|ref|YP_003279328.1| hypothetical protein CtCNB1_3286 [Comamonas testosteroni CNB-2]
 gi|262209934|gb|ACY34032.1| conserved hypothetical protein [Comamonas testosteroni CNB-2]
          Length = 225

 Score = 87.4 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/204 (10%), Positives = 63/204 (30%), Gaps = 3/204 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     +  +   +++++      +  +    +++            E   +     
Sbjct: 14  EQLKHFWNSWGTLITSVLVVVFLGLAGWNGWQYWQKRQATQASALEFAVDEALTAKDAAR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A  +F ++  +            + +    +    + A+  L    D     + +  A +
Sbjct: 74  ADQAFSELRDKYAGTAQAAQTALLMAKASVEAGKLDDAKAQLSWVADKG-DESFKALARI 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + +S+L    SY+E  K+L+              +  G   +  GK  +A   ++   K 
Sbjct: 133 RLSSVLEQQKSYDEGLKVLEA--AMPESYAGLQADRRGDLYVALGKQAEAVAQYQAAYKA 190

Query: 192 NNSPFGISTRSQMILANIIASDQR 215
            +         +  L  +  + + 
Sbjct: 191 LDKDLDYRHLVEFKLNALGVAPEA 214


>gi|77463248|ref|YP_352752.1| hypothetical protein RSP_2697 [Rhodobacter sphaeroides 2.4.1]
 gi|77387666|gb|ABA78851.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 215

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 65/206 (31%), Gaps = 7/206 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WIA + ++ ++  A +          +    G+       L      
Sbjct: 16  RRERLFGYFRRYGWIALVAVIALVGGAAYIEWQKSQDAAESQAFGDA-----ILAALEAP 70

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
           D A                 L ++ +AS   A      +      VA +     A R  A
Sbjct: 71  DAAARRAAVAAIPAEGARAALRDLMVASDPAADR--AASLRALEGVAANATLDPAFRDLA 128

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L+   +        +    L +++ P  P    A E +    ++ GK  +A      L 
Sbjct: 129 VLRRVILAGAEMPVADRRAALDEIAAPGRPYRTLALEQMAYLDVEAGKPAEAIQTLRNLV 188

Query: 190 KDNNSPFGISTRSQMILANIIASDQR 215
           +D  +  G+  R++ ++  +    Q 
Sbjct: 189 QDQEATQGLRRRAEQMITALGGDTQA 214


>gi|294086066|ref|YP_003552826.1| hypothetical protein SAR116_2499 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665641|gb|ADE40742.1| hypothetical membrane associated protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 208

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/207 (20%), Positives = 71/207 (34%), Gaps = 6/207 (2%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    K + ++    Y        L+++        +     K+     + +  +L   
Sbjct: 8   IDEELKKDRAELLWARYGKYVIGACLVVVLAVGGHQGYGIYSTKQIEKAADLYHTSL--- 64

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              K DD  SS    + +    Y  L+   IA+     GD   A   +  +A D      
Sbjct: 65  ---KADDVISSLNNNVDELTDGYQMLARFQIAAAEARAGDHAAAQASYSALAEDKNIDPL 121

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            +  A L +       SS + +   L  L   +      A E      L+ GKV  AKT 
Sbjct: 122 YQQFAQLLSVMNAPADSSVQSLQDRLAPLISAAGTWQGLALEQSAGLDLQTGKVDAAKTK 181

Query: 185 FEELAKDNNSPFGISTRSQMILANIIA 211
            E++ K    P  +  R+Q +L  + A
Sbjct: 182 LEQIVKLTEIPQSLRQRAQRMLDILNA 208


>gi|296136230|ref|YP_003643472.1| Protein of unknown function DUF2133 [Thiomonas intermedia K12]
 gi|295796352|gb|ADG31142.1| Protein of unknown function DUF2133 [Thiomonas intermedia K12]
          Length = 212

 Score = 86.6 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 66/213 (30%), Gaps = 2/213 (0%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  N +      + +     +       +L +      +Y +      +       F Q 
Sbjct: 1   MSYNFEEQEQIAQMRHFWERWGTQISAGVLAVAVGFAGYYGWQWWQRSQGAKAAVVFEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                SN  D    ++  + S+              +  +        A   LK A++  
Sbjct: 61  QAALQSNSPDKIEQAWAVMQSKAPGSAYAGMAALAVAKSLHDAGKNEQAIAALKWASEHA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A  + R  A L  +++ +D   Y E  K L  + EP+       +   G  A+  G+   
Sbjct: 121 AGPSARSVARLNLSALQIDAKQYAEAIKTLADVPEPT--FAALFDIRRGDLAMLQGQRDA 178

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           A+T +E   K   +        +  L ++    
Sbjct: 179 ARTAYEAALKALPADSSQRAAVEQKLQSVGGGA 211


>gi|294340465|emb|CAZ88846.1| conserved hypothetical protein; putative TPR domain [Thiomonas sp.
           3As]
          Length = 212

 Score = 86.6 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 66/213 (30%), Gaps = 2/213 (0%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  N +      + +     +       +L +      +Y +      +       F Q 
Sbjct: 1   MSYNFEEQEQIAQMRHFWERWGTQISAGVLAVAVGFAGYYGWQWWQRNQGAKAAVVFEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                SN  D    ++  + S+              +  +        A   LK A++  
Sbjct: 61  QAAIQSNNPDKIEQAWAVMQSKAPGSAYAGMAALAVAKSLHDAGKNEQAIAALKWASEHA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A  + R  A L  +++ +D   Y E  K L  + EP+       +   G  A+  G+   
Sbjct: 121 AGPSARSVARLNLSALQIDAKQYAEAIKTLADVPEPT--FAALFDIRRGDLAMLQGQRDA 178

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           A+T +E   K   +        +  L ++    
Sbjct: 179 ARTAYEAALKALPADSSQRAAVEQKLQSVGGGA 211


>gi|299530504|ref|ZP_07043924.1| hypothetical protein CTS44_06983 [Comamonas testosteroni S44]
 gi|298721480|gb|EFI62417.1| hypothetical protein CTS44_06983 [Comamonas testosteroni S44]
          Length = 225

 Score = 86.6 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 20/204 (9%), Positives = 62/204 (30%), Gaps = 3/204 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     +  +   +++++      +  +    +++            E   +     
Sbjct: 14  EQLKHFWNSWGTLITSVLVVVFLGLAGWNGWQYWQKRQATQASALEFAVDEALTAKDAAR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A  +F ++  +            + +         + A+  L    +     + +  A +
Sbjct: 74  ADQAFSELRDKYAGTAQAAQTALLMAKASVDAGKLDDAKAQLSWVAEKG-DESFKALARI 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + +S+L    SY+E  K+L+              +  G   +  GK  +A   ++   K 
Sbjct: 133 RLSSVLEQQKSYDEGLKVLEA--AMPESYAGLQADRRGDLYVALGKQAEAVAQYQAAYKA 190

Query: 192 NNSPFGISTRSQMILANIIASDQR 215
            +         +  L  +  + + 
Sbjct: 191 LDKDLDYRHLVEFKLNALGVAPEA 214


>gi|172060770|ref|YP_001808422.1| hypothetical protein BamMC406_1721 [Burkholderia ambifaria MC40-6]
 gi|171993287|gb|ACB64206.1| conserved hypothetical protein [Burkholderia ambifaria MC40-6]
          Length = 209

 Score = 86.2 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 61/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESVKAWWARWGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +N       +   +  +  +          A+  +        A+  L+ A D       
Sbjct: 65  ANDKATMARAAADMEDKFARTPYAQMTALSAAKTLYAAGDAAGAKAQLQWAVDHARDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGVVADRRGDLLAAQGKTDDARAAY 182

Query: 186 EELAK-DNNSPFGISTRSQMILANIIA 211
           +                 Q  L  +  
Sbjct: 183 KLALDGLPQDDQSARQLVQFKLDALGG 209


>gi|330817165|ref|YP_004360870.1| hypothetical protein bgla_1g22870 [Burkholderia gladioli BSR3]
 gi|327369558|gb|AEA60914.1| hypothetical protein bgla_1g22870 [Burkholderia gladioli BSR3]
          Length = 209

 Score = 86.2 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/207 (12%), Positives = 59/207 (28%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++  +L +   +  ++     + +     +    +   
Sbjct: 5   DEQESIESVKAWWARWGNLTTWILTAVLVVVAAWNGWNFWQRHQASEASGLYEAVQQAVT 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           S        +   +  +             A+  +        A+  L+ A D       
Sbjct: 65  SGDKAKIARAAADMEDKYGGTAYAQMTALAAAKGLYMAGDSAGAKTQLQWAIDHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  SY+    +L   S+          +  G      GK   A++ +
Sbjct: 125 KQIAKLRLASLLLDEKSYDAGLALLNGTSDEG--FKGLVADRRGDLLAAQGKRDDARSAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +                 Q  L  + +
Sbjct: 183 QLALDSLPKEDQRARQLVQFKLDALGS 209


>gi|186476176|ref|YP_001857646.1| hypothetical protein Bphy_1418 [Burkholderia phymatum STM815]
 gi|184192635|gb|ACC70600.1| conserved hypothetical protein [Burkholderia phymatum STM815]
          Length = 208

 Score = 86.2 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 63/207 (30%), Gaps = 4/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +      ++L+ L  A  +  ++     +       + Q  ++  
Sbjct: 5   DEQESIESLKAWWAQWGNGVTWIVLVALVAAAGWNGWNYWQRHQAAEAAVLYDQVQQVTA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
                        +  + +           A+  +     +  A+  L+ A D       
Sbjct: 65  GTDKATITRVSTDMEDKFSGTAYAQMTALAAAKALYAAGDEPGAKAQLQWAIDHAKDDEF 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +   L++PS+       +  G      GK   A+T +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLAL---LNDPSDAFKGVVADRRGDLLAAQGKRDDARTAY 181

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +        +        Q  L  +  
Sbjct: 182 KLALDSLPKNDASARQLIQFKLDALGG 208


>gi|310815834|ref|YP_003963798.1| hypothetical protein EIO_1363 [Ketogulonicigenium vulgare Y25]
 gi|308754569|gb|ADO42498.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 216

 Score = 86.2 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 40/202 (19%), Positives = 71/202 (35%), Gaps = 5/202 (2%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y  IA ++I+++L LAIW+ +   +   +    G+    ALE     + 
Sbjct: 16  RRERLFTFFRRYGGIALIVIVVLLGLAIWYEVSRHNQTAEVRARGDALLSALEGPAEGRA 75

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                               ++    A      GD   A      VA D  AP   R  A
Sbjct: 76  SALAQI-----DAGEGAVAAVTAFLQADAAADAGDVAGAVATLDAVARDSAAPRLYRDLA 130

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           TL++A      +        L+ L   ++     A E L +  L+ G V  A++  + + 
Sbjct: 131 TLKSAITGAGVTDANLRRAALEGLVAQNSTYLSLAREQLALIDLETGNVDAARSALQAMV 190

Query: 190 KDNNSPFGISTRSQMILANIIA 211
            D  +     +R   +L  + A
Sbjct: 191 DDAATSDVQRSRIAALLEALGA 212


>gi|289666004|ref|ZP_06487585.1| hypothetical protein XcampvN_23760 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289670464|ref|ZP_06491539.1| hypothetical protein XcampmN_18748 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 212

 Score = 86.2 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/211 (13%), Positives = 70/211 (33%), Gaps = 10/211 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ++   D +    + +             IL+ L+L + +  +      +       +   
Sbjct: 3   IDDLLDEHEQGERVRSWLRKNGAGLVGGILVGLALILGWQWWQKHTNTELVEANTRYQAV 62

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +  LD A      +      +Y  L+ + +A   V  G    A     K   D  
Sbjct: 63  VKSIQAKDLDKAAKDIVALDDGKGGIYAELAALRLAKAQVDAGKNAEAI----KTLRDVP 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   ++     + A +L ++   +E  K+L      ++     + EI   + +  GK  +
Sbjct: 119 AEGELKQIVQQRLARVLTESGKPDEAIKLL------ADAQDHASLEIRADALVAQGKPDE 172

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+ ++ +     +         +  L ++  
Sbjct: 173 ARALYTKALTTVDVASPQRRLLETKLMDVGG 203


>gi|218661714|ref|ZP_03517644.1| hypothetical protein RetlI_20621 [Rhizobium etli IE4771]
          Length = 213

 Score = 85.8 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 45/181 (24%), Positives = 90/181 (49%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +     +  ++I+       LF+   + + +  G+ F  A++L 
Sbjct: 12  VNEELRSDQMKGVWRRFGRYIIVAAVLIVVGTAGKVLFEYWDDTRSSGAGDQFLAAMKLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           + NK D+A ++  K+  + +  Y  L+ M  A++   KGD   A   F ++  D+  P A
Sbjct: 72  DENKNDEALAALGKLEKEGHGAYPVLARMRAATVQAQKGDANAAITAFNEIGKDNSVPAA 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           VR AA ++A  +L++  SYE++S  +++++ P N     A E LG+++ K G + +A+  
Sbjct: 132 VRDAARMRAGWLLIENGSYEQVSAAVEEMAVPGNAFRHSAREALGLASYKAGNMAQARQW 191

Query: 185 F 185
           F
Sbjct: 192 F 192



 Score = 38.8 bits (88), Expect = 0.56,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 28/76 (36%), Gaps = 1/76 (1%)

Query: 130 TLQAASILVDTSSYEEISKILQKL-SEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
              AA  L D +  +E    L KL  E        A         + G    A T F E+
Sbjct: 63  QFLAAMKLADENKNDEALAALGKLEKEGHGAYPVLARMRAATVQAQKGDANAAITAFNEI 122

Query: 189 AKDNNSPFGISTRSQM 204
            KDN+ P  +   ++M
Sbjct: 123 GKDNSVPAAVRDAARM 138


>gi|17545936|ref|NP_519338.1| hypothetical protein RSc1217 [Ralstonia solanacearum GMI1000]
 gi|17428231|emb|CAD14919.1| putative transmembrane protein [Ralstonia solanacearum GMI1000]
 gi|299067268|emb|CBJ38465.1| conserved protein of unknown function [Ralstonia solanacearum
           CMR15]
          Length = 211

 Score = 85.8 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 21/213 (9%), Positives = 69/213 (32%), Gaps = 3/213 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K        +   +++++L     ++ +     K+       + Q 
Sbjct: 1   MAYDLEEQEQLESLKHWWRDNGNVVTWIVIVVLLALAGWFGWKNWQRKQAGEASVLYEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  ++   +  + +   +  +  +          A+  + + +    A+  L+   D  
Sbjct: 61  QKAVDAKDAEKIKRAAADMEDKFGRTAYAQMGALSAAKALYEANDAAGAKAQLQWTIDHA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                +  A L+ A +L+D  +Y++   ++    + +        +  G       K  +
Sbjct: 121 GDDEYKAVAKLRLAGLLLDEKAYDQGLALVSG--DVAPAFAALYADRRGDLLAAQNKKDE 178

Query: 181 AKTIFEELAKD-NNSPFGISTRSQMILANIIAS 212
           A+T ++   +    +        Q  L  +  +
Sbjct: 179 ARTAYKLALEKFGQADASARQIVQFKLDALGGA 211


>gi|85373405|ref|YP_457467.1| hypothetical protein ELI_02890 [Erythrobacter litoralis HTCC2594]
 gi|84786488|gb|ABC62670.1| hypothetical protein ELI_02890 [Erythrobacter litoralis HTCC2594]
          Length = 270

 Score = 85.8 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 43/177 (24%), Positives = 80/177 (45%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
           +    +  +DG  E       E    AL+   +  L     + E + + DN      + M
Sbjct: 64  AAFGGYLWWDGQREAALEQDSEVLVSALDQIEAGNLQTGTETLEPLTTSDNAGAQAAALM 123

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
             A I   +GD   AA +F +VAN+  AP A R  AT++  ++  D     E+ + L  +
Sbjct: 124 LQAGIAAQQGDLARAATLFGQVANNSDAPPAYRDLATVRQVALQFDRLEPAEVIQRLSAI 183

Query: 154 SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
           + P N     A E++ ++ L+ G    A  +F E+AK +++P  + +R++ +   + 
Sbjct: 184 AVPDNAFFGSAGELVAMAHLEKGDRAAAGKLFGEIAKSDDAPQSLRSRARQMAGMLG 240


>gi|171059547|ref|YP_001791896.1| hypothetical protein Lcho_2866 [Leptothrix cholodnii SP-6]
 gi|170776992|gb|ACB35131.1| conserved hypothetical protein [Leptothrix cholodnii SP-6]
          Length = 224

 Score = 85.8 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 61/202 (30%), Gaps = 2/202 (0%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     Y  +    ++++      +  ++     + +  G  + +      + + D 
Sbjct: 14  DQLKHFWRAYGNLITWTLVLVFGAYAAWNGWNYWQRDQASKAGGMYDEVERAVLAGEADR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A   F  +  +            + + +       +AA+  L    D          A L
Sbjct: 74  AAKVFADLKDRYPGTTFAEQAALLTAQVQFDKGQIDAAQATLAWVADKAREPEYSAGARL 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L+D   Y+E    L    +          +  G   L  GK  +A   ++   K 
Sbjct: 134 RLAGLLLDAKQYDEALARLAG--DVPPSYEALVADRRGDILLAQGKNAEAVAAYQVAFKG 191

Query: 192 NNSPFGISTRSQMILANIIASD 213
            +         +  L  + A+ 
Sbjct: 192 MDRTLDYRRLIEAKLTALGAAP 213


>gi|241662757|ref|YP_002981117.1| hypothetical protein Rpic12D_1153 [Ralstonia pickettii 12D]
 gi|240864784|gb|ACS62445.1| conserved hypothetical protein [Ralstonia pickettii 12D]
          Length = 211

 Score = 85.4 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 20/213 (9%), Positives = 67/213 (31%), Gaps = 3/213 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K        +   + +++L     ++ +     K+       + Q 
Sbjct: 1   MAYDLEEQEQIESLKHWWRDNGNVVTWVAIVVLLAVAGWFGWKNWQRKQAGEASVLYEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  +    +  + +   +  +             A+  + + +   +A+  L+   D  
Sbjct: 61  QKAVDGKDAEKIKRAATDMEDKFGGTAYAQMTALAAAKALYEANDVASAKAQLQWTVDHA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                +  A L+ A +L+D  +Y++   ++    + +        +  G       K ++
Sbjct: 121 RDDEYKALAKLRLAGLLLDEKAYDQGIALVSG--DVAPAFAGLYADRRGDLLAAQNKNEE 178

Query: 181 AKTIFEELAKD-NNSPFGISTRSQMILANIIAS 212
           A+  ++   +    +        Q  L  +  +
Sbjct: 179 ARAAYKLALEKFGPADASARQIVQFKLDALGGA 211


>gi|107029011|ref|YP_626106.1| hypothetical protein Bcen_6269 [Burkholderia cenocepacia AU 1054]
 gi|116689831|ref|YP_835454.1| hypothetical protein Bcen2424_1810 [Burkholderia cenocepacia
           HI2424]
 gi|105898175|gb|ABF81133.1| conserved hypothetical protein [Burkholderia cenocepacia AU 1054]
 gi|116647920|gb|ABK08561.1| conserved hypothetical protein [Burkholderia cenocepacia HI2424]
          Length = 209

 Score = 85.4 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/207 (13%), Positives = 60/207 (28%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +N       +   +  +             A+  +        A+  L+   D       
Sbjct: 65  ANDKATMARAAADMEDKFGSTPYAQMTALAAAKTLYAAGDAAGAKAQLQWTVDHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGLVADRRGDLLAAQGKTDDARAAY 182

Query: 186 EELAK-DNNSPFGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDGLSKDDQSARQLVQFKLDALGG 209


>gi|260221253|emb|CBA29632.1| hypothetical protein Csp_A13120 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 215

 Score = 85.4 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 19/199 (9%), Positives = 62/199 (31%), Gaps = 2/199 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     Y      L++++      +  +    +++       + +   +     +  
Sbjct: 14  DQLKHFWKQYGNAISWLLIIVFGAFAAWNGYQWWSKRQAEQASAMYEEVDRVIAGGDVAA 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A  ++  +  +              + +       + A+  L    +      +   A +
Sbjct: 74  ADRAYGDMRQRFPSTVYTQQAGLTLAKVAYLSGKPDVAQTALITVAESSVDPGLAALARI 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L++  S +  SK L               +      +  GK ++A +++++  K 
Sbjct: 134 RLAGLLIEAKSIDAASKTLDAKFPLE--FMGLVADKKADLLMAQGKAEEAVSLYKDAIKQ 191

Query: 192 NNSPFGISTRSQMILANII 210
            +         ++ LA + 
Sbjct: 192 LSERDQYRRLVEVKLAALG 210


>gi|170733170|ref|YP_001765117.1| hypothetical protein Bcenmc03_1834 [Burkholderia cenocepacia MC0-3]
 gi|206560245|ref|YP_002231009.1| hypothetical protein BCAL1882 [Burkholderia cenocepacia J2315]
 gi|254248072|ref|ZP_04941393.1| hypothetical protein BCPG_02897 [Burkholderia cenocepacia PC184]
 gi|124872848|gb|EAY64564.1| hypothetical protein BCPG_02897 [Burkholderia cenocepacia PC184]
 gi|169816412|gb|ACA90995.1| conserved hypothetical protein [Burkholderia cenocepacia MC0-3]
 gi|198036286|emb|CAR52182.1| putative membrane protein [Burkholderia cenocepacia J2315]
          Length = 209

 Score = 85.4 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 61/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +N       +   +  +             A+  +        A+  L+ A D       
Sbjct: 65  ANDKATMARAAADMEDKFGSTPYAQMTALAAAKTLYAAGDAAGAKAQLQWAVDHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGLVADRRGDLLAAQGKTDDARAAY 182

Query: 186 EELAK-DNNSPFGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDGLSKDDQSARQLVQFKLDALGG 209


>gi|37525334|ref|NP_928678.1| hypothetical protein plu1378 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784761|emb|CAE13671.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 206

 Score = 85.1 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 35/211 (16%), Positives = 82/211 (38%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      +           L +++     I +  +      +     E F + 
Sbjct: 1   MEVYTNENEQVDVIRRFFANNGKALVLGLVLGAGALIGWRYWQSHQTNQLQESAEAFERV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                ++   ++ ++ EK  S+ N  Y  +++M++A + V K +    A+ FL  A   +
Sbjct: 61  DRGLITSTK-ESHTAAEKFASETNNSYGVMAHMHLAQLAVEKNELTK-ADQFLSAATGQV 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    ++ A + +     +   K L+++    +     A +I G + +K G +  
Sbjct: 119 KNEDLQALVNIRLARVQLAEDKADAALKTLEQVK--GSGWVGVAEDIRGDALVKKGDIAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +     NSP  I +   + L N+ +
Sbjct: 177 ARAAYTKGLSS-NSPQAIKSMLNLKLNNLSS 206


>gi|171321333|ref|ZP_02910292.1| conserved hypothetical protein [Burkholderia ambifaria MEX-5]
 gi|171093390|gb|EDT38578.1| conserved hypothetical protein [Burkholderia ambifaria MEX-5]
          Length = 209

 Score = 85.1 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 61/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +N       +   +  +             A+  +        A+  L+ A D       
Sbjct: 65  ANDKATMARAAADMEDKFGSTPYAQMTALAAAKTLYAAGDAAGAKAQLQWAADHAKDEEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGLVADRRGDLLAAQGKTDDARAAY 182

Query: 186 EELAK-DNNSPFGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDGLSKDDQSARQLVQFKLDALGG 209


>gi|152980881|ref|YP_001353815.1| hypothetical protein mma_2125 [Janthinobacterium sp. Marseille]
 gi|151280958|gb|ABR89368.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 216

 Score = 85.1 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 25/200 (12%), Positives = 70/200 (35%), Gaps = 2/200 (1%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
            K     Y  +   L++++L     +  +      +    G+ + +  +   +   +  +
Sbjct: 14  LKSWWNQYGNLVTWLLIVVLGAYAAWAGWGYYQRSQATQAGQLYEELQKAVAAQDKEKVQ 73

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
            +   + ++         +   A+      +    A+  L+   D       +  A ++ 
Sbjct: 74  RAATDMEAKFAGTAYAQMSALAAAKSAFDSNDFKTAKAQLQWVIDKGQSDEYKAVAKVRL 133

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           A IL+D  +Y+E  K+L    E         ++  G   +   K+++A+  ++   +  +
Sbjct: 134 AGILLDEKAYDEGLKVLAG--EFPAQFANVVSDRKGDILVAQNKLEEARAAYQTALEKTD 191

Query: 194 SPFGISTRSQMILANIIASD 213
           +        Q+ L  I  + 
Sbjct: 192 AKNPARQLIQIKLDAIGGAA 211


>gi|187928154|ref|YP_001898641.1| hypothetical protein Rpic_1061 [Ralstonia pickettii 12J]
 gi|309782319|ref|ZP_07677046.1| tetratricopeptide repeat protein [Ralstonia sp. 5_7_47FAA]
 gi|187725044|gb|ACD26209.1| conserved hypothetical protein [Ralstonia pickettii 12J]
 gi|308918937|gb|EFP64607.1| tetratricopeptide repeat protein [Ralstonia sp. 5_7_47FAA]
          Length = 211

 Score = 85.1 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 20/213 (9%), Positives = 66/213 (30%), Gaps = 3/213 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K        +   + +++L     ++ +     K+       + Q 
Sbjct: 1   MAYDLEEQEQIESLKHWWRDNGNVVTWVAIVVLLAVAGWFGWKNWQRKQAGEASVLYEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  +    +  + +   +  +             A+  + + +   +A+  L+   D  
Sbjct: 61  QKAVDGKDAEKIKRAATDMEDKFGGTAYAQMTALAAAKALYEANDVASAKAQLQWTVDHA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                +  A L+ A +L+D  +Y++   ++    + +        +  G       K + 
Sbjct: 121 RDDEYKALAKLRLAGLLLDEKAYDQGIALVSG--DVAPAFAGLYADRRGDLLAAQNKNED 178

Query: 181 AKTIFEELAKD-NNSPFGISTRSQMILANIIAS 212
           A+  ++   +    +        Q  L  +  +
Sbjct: 179 ARAAYKLALEKFGPADASARQIVQFKLDALGGA 211


>gi|115351799|ref|YP_773638.1| hypothetical protein Bamb_1748 [Burkholderia ambifaria AMMD]
 gi|115281787|gb|ABI87304.1| conserved hypothetical protein [Burkholderia ambifaria AMMD]
          Length = 209

 Score = 84.7 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 62/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESVKAWWARWGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +N       +   +  +  +          A+  +        A+  L+ A D       
Sbjct: 65  ANDKATMARAAADMEDKFARTPYAQMTALSAAKTLYAAGDAAGAKAQLQWAVDHARDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGVVADRRGDLLAAQGKTDDARAAY 182

Query: 186 EELAK-DNNSPFGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDGLSKDDQSARQLVQFKLDALGG 209


>gi|238758837|ref|ZP_04620010.1| hypothetical protein yaldo0001_24180 [Yersinia aldovae ATCC 35236]
 gi|238702945|gb|EEP95489.1| hypothetical protein yaldo0001_24180 [Yersinia aldovae ATCC 35236]
          Length = 206

 Score = 84.7 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 27/211 (12%), Positives = 69/211 (32%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +              + QA
Sbjct: 1   MEVYTTENDQVDAVRRFFSENGKALAVGVVLGIGALVGWRYWQSHQNTAMTEASSAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                +N  D    + + +    N  Y  L+ + +A   V +G+   A +   +      
Sbjct: 61  SNALLANSADGVAIAEKFVQGNKN-NYGVLAGLELAHHFVEQGEFDKATQQLSQALGQTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     ++  K L  +    +     A ++ G + L  G +  
Sbjct: 120 -DENLLSLINLRLARVQLQLKKPDQALKTLDAV--QGDGWTAMAQDVRGDALLSKGDIAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +  +  N+   +    +M L N+ +
Sbjct: 177 ARAAYSKGVES-NASQALQALLRMKLNNLSS 206


>gi|170702837|ref|ZP_02893686.1| conserved hypothetical protein [Burkholderia ambifaria IOP40-10]
 gi|170132255|gb|EDT00734.1| conserved hypothetical protein [Burkholderia ambifaria IOP40-10]
          Length = 209

 Score = 84.7 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 64/207 (30%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESVKAWWARWGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +N       +   +  +  +          A+  +        A+  L+ A D       
Sbjct: 65  ANDKATMARAAADMEDKFARTPYAQMTALSAAKTLYAAGDAAGAKAQLQWAVDHARDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +      ++  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGVVSDRRGDLLAAQGKTDDARAAY 182

Query: 186 EELAK-DNNSPFGISTRSQMILANIIA 211
           +      + +        Q  L  +  
Sbjct: 183 KLALDGLSQNDQSARQLVQFKLDALGG 209


>gi|163736773|ref|ZP_02144192.1| hypothetical protein RGBS107_16616 [Phaeobacter gallaeciensis
           BS107]
 gi|161390643|gb|EDQ14993.1| hypothetical protein RGBS107_16616 [Phaeobacter gallaeciensis
           BS107]
          Length = 223

 Score = 84.7 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 33/203 (16%), Positives = 75/203 (36%), Gaps = 4/203 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WI  + +++I+  A          E     +G+    AL+   S+  
Sbjct: 16  RRDRLFKMLKRYGWIGGIAVVLIVGGAALREYNRAQTEAASQALGDQMIAALD---SDDS 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
               ++ + I ++       L  +   ++    GD   A E    VA +   PL  R+ A
Sbjct: 73  AARATALDAITAETAGGDTVLKLLQAGAL-ADAGDRAAAVERLNAVARNGEMPLIYRHIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           T +A  +  ++    +     + L++P  P+   A E L +  ++      A +  +E+ 
Sbjct: 132 TFKALGLQQESLPAADRRIQFEALAQPGAPLALLAQEQLALIDIEEDNTDAAISRLQEII 191

Query: 190 KDNNSPFGISTRSQMILANIIAS 212
                   +  R+  ++  +  +
Sbjct: 192 ASAGVTSDLKDRASQVIVALGGA 214


>gi|120610113|ref|YP_969791.1| hypothetical protein Aave_1426 [Acidovorax citrulli AAC00-1]
 gi|120588577|gb|ABM32017.1| conserved hypothetical protein [Acidovorax citrulli AAC00-1]
          Length = 221

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/207 (11%), Positives = 67/207 (32%), Gaps = 2/207 (0%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     +  +   ++++I      +  +     ++                      
Sbjct: 14  DQLKHFWNAWGTLISGVLVVIFGGVAAWNGYHYWQNQQAGQAAALSDAVQVAVQGGDAAR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A  +F+ + S+            +A+  +      + A+  L+   D+ +    +  A+L
Sbjct: 74  ATQAFDDLKSRYGGTVQAAQAGLLAAKAMVDSGNPDGAKPILQWLADNASDDGYKAIASL 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + +S+L+D  +Y+E    L    +          +  G      GK  +A   +++  K 
Sbjct: 134 RLSSLLIDQKAYDEALSRLSG--KFPPQFDPMIADRKGDVLALQGKKAEAIAEYQKAYKG 191

Query: 192 NNSPFGISTRSQMILANIIASDQRNKK 218
                      ++ L ++    + + +
Sbjct: 192 LEDGTEYRRVVEVKLGSLGVQARADGE 218


>gi|303257592|ref|ZP_07343604.1| tetratricopeptide repeat protein [Burkholderiales bacterium 1_1_47]
 gi|330999633|ref|ZP_08323342.1| tetratricopeptide repeat protein [Parasutterella excrementihominis
           YIT 11859]
 gi|302859562|gb|EFL82641.1| tetratricopeptide repeat protein [Burkholderiales bacterium 1_1_47]
 gi|329574139|gb|EGG55715.1| tetratricopeptide repeat protein [Parasutterella excrementihominis
           YIT 11859]
          Length = 211

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/199 (13%), Positives = 65/199 (32%), Gaps = 1/199 (0%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
            K     +  +   ++ +    A  F  +     K+    G  +AQ ++  N       +
Sbjct: 14  IKAWWEKWGNLILTVVTVACLCAAGFQGWRWYQMKESTDAGVLYAQMIQASNMKDEARVQ 73

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
           +   ++               +A+           AE  LK   D      ++  A+++ 
Sbjct: 74  AIAGRLHESYASTTYAGMGALLAAHNAETAGKYAEAEKALKWIVDSDKYPELKPLASVRL 133

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           A + +D   Y++   +L  + +          + +G   L  G V  A+  +E+  +   
Sbjct: 134 AGVYLDEGKYDQGLTVLNAVKDAKGEEVPVY-DRMGDLYLAKGDVAAARKSWEDALRHAP 192

Query: 194 SPFGISTRSQMILANIIAS 212
               +    ++ L ++   
Sbjct: 193 MTNPLVGVIEIKLNSLPKE 211


>gi|163743208|ref|ZP_02150590.1| hypothetical protein RG210_14945 [Phaeobacter gallaeciensis 2.10]
 gi|161383625|gb|EDQ08012.1| hypothetical protein RG210_14945 [Phaeobacter gallaeciensis 2.10]
          Length = 223

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/203 (16%), Positives = 76/203 (37%), Gaps = 4/203 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WI  + +++I+  A          E     +G+    AL+   S+  
Sbjct: 16  RRDRLFKMLKRYGWIGGIAVVLIVGGAALREYNRAQTEAASQALGDQMIAALD---SDDS 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
               ++ + I ++       L  +   ++    GD   A E    VA +   PL  R+ A
Sbjct: 73  AARATALDAITAETAGGDTVLKLLQAGAL-ADAGDRAAAVERLNAVARNGEMPLIYRHIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           T +A  +  ++    +     + L++P  P+   A E L +  ++    + A +  +E+ 
Sbjct: 132 TFKALGLQQESLPAADRRIQFEALAQPGAPLALLAQEQLALIDIEEDNTEAAISRLQEII 191

Query: 190 KDNNSPFGISTRSQMILANIIAS 212
                   +  R+  ++  +  +
Sbjct: 192 ASAGVTSDLKDRASQVIVALGGA 214


>gi|149913924|ref|ZP_01902456.1| hypothetical protein RAZWK3B_18013 [Roseobacter sp. AzwK-3b]
 gi|149812208|gb|EDM72039.1| hypothetical protein RAZWK3B_18013 [Roseobacter sp. AzwK-3b]
          Length = 224

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/202 (18%), Positives = 70/202 (34%), Gaps = 5/202 (2%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WIA LL+L+++    W         +   + G+    ALE  + +  
Sbjct: 19  RRDRLFGLMRRYGWIAVLLVLLLVGGTAWNEWRKAQERQTAQVFGDAVLAALEADSRDAR 78

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             A S  E            +    +A+   +    + AA   + +A         R  A
Sbjct: 79  AAALSGVEA-----PNPGAAVMRDLLAAAEASDATPQEAASRLMALAESSGIEPVYRQIA 133

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           TL+A ++     S E+    L+ L+         A E L +  ++ G    A      + 
Sbjct: 134 TLKAVAMPDSGLSVEDRRTRLEGLALAEGLTRLLAEEQLAMIDIETGDTGAALERLVAIV 193

Query: 190 KDNNSPFGISTRSQMILANIIA 211
            D  S  G+  R+  ++  +  
Sbjct: 194 GDAQSTPGLRRRASQVIVALGG 215


>gi|115525348|ref|YP_782259.1| hypothetical protein RPE_3347 [Rhodopseudomonas palustris BisA53]
 gi|115519295|gb|ABJ07279.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 217

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 47/199 (23%), Positives = 93/199 (46%), Gaps = 1/199 (0%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  D +  + + K     Y  +     ++I++    +  +     KK    G  F  A +
Sbjct: 6   NEVDEDLRREQLKKLWDRYSLLIIACAVLIIASVGGWRGYQYFEAKKAAEAGAAFNAAAD 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L   NK  +A ++F K+++     Y  L+ + +A+ + A+  T   A+ F ++A D   P
Sbjct: 66  LAEQNKHAEAEAAFAKLMATAPSGYRTLARLRLAAEIAARDTTA-GAKAFDEIAADSAVP 124

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  A L+AA++L++T+SY ++ + L+  +  +      A E+L +SA + G    A+
Sbjct: 125 AVDREVAKLRAATLLLETASYPDMVQRLEPSAAATGTFRHSARELLALSAWRTGDAAAAR 184

Query: 183 TIFEELAKDNNSPFGISTR 201
              E +A D  +P  +  R
Sbjct: 185 KWLELIATDAETPSSLRQR 203


>gi|254252259|ref|ZP_04945577.1| hypothetical protein BDAG_01479 [Burkholderia dolosa AUO158]
 gi|124894868|gb|EAY68748.1| hypothetical protein BDAG_01479 [Burkholderia dolosa AUO158]
          Length = 209

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 61/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +N       +   +  +             A+ ++        A+  L+ A D       
Sbjct: 65  ANDKTTMARAAADMEDKYGSTAYAQMTALAAAKVLYAAGDSAGAKAQLQWAVDHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGLVADRRGDLLAAQGKTDDARAAY 182

Query: 186 EELAK-DNNSPFGISTRSQMILANIIA 211
           +                 Q  L  +  
Sbjct: 183 KLALDGLPKDDQSARQLVQFKLDALGG 209


>gi|323526576|ref|YP_004228729.1| hypothetical protein BC1001_2252 [Burkholderia sp. CCGE1001]
 gi|323383578|gb|ADX55669.1| Protein of unknown function DUF2133 [Burkholderia sp. CCGE1001]
          Length = 209

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/207 (13%), Positives = 63/207 (30%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +      ++L++L  A  +  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWTQWGNATTWIVLVVLVTAAAWNGWNFWQRREAAEAAVLYDQVQQAVA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           S            +  + ++          A+  +     +  A+  L+   D       
Sbjct: 65  SGDKAKVSRVAADMEDKFSRTAYAQMTALGAAKALYAAGDEAGAKAQLQWTIDHAKDDEF 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y++   +L +    S+          G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDQGLALLAE--PQSDAFKGIVANGRGDLLAAQGKRDDARAAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +   +    S        Q  L  +  
Sbjct: 183 KLALESLPKSDSSERQLIQFKLDALGG 209


>gi|218701023|ref|YP_002408652.1| hypothetical protein ECIAI39_2714 [Escherichia coli IAI39]
 gi|300940236|ref|ZP_07154834.1| conserved hypothetical protein [Escherichia coli MS 21-1]
 gi|218371009|emb|CAR18837.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|300454932|gb|EFK18425.1| conserved hypothetical protein [Escherichia coli MS 21-1]
          Length = 206

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAATQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|289207921|ref|YP_003459987.1| hypothetical protein TK90_0736 [Thioalkalivibrio sp. K90mix]
 gi|288943552|gb|ADC71251.1| Protein of unknown function DUF2133 [Thioalkalivibrio sp. K90mix]
          Length = 204

 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/201 (13%), Positives = 60/201 (29%), Gaps = 2/201 (0%)

Query: 7   ANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNS 66
                 + K             +++ +   I +  + G  E++     + +        +
Sbjct: 6   DEEKAERIKQWWSDNAVAIIAGLVLGIGGLIGWNWWSGHQEERAAGASDMYIAMQGAAQT 65

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
                A    ++++ Q              + L        AA   L+ A D       R
Sbjct: 66  GNNARAMELADQLIEQGRGTPYRSLAWIFRADLAVSEGDHEAAIEALRSARDAAPDRGYR 125

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
              TL+ A  ++    Y+     L  +    +       E+ G  A   G    A+  + 
Sbjct: 126 ELLTLRMARQMILAEQYDNAESALGDV--RRDAFRGLRLELEGDLARARGDRDLARERYR 183

Query: 187 ELAKDNNSPFGISTRSQMILA 207
           E     ++P  +S + + + A
Sbjct: 184 EALDHGHTPEYLSLKYEELSA 204


>gi|254503672|ref|ZP_05115823.1| hypothetical protein SADFL11_3711 [Labrenzia alexandrii DFL-11]
 gi|222439743|gb|EEE46422.1| hypothetical protein SADFL11_3711 [Labrenzia alexandrii DFL-11]
          Length = 225

 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 40/214 (18%), Positives = 80/214 (37%), Gaps = 1/214 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +    K +     +      + ++I+     +  +    + +    G+ F +A+ L 
Sbjct: 8   VDEDIRHEKYRRLWDRFGSWVIAVAVLIVVGTGGYRGWLYWQDTQSQSAGDTFLEAVSLS 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            + +  +A   + ++ S                     GD   A   F  ++ D     A
Sbjct: 68  EAGQYSEASQLYTELGSSIGGYPALAQMRQATDK-ANAGDATAALAEFDALSRDSNLAPA 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           ++  A L+AA I VD+  Y+ I+  ++ L+  ++     A E+L +SA K G  + A T 
Sbjct: 127 LQNVAALRAAYIAVDSEPYDAIADRIESLTGDTDAFRAAARELLALSAWKNGDAETALTW 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              L  D  +P  I  R  ++   I        +
Sbjct: 187 ITALEDDAETPQDIRQRVTLLGGLIRGQTGIPAE 220


>gi|323967961|gb|EGB63373.1| yfgM [Escherichia coli M863]
 gi|323977304|gb|EGB72390.1| yfgM [Escherichia coli TW10509]
 gi|327252220|gb|EGE63892.1| hypothetical protein ECSTEC7V_3068 [Escherichia coli STEC_7v]
          Length = 206

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSTRSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAATQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|89054689|ref|YP_510140.1| hypothetical protein Jann_2198 [Jannaschia sp. CCS1]
 gi|88864238|gb|ABD55115.1| hypothetical protein Jann_2198 [Jannaschia sp. CCS1]
          Length = 304

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/204 (14%), Positives = 69/204 (33%), Gaps = 6/204 (2%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       + WI  L+++ I+  A +F   +     +    G+    AL+  ++   
Sbjct: 36  RRDRLYALMRRWGWIPILVVIAIVGGAAYFEWQNAQQRAQAEAFGDALLSALDNEDTQAR 95

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             A  + +   ++   +   L+            D   AA      A            A
Sbjct: 96  VAALEAVDVPSAEAGIILALLAAGET----ANGEDRAGAAARLRAAAEAPGVARRYVDLA 151

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L+A   ++D +   E    L+ L+ P  P    A E L +  ++ G +         + 
Sbjct: 152 LLKA--EMLDPAPEAEARATLEALAAPGAPYSALAEEQLALMEVRAGDLDAGLDRLRAIE 209

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
           +   +  G+  R+  ++  + +  
Sbjct: 210 RSAAATAGLQQRAAQLIVALESGA 233


>gi|215487863|ref|YP_002330294.1| hypothetical protein E2348C_2796 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|215265935|emb|CAS10344.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
          Length = 206

 Score = 83.1 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGVLASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|221198079|ref|ZP_03571125.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221204363|ref|ZP_03577380.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221175220|gb|EEE07650.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221182011|gb|EEE14412.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 209

 Score = 83.1 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 64/207 (30%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +N       +   +  +  +          A+ ++        A+  L+ A D       
Sbjct: 65  ANDKTTIARAAADMEDKYGRTAYAQMTALSAAKVLYAAGDTAGAKAQLQWAADHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+T +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPMDAFKGLVADRRGDLLAAQGKTDDARTAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDSLSKDDQSARQLVQFKLDALGG 209


>gi|187924516|ref|YP_001896158.1| hypothetical protein Bphyt_2539 [Burkholderia phytofirmans PsJN]
 gi|187715710|gb|ACD16934.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN]
          Length = 209

 Score = 83.1 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/207 (13%), Positives = 62/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +      ++L+ L  A  +  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWTQWGNATTWIVLVALVAAAGWNGWNFWQRRQAAEAAVLYDQVQQAVA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           S            +  + ++          A+  +     + AA+  L+   D       
Sbjct: 65  SGDKAKITRVATDMEDKFSRTAYAQMTALGAAKALYAAGDEAAAKAQLQWTIDHAKDDEF 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y++   +L +    S+          G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDDKAYDQGLALLAE--PQSDAFKGIVANGRGDLLAAQGKRDDARAAY 182

Query: 186 EELAKDNNSP-FGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDSLSKNDSSARQLIQFKLDALGG 209


>gi|163733997|ref|ZP_02141438.1| hypothetical protein RLO149_03624 [Roseobacter litoralis Och 149]
 gi|161392533|gb|EDQ16861.1| hypothetical protein RLO149_03624 [Roseobacter litoralis Och 149]
          Length = 225

 Score = 83.1 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/213 (16%), Positives = 80/213 (37%), Gaps = 4/213 (1%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + K  +    Y W+A L++++I+  A W          +   +G+    AL L 
Sbjct: 11  VNDEVRRDKFYLMLRRYGWVAALVVVLIVGGAAWSEYRKAQTRAEAERLGDQILNALSL- 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
              +    ++  + I ++       +     A+     G+T  A +   +VA D   P  
Sbjct: 70  --GEPATRQAGLDTINAETPTAKAVVRL-LAAAEAQQAGETDTALQALEQVAVDGDVPEI 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A  ++  +  DT    E  + L+ L+ P  P+   A E + +  +  G    A   
Sbjct: 127 YRQIAAFKSIVLQADTMDPSERRQQLEALAVPGAPLSFLAQEQIALMEVAAGNTDAALAQ 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           ++ + +       +  R+  ++  +  + + + 
Sbjct: 187 YQSILQAAGVSADLQQRALQVIVALGGTPELDN 219


>gi|110679078|ref|YP_682085.1| hypothetical protein RD1_1780 [Roseobacter denitrificans OCh 114]
 gi|109455194|gb|ABG31399.1| hypothetical protein RD1_1780 [Roseobacter denitrificans OCh 114]
          Length = 256

 Score = 83.1 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/212 (15%), Positives = 75/212 (35%), Gaps = 4/212 (1%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + +  +    Y W+A L++++I+  A W          +   +G+    AL L 
Sbjct: 42  VNEEVRRDRFYLMLRRYGWVAALVVVLIVGGAAWSEYRKAQARAEAERLGDQILDALSLS 101

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
                          +         +  +  A+     G+   A     +VA D   P  
Sbjct: 102 EPATRQAGL----DTIDTATPGAAAVVRLLSAAEAQQAGELDAALAALEQVAVDGDVPEI 157

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A  ++  +  DT    E  + L+ L+ P  P+   A E L +  +  G  + A   
Sbjct: 158 YRQIAAFKSIVLQADTMDPSERRQQLEALAVPGAPLSFLAQEQLALMEVAAGNTEAALAQ 217

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRN 216
           ++ + +   +   +  R+  ++  +  + + +
Sbjct: 218 YQSILQAEGASADLQQRALQVIVALGGTPELD 249


>gi|91784205|ref|YP_559411.1| hypothetical protein Bxe_A1596 [Burkholderia xenovorans LB400]
 gi|91688159|gb|ABE31359.1| Putative membrane protein [Burkholderia xenovorans LB400]
          Length = 209

 Score = 83.1 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 61/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +      ++L+ L  A  +  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWTQWGNATTWIVLVALVAAAGWNGWNFWQRREAAEAAVLYDQVQQAVA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           S            +  +  +          A+  +     + AA+  L+   D       
Sbjct: 65  SGDKAKITRVAADMEDRFGRTAYAQMTALGAARALYAAGDEAAAKAQLQWTIDHAKDDEF 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           R  A L+ AS+L+D  +Y++   +L +    S+          G      GK   A+  +
Sbjct: 125 RQIAKLRLASLLLDDKAYDQGLALLAE--PQSDAFKGIVANGRGDLLAAQGKRDDARAAY 182

Query: 186 EELAKDNNSP-FGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDSLSKNDSSARQLIQFKLDALGG 209


>gi|78066580|ref|YP_369349.1| hypothetical protein Bcep18194_A5111 [Burkholderia sp. 383]
 gi|77967325|gb|ABB08705.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 209

 Score = 83.1 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 61/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +N       +   +  +             A+  +        A+  L+ A D       
Sbjct: 65  ANDKATMARAAADMEDKFGSTPYAQMAALSAAKTLYAAGDSAGAKAQLQWAVDHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGLVADRRGDLLAAQGKTDDARAAY 182

Query: 186 EELAK-DNNSPFGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDGLSKDDQSARQLVQFKLDALGG 209


>gi|238753873|ref|ZP_04615233.1| hypothetical protein yruck0001_6450 [Yersinia ruckeri ATCC 29473]
 gi|238707861|gb|EEQ00219.1| hypothetical protein yruck0001_6450 [Yersinia ruckeri ATCC 29473]
          Length = 206

 Score = 83.1 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/211 (16%), Positives = 78/211 (36%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +             +F +A
Sbjct: 1   MEVYTTENDQVDAVRRFFSENGKALAVGVVLGIGALVGWRYWQSHQVTALTEASSSFQKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E   +N   +  ++ EK    ++  Y  L+ + +A   VA+G    AA+  L +A  + 
Sbjct: 61  SEALAANN-AEGVAAAEKFAQNNSNNYGVLAGLELAHHFVAQGQFDKAAQ-QLSLAQGNT 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     E+  K L  ++         A +I G + L  G V  
Sbjct: 119 KDENLLSLIHLRLARVQLQLKKPEDALKTLDAVNGDG--WTAMAQDIRGDALLSKGDVAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +  +  N+   + +  +M L N+ +
Sbjct: 177 ARAAYTKGIES-NASQALQSLLRMKLNNLSS 206


>gi|149204179|ref|ZP_01881147.1| hypothetical protein RTM1035_11675 [Roseovarius sp. TM1035]
 gi|149142621|gb|EDM30666.1| hypothetical protein RTM1035_11675 [Roseovarius sp. TM1035]
          Length = 229

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 66/201 (32%), Gaps = 5/201 (2%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WIA L ILM++  A W        +     +G+    AL   + +  
Sbjct: 16  RRDRLFALMRRYGWIAVLAILMLVGGAAWNEWRKAQDQAAAQALGDAVLAALATEDRSAR 75

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             A  + E                 +A+   A    + AA   L +A+        R  A
Sbjct: 76  AAALDAIEA-----PGAQAGSVIALLAAAEEAADTPEAAAARLLALADRSDVDAVYRNIA 130

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           TL+A  +       E     L  L+     +   A E L +  L+ G    A      +A
Sbjct: 131 TLKAVMLPGSGLDAEARRGRLNGLALSGGVLRLLAEEQLALIDLETGNRDAALERLGAIA 190

Query: 190 KDNNSPFGISTRSQMILANII 210
            D  +  G+  R   ++  + 
Sbjct: 191 SDAEATMGLRRRVTQVIVALG 211


>gi|161524638|ref|YP_001579650.1| hypothetical protein Bmul_1465 [Burkholderia multivorans ATCC
           17616]
 gi|189350606|ref|YP_001946234.1| hypothetical protein BMULJ_01778 [Burkholderia multivorans ATCC
           17616]
 gi|221212771|ref|ZP_03585747.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|160342067|gb|ABX15153.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
 gi|189334628|dbj|BAG43698.1| putative membrane protein [Burkholderia multivorans ATCC 17616]
 gi|221166984|gb|EED99454.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 209

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 64/207 (30%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +N       +   +  +  +          A+ ++        A+  L+ A D       
Sbjct: 65  ANDKATIARAAADMEDKYGRTAYAQMTALSAAKVLYAAGDTAGAKAQLQWAADHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+T +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPMDAFKGLVADRRGDLLAAQGKTDDARTAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDSLSKDDQSARQLVQFKLDALGG 209


>gi|325524776|gb|EGD02750.1| hypothetical protein B1M_19904 [Burkholderia sp. TJI49]
          Length = 209

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 62/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +N       +   +  +             A+ ++        A+  L+ A D       
Sbjct: 65  ANDKATMARAAADMEDKYGSTAYAQMTALAAAKVLYAAGDTAGAKTQLQWAADHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGLVADRRGDLLAAQGKTDDARAAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDSLSKDDQSARQLVQFKLDALGG 209


>gi|86749566|ref|YP_486062.1| hypothetical protein RPB_2446 [Rhodopseudomonas palustris HaA2]
 gi|86572594|gb|ABD07151.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 217

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 49/212 (23%), Positives = 96/212 (45%), Gaps = 1/212 (0%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  D    + + K     Y        ++I++    +  +     KK    G  F  A +
Sbjct: 6   NEVDEEVRRERLKQLWDKYSLFIIAGAILIIAGVGGWRGYQYYEGKKAAETGAAFTAAAD 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L   NK  +A ++F  I +  +  Y  L+    A+  VA+ D K A +++  +A D   P
Sbjct: 66  LAEQNKHAEAEAAFNNIAATASGGYRTLA-RLRAAAEVAQRDPKEAVKVYDAIAADRSVP 124

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  A+L+AA  L+D+  Y ++S+ L+ ++         A E+L +SA + G V  A+
Sbjct: 125 AQDRDLASLRAAQFLMDSVGYADLSQRLEPIAGADAAYRHTAREMLALSAWRAGNVAAAR 184

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
              E++  D  +P  +  R++++ A +  + +
Sbjct: 185 QWIEQINTDAGTPASLRNRAEVLQALLPPAAK 216


>gi|16130438|ref|NP_417008.1| conserved protein, UPF0070 family [Escherichia coli str. K-12
           substr. MG1655]
 gi|82777898|ref|YP_404247.1| hypothetical protein SDY_2709 [Shigella dysenteriae Sd197]
 gi|89109319|ref|AP_003099.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|157158004|ref|YP_001463835.1| hypothetical protein EcE24377A_2797 [Escherichia coli E24377A]
 gi|157161988|ref|YP_001459306.1| hypothetical protein EcHS_A2664 [Escherichia coli HS]
 gi|170019204|ref|YP_001724158.1| hypothetical protein EcolC_1164 [Escherichia coli ATCC 8739]
 gi|170082123|ref|YP_001731443.1| hypothetical protein ECDH10B_2679 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170682168|ref|YP_001744701.1| hypothetical protein EcSMS35_2665 [Escherichia coli SMS-3-5]
 gi|187730758|ref|YP_001881304.1| hypothetical protein SbBS512_E2888 [Shigella boydii CDC 3083-94]
 gi|188493088|ref|ZP_03000358.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|191167663|ref|ZP_03029472.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|191172634|ref|ZP_03034173.1| conserved hypothetical protein [Escherichia coli F11]
 gi|193064011|ref|ZP_03045096.1| conserved hypothetical protein [Escherichia coli E22]
 gi|193068350|ref|ZP_03049313.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194427259|ref|ZP_03059809.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194437588|ref|ZP_03069684.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|209919990|ref|YP_002294074.1| hypothetical protein ECSE_2799 [Escherichia coli SE11]
 gi|218555038|ref|YP_002387951.1| hypothetical protein ECIAI1_2565 [Escherichia coli IAI1]
 gi|218696140|ref|YP_002403807.1| hypothetical protein EC55989_2798 [Escherichia coli 55989]
 gi|218706016|ref|YP_002413535.1| hypothetical protein ECUMN_2833 [Escherichia coli UMN026]
 gi|238901678|ref|YP_002927474.1| hypothetical protein BWG_2277 [Escherichia coli BW2952]
 gi|253772593|ref|YP_003035424.1| hypothetical protein ECBD_1173 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162487|ref|YP_003045595.1| hypothetical protein ECB_02405 [Escherichia coli B str. REL606]
 gi|256017339|ref|ZP_05431204.1| hypothetical protein ShiD9_00390 [Shigella sp. D9]
 gi|256021801|ref|ZP_05435666.1| hypothetical protein E4_00395 [Escherichia sp. 4_1_40B]
 gi|260845143|ref|YP_003222921.1| hypothetical protein ECO103_3030 [Escherichia coli O103:H2 str.
           12009]
 gi|260856607|ref|YP_003230498.1| hypothetical protein ECO26_3560 [Escherichia coli O26:H11 str.
           11368]
 gi|260869202|ref|YP_003235604.1| hypothetical protein ECO111_3237 [Escherichia coli O111:H- str.
           11128]
 gi|291283734|ref|YP_003500552.1| hypothetical protein G2583_3037 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293405954|ref|ZP_06649946.1| membrane protein [Escherichia coli FVEC1412]
 gi|293415778|ref|ZP_06658421.1| yfgM protein [Escherichia coli B185]
 gi|293446866|ref|ZP_06663288.1| yfgM protein [Escherichia coli B088]
 gi|297518017|ref|ZP_06936403.1| hypothetical protein EcolOP_10297 [Escherichia coli OP50]
 gi|298381755|ref|ZP_06991354.1| yfgM protein [Escherichia coli FVEC1302]
 gi|300817717|ref|ZP_07097932.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300820817|ref|ZP_07100967.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|300898383|ref|ZP_07116726.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300904313|ref|ZP_07122170.1| hypothetical protein HMPREF9536_02398 [Escherichia coli MS 84-1]
 gi|300920668|ref|ZP_07137079.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300927124|ref|ZP_07142872.1| hypothetical protein HMPREF9548_05109 [Escherichia coli MS 182-1]
 gi|300930153|ref|ZP_07145574.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|300951782|ref|ZP_07165597.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300958857|ref|ZP_07170965.1| hypothetical protein HMPREF9547_04549 [Escherichia coli MS 175-1]
 gi|300998069|ref|ZP_07181929.1| hypothetical protein HMPREF9553_05402 [Escherichia coli MS 200-1]
 gi|301022373|ref|ZP_07186260.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|301024745|ref|ZP_07188385.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|301302870|ref|ZP_07208998.1| hypothetical protein HMPREF9347_01448 [Escherichia coli MS 124-1]
 gi|301330396|ref|ZP_07223038.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|301648268|ref|ZP_07248011.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|307139148|ref|ZP_07498504.1| hypothetical protein EcolH7_13618 [Escherichia coli H736]
 gi|307312492|ref|ZP_07592125.1| Protein of unknown function DUF2133 [Escherichia coli W]
 gi|309784736|ref|ZP_07679369.1| UPF0070 protein yfgM [Shigella dysenteriae 1617]
 gi|309794440|ref|ZP_07688863.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|312965429|ref|ZP_07779661.1| UPF0070 protein yfgM [Escherichia coli 2362-75]
 gi|312973246|ref|ZP_07787418.1| UPF0070 protein yfgM [Escherichia coli 1827-70]
 gi|331643133|ref|ZP_08344268.1| putative inner membrane protein [Escherichia coli H736]
 gi|331653941|ref|ZP_08354942.1| putative inner membrane protein [Escherichia coli M718]
 gi|331664076|ref|ZP_08364986.1| putative inner membrane protein [Escherichia coli TA143]
 gi|331669259|ref|ZP_08370107.1| putative inner membrane protein [Escherichia coli TA271]
 gi|331673968|ref|ZP_08374731.1| putative inner membrane protein [Escherichia coli TA280]
 gi|331678504|ref|ZP_08379179.1| putative inner membrane protein [Escherichia coli H591]
 gi|332278334|ref|ZP_08390747.1| conserved hypothetical protein [Shigella sp. D9]
 gi|4033493|sp|P76576|YFGM_ECOLI RecName: Full=UPF0070 protein yfgM
 gi|1788860|gb|AAC75566.1| conserved protein, UPF0070 family [Escherichia coli str. K-12
           substr. MG1655]
 gi|81242046|gb|ABB62756.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|85675434|dbj|BAA16399.2| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|157067668|gb|ABV06923.1| conserved hypothetical protein [Escherichia coli HS]
 gi|157080034|gb|ABV19742.1| conserved hypothetical protein [Escherichia coli E24377A]
 gi|169754132|gb|ACA76831.1| conserved hypothetical protein [Escherichia coli ATCC 8739]
 gi|169889958|gb|ACB03665.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170519886|gb|ACB18064.1| conserved hypothetical protein [Escherichia coli SMS-3-5]
 gi|187427750|gb|ACD07024.1| conserved hypothetical protein [Shigella boydii CDC 3083-94]
 gi|188488287|gb|EDU63390.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|190902262|gb|EDV62002.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|190907107|gb|EDV66707.1| conserved hypothetical protein [Escherichia coli F11]
 gi|192929246|gb|EDV82855.1| conserved hypothetical protein [Escherichia coli E22]
 gi|192958302|gb|EDV88742.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194414580|gb|EDX30852.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194423394|gb|EDX39385.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|209763398|gb|ACI80011.1| hypothetical protein ECs3375 [Escherichia coli]
 gi|209763404|gb|ACI80014.1| hypothetical protein ECs3375 [Escherichia coli]
 gi|209913249|dbj|BAG78323.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218352872|emb|CAU98671.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218361806|emb|CAQ99405.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218433113|emb|CAR14010.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|238860355|gb|ACR62353.1| conserved protein [Escherichia coli BW2952]
 gi|242378111|emb|CAQ32884.1| conserved protein [Escherichia coli BL21(DE3)]
 gi|253323637|gb|ACT28239.1| conserved hypothetical protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974388|gb|ACT40059.1| hypothetical protein ECB_02405 [Escherichia coli B str. REL606]
 gi|253978555|gb|ACT44225.1| hypothetical protein ECD_02405 [Escherichia coli BL21(DE3)]
 gi|257755256|dbj|BAI26758.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257760290|dbj|BAI31787.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257765558|dbj|BAI37053.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|260448407|gb|ACX38829.1| conserved hypothetical protein [Escherichia coli DH1]
 gi|284922463|emb|CBG35550.1| conserved hypothetical protein [Escherichia coli 042]
 gi|290763607|gb|ADD57568.1| UPF0070 protein yfgM [Escherichia coli O55:H7 str. CB9615]
 gi|291323696|gb|EFE63124.1| yfgM protein [Escherichia coli B088]
 gi|291428162|gb|EFF01189.1| membrane protein [Escherichia coli FVEC1412]
 gi|291433426|gb|EFF06405.1| yfgM protein [Escherichia coli B185]
 gi|298279197|gb|EFI20711.1| yfgM protein [Escherichia coli FVEC1302]
 gi|299881272|gb|EFI89483.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|300304048|gb|EFJ58568.1| hypothetical protein HMPREF9553_05402 [Escherichia coli MS 200-1]
 gi|300314509|gb|EFJ64293.1| hypothetical protein HMPREF9547_04549 [Escherichia coli MS 175-1]
 gi|300357923|gb|EFJ73793.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300396414|gb|EFJ79952.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|300403745|gb|EFJ87283.1| hypothetical protein HMPREF9536_02398 [Escherichia coli MS 84-1]
 gi|300412349|gb|EFJ95659.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300416894|gb|EFK00205.1| hypothetical protein HMPREF9548_05109 [Escherichia coli MS 182-1]
 gi|300448979|gb|EFK12599.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300461959|gb|EFK25452.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|300526570|gb|EFK47639.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|300529705|gb|EFK50767.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300841805|gb|EFK69565.1| hypothetical protein HMPREF9347_01448 [Escherichia coli MS 124-1]
 gi|300843625|gb|EFK71385.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|301073655|gb|EFK88461.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|306907415|gb|EFN37919.1| Protein of unknown function DUF2133 [Escherichia coli W]
 gi|308121896|gb|EFO59158.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|308927106|gb|EFP72580.1| UPF0070 protein yfgM [Shigella dysenteriae 1617]
 gi|309702845|emb|CBJ02176.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|310331841|gb|EFP99076.1| UPF0070 protein yfgM [Escherichia coli 1827-70]
 gi|312289849|gb|EFR17737.1| UPF0070 protein yfgM [Escherichia coli 2362-75]
 gi|315061832|gb|ADT76159.1| conserved hypothetical protein [Escherichia coli W]
 gi|315137137|dbj|BAJ44296.1| hypothetical protein ECDH1ME8569_2440 [Escherichia coli DH1]
 gi|315256533|gb|EFU36501.1| putative inner membrane protein [Escherichia coli MS 85-1]
 gi|315300480|gb|EFU59709.1| conserved hypothetical protein [Escherichia coli MS 16-3]
 gi|315615772|gb|EFU96404.1| UPF0070 protein yfgM [Escherichia coli 3431]
 gi|320175076|gb|EFW50189.1| hypothetical protein SDB_02437 [Shigella dysenteriae CDC 74-1112]
 gi|320185213|gb|EFW59993.1| hypothetical protein SGF_02749 [Shigella flexneri CDC 796-83]
 gi|320200077|gb|EFW74666.1| hypothetical protein ECoL_02913 [Escherichia coli EC4100B]
 gi|320640857|gb|EFX10345.1| hypothetical protein ECO5101_04487 [Escherichia coli O157:H7 str.
           G5101]
 gi|320646300|gb|EFX15227.1| hypothetical protein ECO9389_06673 [Escherichia coli O157:H- str.
           493-89]
 gi|320651805|gb|EFX20185.1| hypothetical protein ECO2687_02991 [Escherichia coli O157:H- str. H
           2687]
 gi|320657191|gb|EFX25000.1| hypothetical protein ECO7815_13194 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662797|gb|EFX30129.1| hypothetical protein ECO5905_00861 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320667601|gb|EFX34516.1| hypothetical protein ECOSU61_20448 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323156167|gb|EFZ42326.1| hypothetical protein ECEPECA14_1944 [Escherichia coli EPECa14]
 gi|323159383|gb|EFZ45368.1| hypothetical protein ECE128010_4434 [Escherichia coli E128010]
 gi|323177363|gb|EFZ62951.1| hypothetical protein ECOK1180_3849 [Escherichia coli 1180]
 gi|323184426|gb|EFZ69801.1| hypothetical protein ECOK1357_2147 [Escherichia coli 1357]
 gi|323188369|gb|EFZ73661.1| hypothetical protein ECRN5871_3475 [Escherichia coli RN587/1]
 gi|323377587|gb|ADX49855.1| Protein of unknown function DUF2133 [Escherichia coli KO11]
 gi|323936406|gb|EGB32696.1| yfgM [Escherichia coli E1520]
 gi|323941225|gb|EGB37410.1| yfgM [Escherichia coli E482]
 gi|323944735|gb|EGB40802.1| yfgM [Escherichia coli H120]
 gi|323961329|gb|EGB56941.1| yfgM [Escherichia coli H489]
 gi|323971074|gb|EGB66322.1| yfgM [Escherichia coli TA007]
 gi|324011230|gb|EGB80449.1| hypothetical protein HMPREF9533_04773 [Escherichia coli MS 60-1]
 gi|324020073|gb|EGB89292.1| hypothetical protein HMPREF9542_01238 [Escherichia coli MS 117-3]
 gi|324118143|gb|EGC12040.1| yfgM [Escherichia coli E1167]
 gi|331039931|gb|EGI12151.1| putative inner membrane protein [Escherichia coli H736]
 gi|331048790|gb|EGI20866.1| putative inner membrane protein [Escherichia coli M718]
 gi|331059875|gb|EGI31852.1| putative inner membrane protein [Escherichia coli TA143]
 gi|331064453|gb|EGI36364.1| putative inner membrane protein [Escherichia coli TA271]
 gi|331069241|gb|EGI40633.1| putative inner membrane protein [Escherichia coli TA280]
 gi|331074964|gb|EGI46284.1| putative inner membrane protein [Escherichia coli H591]
 gi|332092742|gb|EGI97811.1| hypothetical protein SB359474_2926 [Shigella boydii 3594-74]
 gi|332100686|gb|EGJ04032.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332344385|gb|AEE57719.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|333000701|gb|EGK20277.1| hypothetical protein SFVA6_3393 [Shigella flexneri VA-6]
          Length = 206

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|209964705|ref|YP_002297620.1| hypothetical protein RC1_1403 [Rhodospirillum centenum SW]
 gi|209958171|gb|ACI98807.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 219

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/174 (21%), Positives = 71/174 (40%), Gaps = 1/174 (0%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
               W       ++++   +G   AQAL    S    +A        ++ +  +  L+  
Sbjct: 41  GYVAWQRWQSARNQEQTAELGRALAQALPAGASAPATNAADLLAGAAARTDGAHAALARF 100

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
           Y A +   +GD + A  ++ +      A    R  A L A    VD+   +++   L  L
Sbjct: 101 YEAGLRARQGDREGAVALYDQ-LAGTEADPVFRDLAQLLAVLHQVDSGDPKQLLSRLTPL 159

Query: 154 SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
               NP +  A E+ G+ + + G   +A+ +F +LA D  +P G+  R+  +  
Sbjct: 160 MGSDNPWNWSARELAGLLSARDGDTARARELFSQLADDPQTPAGVRARATELAD 213


>gi|170767286|ref|ZP_02901739.1| conserved hypothetical protein [Escherichia albertii TW07627]
 gi|170123620|gb|EDS92551.1| conserved hypothetical protein [Escherichia albertii TW07627]
          Length = 206

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 74/210 (35%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++    +        +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVESARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VIAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|319763711|ref|YP_004127648.1| hypothetical protein Alide_3035 [Alicycliphilus denitrificans BC]
 gi|330824026|ref|YP_004387329.1| hypothetical protein Alide2_1413 [Alicycliphilus denitrificans
           K601]
 gi|317118272|gb|ADV00761.1| Protein of unknown function DUF2133 [Alicycliphilus denitrificans
           BC]
 gi|329309398|gb|AEB83813.1| Protein of unknown function DUF2133 [Alicycliphilus denitrificans
           K601]
          Length = 226

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/199 (11%), Positives = 58/199 (29%), Gaps = 2/199 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     +      +++++L     +  +     ++                S  L  
Sbjct: 14  DELKHFWNTWGTPITWVLIIVLGGFAAWNGYQLWQSRQAQQATALVEAVELAAQSGDLAR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
              +F  + S             +A+  +A     +AA+  L    +  +       A L
Sbjct: 74  VEQAFGDLKSGYGGTIQAGQAGLLAAKALADAGKWDAAKGVLAWVAEKASDEGYMALARL 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L++  +Y+E    L       +       +  G       K Q+A   +    + 
Sbjct: 134 RLAGVLIEEKAYDEALAQLSA--RFPSEFAGTVADRKGDVLALQDKKQEAIAEYRRAYQA 191

Query: 192 NNSPFGISTRSQMILANII 210
            ++        +  L  + 
Sbjct: 192 LDAGIEYRRLVEAKLNALG 210


>gi|15832629|ref|NP_311402.1| hypothetical protein ECs3375 [Escherichia coli O157:H7 str. Sakai]
 gi|168748428|ref|ZP_02773450.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|168756285|ref|ZP_02781292.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|168761123|ref|ZP_02786130.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|168768605|ref|ZP_02793612.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773573|ref|ZP_02798580.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|168778479|ref|ZP_02803486.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|168787859|ref|ZP_02812866.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|168798884|ref|ZP_02823891.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|195936655|ref|ZP_03082037.1| hypothetical protein EscherichcoliO157_09365 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208806764|ref|ZP_03249101.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208813431|ref|ZP_03254760.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208820375|ref|ZP_03260695.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209397682|ref|YP_002271983.1| hypothetical protein ECH74115_3737 [Escherichia coli O157:H7 str.
           EC4115]
 gi|217326764|ref|ZP_03442847.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|254794459|ref|YP_003079296.1| hypothetical protein ECSP_3453 [Escherichia coli O157:H7 str.
           TW14359]
 gi|261223055|ref|ZP_05937336.1| hypothetical protein EscherichiacoliO157_00410 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261259394|ref|ZP_05951927.1| hypothetical protein EscherichiacoliO157EcO_26821 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|13362845|dbj|BAB36798.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|187770561|gb|EDU34405.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017062|gb|EDU55184.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|189003185|gb|EDU72171.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|189356601|gb|EDU75020.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362284|gb|EDU80703.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|189368453|gb|EDU86869.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|189372330|gb|EDU90746.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|189378605|gb|EDU97021.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|208726565|gb|EDZ76166.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734708|gb|EDZ83395.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740498|gb|EDZ88180.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209159082|gb|ACI36515.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4115]
 gi|209763400|gb|ACI80012.1| hypothetical protein ECs3375 [Escherichia coli]
 gi|209763402|gb|ACI80013.1| hypothetical protein ECs3375 [Escherichia coli]
 gi|209763406|gb|ACI80015.1| hypothetical protein ECs3375 [Escherichia coli]
 gi|217319131|gb|EEC27556.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|254593859|gb|ACT73220.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|320188846|gb|EFW63505.1| hypothetical protein ECoD_03839 [Escherichia coli O157:H7 str.
           EC1212]
 gi|326340311|gb|EGD64115.1| hypothetical protein ECF_04027 [Escherichia coli O157:H7 str. 1125]
 gi|326344995|gb|EGD68739.1| hypothetical protein ECoA_01842 [Escherichia coli O157:H7 str.
           1044]
          Length = 206

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAIKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|15803036|ref|NP_289066.1| hypothetical protein Z3776 [Escherichia coli O157:H7 EDL933]
 gi|12516904|gb|AAG57623.1|AE005480_10 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
          Length = 206

 Score = 82.7 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAIKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDXARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|33602150|ref|NP_889710.1| hypothetical protein BB3174 [Bordetella bronchiseptica RB50]
 gi|33576588|emb|CAE33666.1| putative membrane protein [Bordetella bronchiseptica RB50]
          Length = 212

 Score = 82.7 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/215 (12%), Positives = 62/215 (28%), Gaps = 6/215 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        +     Y  +   L  +++     +  +      + N     F   
Sbjct: 1   MAYDLEEQEKLDAIRAWWARYGTLILTLATLVVLAWGGWSGWKAYQNYRANQAMGYFEAL 60

Query: 61  LELFNSNKLDDARSSFEK---ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
            +       D A         + +             IA+  +      + A   L+   
Sbjct: 61  EDAARLGGADAATRIKAAAATLRTDYPATGYAGRGALIAAQALQSQQDVDGAREQLEWLA 120

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
                 A++  A L+ A IL+D   Y+       +L+ P         +  G      GK
Sbjct: 121 AQAKQPALQPVARLRLAGILLDQKQYDAALA---QLNNPPASFAALFADRRGDVLAAQGK 177

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
             +A+  ++       +   ++   Q+ L  +  +
Sbjct: 178 RDEARAAWQSAIDGLGTSNPLTQVVQLKLDALSGA 212


>gi|299133683|ref|ZP_07026877.1| Protein of unknown function DUF2133 [Afipia sp. 1NLS2]
 gi|298591519|gb|EFI51720.1| Protein of unknown function DUF2133 [Afipia sp. 1NLS2]
          Length = 214

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 47/195 (24%), Positives = 87/195 (44%), Gaps = 4/195 (2%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S  D +  + + K     Y     +LI++I+     +  +     +K    G+ F  A+ 
Sbjct: 6   SEIDEDLRREQLKKLWDRYSLHFIVLIVLIVGGVGGWRAYQYFENQKAEAAGKAFEAAVA 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           L        A+++F+KI S + + Y+ L+ ++ A+    +   +     F  VAND    
Sbjct: 66  LT---DPAQAQAAFDKIASSNAQGYSTLARLHAAAEAAKQDS-QKGIAAFDAVANDGKVE 121

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +R  A L+AAS+L+DT+ Y +I K L   +  ++     A E+L +SA +      A+
Sbjct: 122 APIREIARLRAASLLLDTAPYADIEKRLSDDASGTHTFRHSARELLALSAWRAKNNDAAR 181

Query: 183 TIFEELAKDNNSPFG 197
              + +  D  SP  
Sbjct: 182 KWLDMIGDDPQSPAT 196


>gi|134295841|ref|YP_001119576.1| hypothetical protein Bcep1808_1737 [Burkholderia vietnamiensis G4]
 gi|134138998|gb|ABO54741.1| conserved hypothetical protein [Burkholderia vietnamiensis G4]
          Length = 209

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 61/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWIVLAALVVAAGFNGWNYWQRRQAAEASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +N       +   +  +             A+  +        A+  L+ A D       
Sbjct: 65  ANDKATMARAAADMEDKFGSTAYAQMTALAAAKTLYASGDAAGAKAQLQWAADHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPVDAFKGLVADRRGDLLAAQGKTDDARAAY 182

Query: 186 EELAK-DNNSPFGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDGLSKDDQSARQLVQFKLDALGG 209


>gi|322831768|ref|YP_004211795.1| hypothetical protein Rahaq_1045 [Rahnella sp. Y9602]
 gi|321166969|gb|ADW72668.1| Protein of unknown function DUF2133 [Rahnella sp. Y9602]
          Length = 206

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 68/211 (32%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ ++    +  +    +        +F QA
Sbjct: 1   MEVYTTENEQVDAVRRFFAENGKALAIGVVLGIAALGGWRFWQSHQDSALTEASASFQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +   SN      +  EK    ++  Y   + + +A   V   D    AE  L  A    
Sbjct: 61  NQSLTSNN-AKGVADLEKFAQSNDNNYGVFAALQLADHFVGTSDFA-NAEKQLVQAQGQA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +R    L+ A + +    +++  K L  +             I G   L  G  + 
Sbjct: 119 KEDNLRSLVNLRLARVQMQQGKFDDALKTLDGVKGEG--WTAMQQGIRGDVLLAKGDAKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +   D+     + T  +M L N+ +
Sbjct: 177 AREAYSKGL-DSKPSQTLQTVLRMKLNNLAS 206


>gi|163856332|ref|YP_001630630.1| hypothetical protein Bpet2021 [Bordetella petrii DSM 12804]
 gi|163260060|emb|CAP42361.1| putative membrane protein [Bordetella petrii]
          Length = 212

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/215 (11%), Positives = 62/215 (28%), Gaps = 6/215 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K     Y  +   L  +       ++ +      + N     F   
Sbjct: 1   MAYDLEEQEQLDAIKAWWARYGTLVVTLAAIAALAWGGWWGWKAYQTHRANQAMGYFEAL 60

Query: 61  LELFNSNKLD---DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
            +       D     +++   + S             +A+  + + +    A   L+   
Sbjct: 61  EDAARLGGTDSTVRIKAAASTLRSDYPSTGYAARGALVAAHALEQQNDIAGAREQLEWLA 120

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
                 A++  A ++ A +L+D   Y+       +L  P         +  G      GK
Sbjct: 121 GQSKQAALQPVARVRLAGLLLDQKQYDAALA---QLDNPPAAFAALYADRRGDILAAQGK 177

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
            + A+  ++       +   +    Q+ L  +  +
Sbjct: 178 PEDARKAWQAALDGLAANDPLRQAVQLKLDALSGA 212


>gi|311105361|ref|YP_003978214.1| transmembrane protein 1 [Achromobacter xylosoxidans A8]
 gi|310760050|gb|ADP15499.1| transmembrane protein 1 [Achromobacter xylosoxidans A8]
          Length = 212

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/215 (11%), Positives = 64/215 (29%), Gaps = 6/215 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K     Y  +   L+  +      ++ +      + N     F   
Sbjct: 1   MAYDLEEQEKLDAIKAWWARYGTLVVTLVAAVALAWGGWWGWKAYQSHRANQAMGYFEAL 60

Query: 61  LELFNSNKLD---DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
            +       D     +++   +  Q            +A+  +        A   L+   
Sbjct: 61  EDAARLGGADSSVRIKTAAATLREQYPSTGYATRGALVAAQALQAQKDDAGAREQLEWLA 120

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
                 +++  A L+ A +++D   Y+       +L+ P         +  G      GK
Sbjct: 121 AQGKNPSMQAVARLRLAGMMLDQKQYDAALA---QLNNPPAAFAALFADRRGDILAAQGK 177

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
            ++A+  ++       +   ++   Q+ L  +  +
Sbjct: 178 REEARAAWQSAIDGLGTANPLTQVVQLKLDALSGA 212


>gi|242240153|ref|YP_002988334.1| hypothetical protein Dd703_2735 [Dickeya dadantii Ech703]
 gi|242132210|gb|ACS86512.1| conserved hypothetical protein [Dickeya dadantii Ech703]
          Length = 208

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/212 (12%), Positives = 77/212 (36%), Gaps = 5/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     +      +           + +++ +   + +  +    E         + QA
Sbjct: 1   MEVYTTESEQIDAVRRFLVENGKALAVGVVLGVGALVGWRFWQNHQESTAMASSMAYQQA 60

Query: 61  LELFN-SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           ++    +    +  +  ++  ++++  Y+ L+++ +A     + D   A +   +  +  
Sbjct: 61  MDTLTAAAGKPEGIAGIQQFAAEEHGSYSALASLSLARQYADQNDFPKAEQQLRQALSQT 120

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
                ++    L+ A +L+     ++  K L  +          A ++ G + +  G  Q
Sbjct: 121 K-DADLQTIVNLRLARVLLQQKKADDALKTLDAVKSAG--WLAMAADVRGDALVSKGDTQ 177

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
            A+  + +     N P G+ +  +M L N+ +
Sbjct: 178 GARDAYNQGIAS-NPPQGLQSILRMKLNNLSS 208


>gi|194432129|ref|ZP_03064418.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|194419658|gb|EDX35738.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|320180503|gb|EFW55434.1| hypothetical protein SGB_02403 [Shigella boydii ATCC 9905]
 gi|332087960|gb|EGI93085.1| hypothetical protein SB521682_2893 [Shigella boydii 5216-82]
 gi|332089693|gb|EGI94794.1| hypothetical protein SD15574_2915 [Shigella dysenteriae 155-74]
          Length = 206

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARIQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|74313039|ref|YP_311458.1| hypothetical protein SSON_2595 [Shigella sonnei Ss046]
 gi|73856516|gb|AAZ89223.1| conserved hypothetical protein [Shigella sonnei Ss046]
          Length = 206

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGKALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|26248877|ref|NP_754917.1| hypothetical protein c3035 [Escherichia coli CFT073]
 gi|91211839|ref|YP_541825.1| hypothetical protein UTI89_C2834 [Escherichia coli UTI89]
 gi|117624742|ref|YP_853655.1| hypothetical protein APECO1_4011 [Escherichia coli APEC O1]
 gi|218559439|ref|YP_002392352.1| hypothetical protein ECS88_2689 [Escherichia coli S88]
 gi|218690633|ref|YP_002398845.1| hypothetical protein ECED1_2944 [Escherichia coli ED1a]
 gi|227887548|ref|ZP_04005353.1| tetratricopeptide repeat family protein [Escherichia coli 83972]
 gi|237705023|ref|ZP_04535504.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|300981975|ref|ZP_07175821.1| conserved hypothetical protein [Escherichia coli MS 45-1]
 gi|301047146|ref|ZP_07194241.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|306814417|ref|ZP_07448579.1| hypothetical protein ECNC101_20287 [Escherichia coli NC101]
 gi|331648210|ref|ZP_08349300.1| putative inner membrane protein [Escherichia coli M605]
 gi|331658658|ref|ZP_08359602.1| putative inner membrane protein [Escherichia coli TA206]
 gi|26109283|gb|AAN81485.1|AE016764_167 Hypothetical protein yfgM [Escherichia coli CFT073]
 gi|91073413|gb|ABE08294.1| hypothetical protein YfgM [Escherichia coli UTI89]
 gi|115513866|gb|ABJ01941.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|218366208|emb|CAR03956.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218428197|emb|CAR09114.2| conserved hypothetical protein [Escherichia coli ED1a]
 gi|222034224|emb|CAP76965.1| UPF0070 protein yfgM [Escherichia coli LF82]
 gi|226901389|gb|EEH87648.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227835898|gb|EEJ46364.1| tetratricopeptide repeat family protein [Escherichia coli 83972]
 gi|281179567|dbj|BAI55897.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|294491027|gb|ADE89783.1| conserved hypothetical protein [Escherichia coli IHE3034]
 gi|300300932|gb|EFJ57317.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|300408870|gb|EFJ92408.1| conserved hypothetical protein [Escherichia coli MS 45-1]
 gi|305851811|gb|EFM52263.1| hypothetical protein ECNC101_20287 [Escherichia coli NC101]
 gi|307554536|gb|ADN47311.1| conserved membrane protein YfgM [Escherichia coli ABU 83972]
 gi|307625931|gb|ADN70235.1| hypothetical protein UM146_04140 [Escherichia coli UM146]
 gi|312947090|gb|ADR27917.1| hypothetical protein NRG857_12505 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315288065|gb|EFU47465.1| conserved hypothetical protein [Escherichia coli MS 110-3]
 gi|315292447|gb|EFU51799.1| conserved hypothetical protein [Escherichia coli MS 153-1]
 gi|320196350|gb|EFW70974.1| hypothetical protein EcoM_01743 [Escherichia coli WV_060327]
 gi|323949173|gb|EGB45064.1| yfgM [Escherichia coli H252]
 gi|323955754|gb|EGB51512.1| yfgM [Escherichia coli H263]
 gi|324008521|gb|EGB77740.1| hypothetical protein HMPREF9532_01786 [Escherichia coli MS 57-2]
 gi|330912288|gb|EGH40798.1| hypothetical protein ECAA86_02687 [Escherichia coli AA86]
 gi|331043070|gb|EGI15210.1| putative inner membrane protein [Escherichia coli M605]
 gi|331054323|gb|EGI26350.1| putative inner membrane protein [Escherichia coli TA206]
          Length = 206

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDAIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|331684161|ref|ZP_08384757.1| putative inner membrane protein [Escherichia coli H299]
 gi|331079113|gb|EGI50315.1| putative inner membrane protein [Escherichia coli H299]
          Length = 206

 Score = 82.0 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 74/210 (35%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  + +          ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDAIKDEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|296158990|ref|ZP_06841818.1| Protein of unknown function DUF2133 [Burkholderia sp. Ch1-1]
 gi|295890865|gb|EFG70655.1| Protein of unknown function DUF2133 [Burkholderia sp. Ch1-1]
          Length = 209

 Score = 82.0 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/207 (13%), Positives = 62/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +      ++L+ L  A  +  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWTQWGNATTWIVLVALVAAAGWNGWNFWQRREAAEAAVLYDQVQQAVA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           S            +  + ++          A+  +     + AA+  L+   D       
Sbjct: 65  SGDKAKITRVAADMEDRFSRTAYAQMTALGAAKALYAAGDEAAAKAQLQWTIDHAKDDEF 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y++   +L +    S+          G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDDKAYDQGLALLAE--PQSDAFKGIVANGRGDLLAAQGKRDDARAAY 182

Query: 186 EELAKDNNSP-FGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDSLSKNDSSARQLIQFKLDALGG 209


>gi|163797495|ref|ZP_02191446.1| hypothetical protein BAL199_23462 [alpha proteobacterium BAL199]
 gi|159177244|gb|EDP61803.1| hypothetical protein BAL199_23462 [alpha proteobacterium BAL199]
          Length = 212

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 3/197 (1%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K+ +    W+     + ++        ++    + K  +G+ +  A EL  S    D   
Sbjct: 19  KLWQRYGGWLIAAA-VGVVLAVSGNVFWNRYSTQLKAEMGDRYEAAAELVVSGNPKDGAQ 77

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
           +F  +       Y  L+ +  A+ L   GDT+ A  +F KVA D   P      A L+A 
Sbjct: 78  AFAALADDAGAGYATLARLREAAALATAGDTEAAILVFRKVATDAKPP--YADLARLRAV 135

Query: 135 SILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
            + + T     +   L  +    NP    A E      L+ G+  KA TI++ LA D ++
Sbjct: 136 RLGIGTGDTSALLSELAPVLAAGNPWRPLAAETEAAIHLRAGETGKALTIYKSLADDAST 195

Query: 195 PFGISTRSQMILANIIA 211
           P  +  R+  ++  +  
Sbjct: 196 PSQLRARAAEMVRALGG 212


>gi|110642678|ref|YP_670408.1| hypothetical protein ECP_2518 [Escherichia coli 536]
 gi|110344270|gb|ABG70507.1| hypothetical protein YfgM (putative membrane protein) [Escherichia
           coli 536]
          Length = 206

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGQALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|308187768|ref|YP_003931899.1| UPF0070 protein [Pantoea vagans C9-1]
 gi|308058278|gb|ADO10450.1| UPF0070 protein [Pantoea vagans C9-1]
          Length = 205

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 71/210 (33%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  ++ N      +           + +++ ++    +  +    +     V   + Q 
Sbjct: 1   MEVYSNENEQTDALRNFFASNGKALAIGVVIGIAALGGWRYWSSHQDDTAKSVSAQYQQL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                + K  +   +  +  S+++  Y  L+ M +A   V  G    AA +      D  
Sbjct: 61  TSAMQAGKP-ETLEAVSRFASENSNTYGALAAMDLAKQYVDAGQLDKAATLLQNGLKDTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I +  +  +   K L  +            +I G + L  G  Q 
Sbjct: 120 -DANLQAVINLRLARIQLQQNQADAALKTLDGVKGDG--WTAIVADIRGEALLTKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + +  +  ++   +    QM + N+ 
Sbjct: 177 ARDAWSKGVES-DASPALKQMMQMKMNNLS 205


>gi|33597410|ref|NP_885053.1| hypothetical protein BPP2853 [Bordetella parapertussis 12822]
 gi|33573837|emb|CAE38145.1| putative membrane protein [Bordetella parapertussis]
          Length = 212

 Score = 81.6 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 27/215 (12%), Positives = 61/215 (28%), Gaps = 6/215 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        +     Y  +   L  +++     +  +      + N     F   
Sbjct: 1   MAYDLEEQEKLDAIRAWWARYGTLILTLATLVVLAWGGWSGWKAYQNYRANQAMGYFEAL 60

Query: 61  LELFNSNKLDDARSSFEK---ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
            +       D A         + +             IA+  +      + A   L+   
Sbjct: 61  EDAARLGGADAATRIKAAAATLRTDYPATGYAGRGALIAAQALQSQQDVDGAREQLEWLA 120

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
                 A++  A L+ A IL+D   Y+       +L+ P         +  G      GK
Sbjct: 121 AQAKQPALQPVARLRLAGILLDQKQYDAALA---QLNNPPASFAALFADRRGDVLAAQGK 177

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
              A+  ++       +   ++   Q+ L  +  +
Sbjct: 178 RDDARAAWQSAIDGLGTSNPLTQVVQLKLDALSGA 212


>gi|194365438|ref|YP_002028048.1| hypothetical protein Smal_1660 [Stenotrophomonas maltophilia
           R551-3]
 gi|194348242|gb|ACF51365.1| conserved hypothetical protein [Stenotrophomonas maltophilia
           R551-3]
          Length = 212

 Score = 81.6 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/218 (14%), Positives = 74/218 (33%), Gaps = 10/218 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ++   D +    + +             +++ +     +  +      K       + +A
Sbjct: 3   IDDLLDEHEQSERVRSWLRKNGASILGGVVIAIGAIAGWQWYQKDQGGKLASANVEYQKA 62

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L     NKLDDA  + + + +  + +Y  L+ + +A   V  G  + A    L       
Sbjct: 63  LVGLQQNKLDDASKAVKALEAGPSSIYGDLAALQLAKAQVDAGKNEEA----LATLRAVK 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++     + A +LV T   +E  K+L       +     + EI G + +  GK   
Sbjct: 119 VEGDLQRVVDQRVARLLVATGKSDEAIKLL------GSATDSSSLEIHGDALMAQGKRDD 172

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           A+  +E+  K  +         +  + +   +     +
Sbjct: 173 ARAQYEKALKSLDVAAPQRRLLETKVMDAGGTVAAPAE 210


>gi|293410927|ref|ZP_06654503.1| UPF0070 protein yfgM [Escherichia coli B354]
 gi|291471395|gb|EFF13879.1| UPF0070 protein yfgM [Escherichia coli B354]
          Length = 206

 Score = 81.6 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKLADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|291618409|ref|YP_003521151.1| YfgM [Pantoea ananatis LMG 20103]
 gi|291153439|gb|ADD78023.1| YfgM [Pantoea ananatis LMG 20103]
          Length = 205

 Score = 81.2 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 26/210 (12%), Positives = 69/210 (32%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  ++ N      +           + +++ ++    +  +    +     +   + + 
Sbjct: 1   MEVYSNENEQVDALRRFFANNGKALAVGVVIGIAALGGWRYWSSHQQDSAKTISAEYQKV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                + K  +   +     S+++  Y  L+ + +A   V       AA +      D  
Sbjct: 61  TRAMQAGKP-ETLEAVNTFASENSNTYGALAALDLAKQYVDSNQLDKAATLLQNGLKDTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I +  +  +   K L  +            +I G + L  G  Q 
Sbjct: 120 -DANLQAVINLRLARIQLQQNQADAALKTLDSVKGDG--WTAIVADIRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + +  +  ++   +    QM + N+ 
Sbjct: 177 ARDAWSKGVES-DASPALKQMMQMKMNNLS 205


>gi|167587052|ref|ZP_02379440.1| hypothetical protein BuboB_17042 [Burkholderia ubonensis Bu]
          Length = 209

 Score = 81.2 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 63/207 (30%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++L  L +A  F  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWIVLAALVVAAGFNGWNFWQRRQAAQASGLYEQVQKAAA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           SN       +   +  + +           A+ ++        A+  L+ A D       
Sbjct: 65  SNDKATMARAAADMEDKYSGTPYAQMTALAAAKVLYAAGDAAGAKTQLQWAVDHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P +       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPIDAFKGLVADRRGDLLAAQGKADDARAAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +                 Q  L  + +
Sbjct: 183 KLALDSLPKEDMSARQLVQFKLDALGS 209


>gi|304398583|ref|ZP_07380455.1| Protein of unknown function DUF2133 [Pantoea sp. aB]
 gi|304353794|gb|EFM18169.1| Protein of unknown function DUF2133 [Pantoea sp. aB]
          Length = 205

 Score = 81.2 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 71/210 (33%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  ++ N      +           + +++ ++    +  +    +     V   + Q 
Sbjct: 1   MEVYSNENEQTDALRNFFANNGKALAIGVVIGIAALGGWRYWSSHQDDTAKSVSAQYQQL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                + K  +   +  +  S+++  Y  L+ M +A   V  G    AA +      D  
Sbjct: 61  TSAMQAGKP-ETLEAVNRFASENSNTYGALAAMDLAKQYVDAGQLDKAASLLQNGLKDTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I +  +  +   K L  +            +I G + L  G  Q 
Sbjct: 120 -DANLQAVINLRLARIQLQQNQADAALKTLDGVKGDG--WTAIVADIRGEALLTKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + +  +  ++   +    QM + N+ 
Sbjct: 177 ARDAWSKGVES-DASPALKQMMQMKMNNLS 205


>gi|157371842|ref|YP_001479831.1| hypothetical protein Spro_3607 [Serratia proteamaculans 568]
 gi|157323606|gb|ABV42703.1| conserved hypothetical protein [Serratia proteamaculans 568]
          Length = 206

 Score = 81.2 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 30/211 (14%), Positives = 74/211 (35%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +         +  +++ +A
Sbjct: 1   MEVYTTENEQVDAVRRFFAENGKALAVGVVLGIGALVGWRYWQSHENSNMMVASQSYQEA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +   S K DD  ++ EK    ++  Y  L+++ +A   V + +    A   L +A    
Sbjct: 61  SDRLASGKPDDV-AAAEKFAQANSNSYGVLASLELAKHFVEQNEFAK-ASQQLVLAQGQT 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     ++  K L  +          A +  G   L  G  + 
Sbjct: 119 KDENMLSMINLRLARVQLQEKKLDDALKTLDGVKGEG--WAAMAQDTRGDVLLAKGDTKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +  +  N+   +    +M L N+ +
Sbjct: 177 AREAYSKGIES-NASQALQVLLRMKLNNLSS 206


>gi|294677826|ref|YP_003578441.1| hypothetical protein RCAP_rcc02304 [Rhodobacter capsulatus SB 1003]
 gi|294476646|gb|ADE86034.1| conserved hypothetical protein [Rhodobacter capsulatus SB 1003]
          Length = 214

 Score = 81.2 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 35/207 (16%), Positives = 67/207 (32%), Gaps = 8/207 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       Y WI  + IL ++  + +          +    G+    ALE   +   
Sbjct: 16  RRDRLFAAFRKYGWIGVVAILGLVGGSAYVEWSKTQRAARAEAFGDGILSALE---AENP 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
            +A ++              +  +  A+     G    A      VA D   P ++R  A
Sbjct: 73  SEALAAL-----PVAGPQGGMRKLLTAAQAAEDGKVDLALADLRAVAGDATLPDSLRQLA 127

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L+A  +       E  +  L  L+ P  P    A E   ++AL  G    A     E+ 
Sbjct: 128 RLKAVLVAGAAMGAEARAAELAALAAPGAPFRLMAMEQQALAALDAGDKDGAIAKAREIM 187

Query: 190 KDNNSPFGISTRSQMILANIIASDQRN 216
            ++    G+  R+  ++  +       
Sbjct: 188 AEDGVTSGLQQRATELIVALEGDPAAK 214


>gi|126739023|ref|ZP_01754717.1| hypothetical protein RSK20926_21524 [Roseobacter sp. SK209-2-6]
 gi|126719640|gb|EBA16348.1| hypothetical protein RSK20926_21524 [Roseobacter sp. SK209-2-6]
          Length = 223

 Score = 81.2 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 39/203 (19%), Positives = 82/203 (40%), Gaps = 4/203 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +  +    Y WI  L +++I+  A +  +     E     +G+    AL      K 
Sbjct: 16  RRDRLFLMLKRYGWIGGLAVILIVGGATFREINKSKAETAAQDLGDELLAALVHDEDAKR 75

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
            +A S        D +    +  +  A  LV   D   A      VA +   P+  R+ A
Sbjct: 76  AEALSKIAA----DTEGGKAVVALLQAGALVNADDRDAAVARLESVAVNGELPMIYRHIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           + +A  +  ++ S EE     + L++P  P+   A+E + +  ++ G  + A T  +++ 
Sbjct: 132 SFKALLLQQESLSLEERRIQFEALAQPGAPLALLASEQIALLEIEQGNTEAAITRLQQIT 191

Query: 190 KDNNSPFGISTRSQMILANIIAS 212
            D ++   +  R+  ++  +  S
Sbjct: 192 VDASAAADLKERASQVIVALGGS 214


>gi|238921037|ref|YP_002934552.1| membrane protein [Edwardsiella ictaluri 93-146]
 gi|238870606|gb|ACR70317.1| membrane protein [Edwardsiella ictaluri 93-146]
          Length = 206

 Score = 81.2 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 78/211 (36%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +  N      +     Y     + +++ +   + +  + G  +       +++  A
Sbjct: 1   MEVYSTENEQVDAIRHFFQEYGKTLVVGVVIGIGALLGWRYWVGHQQANMAQASQSYQLA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E  +  K D    S E  + ++   Y  L+ + +A   V K D    A+  L  A    
Sbjct: 61  SEALSGGKKDGVMLS-EAFIKENGNNYGVLAALQLAQYEVEKSDFAK-AQTQLAWAEGQA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
             + ++  + L+ A + +  +  +   K L  ++         A +I G   LK G  + 
Sbjct: 119 KDVNLKALSNLRLARVQLQENQLDAALKTLDGVTAKG--WQPLAQDIRGDVLLKKGDAKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +     ++   +    +M L N+ +
Sbjct: 177 AREAYSKGLA-ESASQSLQALLRMKLNNLSS 206


>gi|319941510|ref|ZP_08015837.1| hypothetical protein HMPREF9464_01056 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804984|gb|EFW01823.1| hypothetical protein HMPREF9464_01056 [Sutterella wadsworthensis
           3_1_45B]
          Length = 212

 Score = 81.2 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 23/212 (10%), Positives = 70/212 (33%), Gaps = 1/212 (0%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K     +      ++ +       +  ++     +     + +A  
Sbjct: 1   MAYDLEEQESIDQMKAWWDRWGTPVTSVVCVCCLAFAGWNGWNWWQRNQAAKASQIYAAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                ++ L + +S    ++S+ +         + ++   +       A+  L    +  
Sbjct: 61  QNAVATHDLKNVQSLSAGLISEYSSTLYAPLAAFASAQSASDAGDLADAKAKLNWVIEKS 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                   A ++ A +L D    +E    +   ++P+        +  G      G +QK
Sbjct: 121 GRPEYDTVARVRLAGVLFDEGKLDEA-AAVLAAAKPAEAQKVLVLDRQGDIWAAKGDLQK 179

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           A+  + +     NS   ++   ++ LA + ++
Sbjct: 180 ARDAWTQAQAALNSQDPLNRVLELKLAALPSA 211


>gi|30248177|ref|NP_840247.1| hypothetical protein NE0151 [Nitrosomonas europaea ATCC 19718]
 gi|30180062|emb|CAD84062.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 214

 Score = 81.2 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 64/207 (30%), Gaps = 3/207 (1%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N +        K             I +  +      L++    ++     + +A   + 
Sbjct: 5   NFEEQEKIEGLKSWWAANGTTMLFAIAVFAATVAGNRLWNHYKAEQAQQAADLYAVLQQQ 64

Query: 64  FNSNKL-DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
                       +   +               IA+    +      A   L+ A D    
Sbjct: 65  VEKGSELVKITDAAHLLTEGFPGSGYASRAALIAARAAGQAGNDQVARDMLQWALDHAEE 124

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             ++  A L+ AS+LVD S Y++  K+L    + +        ++ G +    GK  +A+
Sbjct: 125 PEIKDMARLRLASVLVDESKYDQALKLLDA--QHAASFTGLYADLRGDALAAAGKTDEAR 182

Query: 183 TIFEELAKDNNSPFGISTRSQMILANI 209
             +++     N+        QM L  +
Sbjct: 183 AAYQKALDSLNAQGAYRNVVQMKLDVL 209


>gi|327394801|dbj|BAK12223.1| transmembrane protein YfgM [Pantoea ananatis AJ13355]
          Length = 205

 Score = 81.2 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/210 (12%), Positives = 69/210 (32%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  ++ N      +           + +++ ++    +  +    +     V   + + 
Sbjct: 1   MEVYSNENEQVDALRRFFANNGKALAVGVVIGIAALGGWRYWSSHQQDSAKTVSAEYQKV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                + K  +   +     S+++  Y  L+ + +A   V       AA +      D  
Sbjct: 61  TRAMQAGKP-ETLEAVNTFASENSNTYGALAALDLAKQYVDSNQLDKAATLLQNGLKDTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I +  +  +   K L  +            +I G + L  G  Q 
Sbjct: 120 -DANLQAVINLRLARIQLQQNQADAALKTLDSVKGDG--WTAIVADIRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + +  +  ++   +    QM + N+ 
Sbjct: 177 ARDAWSKGVES-DASPALKQMMQMKMNNLS 205


>gi|254523546|ref|ZP_05135601.1| Tetratricopeptide repeat family protein [Stenotrophomonas sp.
           SKA14]
 gi|219721137|gb|EED39662.1| Tetratricopeptide repeat family protein [Stenotrophomonas sp.
           SKA14]
          Length = 212

 Score = 81.2 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/218 (14%), Positives = 74/218 (33%), Gaps = 10/218 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ++   D +    + +             +++ +     +  +      K       + +A
Sbjct: 3   IDDLLDEHEQSERVRSWLRKNGASILGGVVIAIGAIAGWQWYQKDQGGKLASANVEYQKA 62

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L     NKLDDA  + + + +  + +Y  L+ + +A   V  G  + A    L       
Sbjct: 63  LLGLQQNKLDDASKAVKALEAGPSSIYGDLAALQLAKAQVDAGKNEEA----LATLRGVK 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++     + A +LV T   +E  K+L       +     + EI G + +  GK   
Sbjct: 119 VEGDLQRVVDQRVARLLVATGKSDEAIKLL------GSAADSSSLEIHGDALMAQGKRDD 172

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           A+  +E+  K  +         +  + +   +     +
Sbjct: 173 ARAQYEKALKSLDVAAPQRRLLETKVMDAGGTVAAPAE 210


>gi|33593201|ref|NP_880845.1| hypothetical protein BP2197 [Bordetella pertussis Tohama I]
 gi|33563576|emb|CAE42475.1| putative membrane protein [Bordetella pertussis Tohama I]
 gi|332382612|gb|AEE67459.1| hypothetical protein BPTD_2163 [Bordetella pertussis CS]
          Length = 212

 Score = 80.8 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/215 (13%), Positives = 63/215 (29%), Gaps = 6/215 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        +     Y  +   L  +++     +  +      + N     F   
Sbjct: 1   MAYDLEEQEKLDAIRAWWARYGTLILTLATLVVLAWGGWSGWKAYQNYRANQAMGYFEAL 60

Query: 61  LELFNSNKLDDARSSFEK---ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
            +       D A         + +             IA+  +      + A   L+   
Sbjct: 61  EDAARLGGADAATRIKAAAATLRTDYPATGYAGRGALIAAQALQSQQDVDGAREQLEWLA 120

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
                LA++  A L+ A IL+D   Y+       +L+ P         +  G      GK
Sbjct: 121 AQAKQLALQPVARLRLAGILLDQKQYDAALA---QLNNPPASFAALFADRRGDVLAAQGK 177

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
             +A+  ++       +   ++   Q+ L  +  +
Sbjct: 178 RDEARAAWQSAIDGLGTSNPLTQVVQLKLDALSGA 212


>gi|226939616|ref|YP_002794689.1| hypothetical protein LHK_00687 [Laribacter hongkongensis HLHK9]
 gi|226714542|gb|ACO73680.1| Putative membrane protein [Laribacter hongkongensis HLHK9]
          Length = 211

 Score = 80.8 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/198 (12%), Positives = 58/198 (29%), Gaps = 2/198 (1%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K     +     L ++++    + +  +      +       +A               +
Sbjct: 15  KAFWQQWGKWISLAVIVVALGYLGYQGWKYYRSHQAEQAALLYAPVETAVTEGDAGKLVA 74

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
           S + +     K         +A+ +         AE  L+    + A  AV+  A L+ A
Sbjct: 75  SAKALQDAYPKSGYAARASLLAARVAFDKGDTKTAEQELRWVAGNAAEPAVKAVAQLRLA 134

Query: 135 SILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
            + +D    +     L +  + +        E+ G + L  G  Q A+  ++E       
Sbjct: 135 GLQLDAGQTDAALAELARPIDAT--FLPQQLELKGDALLVKGDRQGARVAYQEAIAKLAP 192

Query: 195 PFGISTRSQMILANIIAS 212
                    + L  +   
Sbjct: 193 DAPQQALLNVKLDALGGE 210


>gi|311278556|ref|YP_003940787.1| hypothetical protein Entcl_1236 [Enterobacter cloacae SCF1]
 gi|308747751|gb|ADO47503.1| Protein of unknown function DUF2133 [Enterobacter cloacae SCF1]
          Length = 206

 Score = 80.8 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 74/210 (35%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  ++ N      K           + +++ +   + +  +    E         + Q+
Sbjct: 1   MEIYSNENDQVDAIKRFFSENGIALAVGVILGVGALVGWRYWTSHQENNARDASLAYEQS 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +S K D   ++ +   ++ N  Y   +++ +A   V K   +NA +   +      
Sbjct: 61  VSSLSSGKPDALSAAEKFAAAEKN-TYGAFASLELAQQFVDKNQLENAEKQLQQGLAAAS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    ++ A + +     +   K L+ +            ++ G   L  G  Q 
Sbjct: 120 -DDNLKSVINMRLARVQLQMKQPDAALKTLEGIKGEG--WTAIVADLRGEILLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  +E   K  ++   +S   +M + N+ 
Sbjct: 177 ARAAWEAGVKS-DASPALSEMMRMKMNNLS 205


>gi|209521125|ref|ZP_03269853.1| conserved hypothetical protein [Burkholderia sp. H160]
 gi|209498435|gb|EDZ98562.1| conserved hypothetical protein [Burkholderia sp. H160]
          Length = 209

 Score = 80.8 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/207 (11%), Positives = 60/207 (28%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +      ++L+ L     +  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWKQWGNATTWIVLVALLAGASWNGWNFWQRRQATQAAVLYDQVQQAVA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +            +  +  +           +  +     +  A+  L+   D       
Sbjct: 65  AGDKAQIARVAADMEDKFGRTAYAQMTALGVAKALYAAGDEAGAKAQLQWTIDHAKDDEF 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y++   +L +    S+       +  G      GK   A+  +
Sbjct: 125 KQIAKLRMASLLLDDKAYDQGLALLAE--PQSDAFKGVVADRRGDLLAAQGKRDDARAAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +      + S        Q  L  +  
Sbjct: 183 KLALDSLSKSDTSARQLIQFKLDALGG 209


>gi|253988869|ref|YP_003040225.1| hypothetical protein PAU_01388 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780319|emb|CAQ83480.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 206

 Score = 80.8 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 75/211 (35%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      +             +++     I +  +      +     E F Q 
Sbjct: 1   MEVYTNENEQVDAIRRFFANNGKALVFGLVLGAGALIGWRYWQSHQTNQLQTSAEAFEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                S    ++ ++ EK  S+ N  Y  ++ M +A + V K +   A + FL  A    
Sbjct: 61  NSGLLSGTK-ESNTAVEKFASETNNSYGVMAYMQLAKLAVEKNELAKAEQ-FLSTAVGQT 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    ++ A + +     +   K L+++    +     A ++ G + LK G +  
Sbjct: 119 KSENLQSLVNIRLARVQLAEDKADVALKTLEQVK--GSGWIAVAEDVRGDALLKKGDIAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +     N    I +   + L N+ +
Sbjct: 177 ARAAYTKGLA-ANPSQAIKSMLNLKLNNLSS 206


>gi|238797966|ref|ZP_04641456.1| hypothetical protein ymoll0001_28280 [Yersinia mollaretii ATCC
           43969]
 gi|238718171|gb|EEQ09997.1| hypothetical protein ymoll0001_28280 [Yersinia mollaretii ATCC
           43969]
          Length = 206

 Score = 80.8 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/211 (13%), Positives = 70/211 (33%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +              + QA
Sbjct: 1   MEVYTTDNDQVDAVRRFFSENGKALAVGVVLGIGALVGWRYWQSHQNTAMTEASSAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  ++N  D    + + +    N  Y  L+ + +A   V + +   AA+   +      
Sbjct: 61  SDALSANSADGVTLAEKFVQGNKN-NYGVLAGLELAHHFVEQNEFDKAAQQLTQALGQTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     +E  K L  +          A ++ G + L  G +  
Sbjct: 120 -DENLLSLINLRLARLQLQLKKPDEALKTLDAV--QGEGWTAMAQDVRGDALLSKGDISG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +  +  N+   +    +M L N+ +
Sbjct: 177 ARAAYSKGVES-NASQALQALLRMKLNNLSS 206


>gi|94311042|ref|YP_584252.1| hypothetical protein Rmet_2104 [Cupriavidus metallidurans CH34]
 gi|93354894|gb|ABF08983.1| conserved hypothetical protein [Cupriavidus metallidurans CH34]
          Length = 210

 Score = 80.8 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/214 (15%), Positives = 70/214 (32%), Gaps = 6/214 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K     Y       +++IL     +  +      +       + Q 
Sbjct: 1   MAYDLEEQEQLESLKAWWKQYGNAVTWALIVILLGLAAWSGWGYWQRVQARDASLLYEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKL-YNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
            +   S   D  + +   +  +  +  Y P+S +  A +L   GD   A        +  
Sbjct: 61  TKAAESRDADRVKRAATDLEEKFGRTAYGPMSALVAAKVLYEAGDLAGAKTQLQWAIDHG 120

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
                    A ++ A +L+D  +Y++   +L+   EP+ P      +  G       K +
Sbjct: 121 GDD--YAPLARVRMAGVLLDEKAYDQGLALLKD--EPAAPYAALFADRRGDLLAAQDKRE 176

Query: 180 KAKTIFEELAKDNNSPF-GISTRSQMILANIIAS 212
           +A+T +        S    +    Q  L  + A+
Sbjct: 177 EARTAYRSALDKLGSGEAAMRQIIQFKLDALGAA 210


>gi|318606738|emb|CBY28236.1| mlr7403 protein [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 206

 Score = 80.8 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 71/211 (33%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +              + QA
Sbjct: 1   MEVYTTENDQVDAVRRFFSENGKALAVGVVLGIGALVGWRYWQSHQNTVLTEASSAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  ++N  D    + EK +  +   Y  L+ + +A   V + +   AA    +  +   
Sbjct: 61  SDALSANSADGVAVA-EKFVQSNKNNYGVLAGLELAHHFVEQNEFDKAARQLTQALSQTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     +E  K L  +    +     A ++ G + L  G    
Sbjct: 120 -DENLLSLINLRLARLQLQLKKPDEALKTLDAV--QGDGWTAMAQDVRGDALLSKGDTAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +  +  N+   +    +M L N+ +
Sbjct: 177 ARAAYSKGVES-NASQALQALLRMKLNNLSS 206


>gi|91788468|ref|YP_549420.1| hypothetical protein Bpro_2606 [Polaromonas sp. JS666]
 gi|91697693|gb|ABE44522.1| conserved hypothetical transmembrane protein [Polaromonas sp.
           JS666]
          Length = 231

 Score = 80.4 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/199 (11%), Positives = 59/199 (29%), Gaps = 2/199 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     Y  +    ++ +  +   +  +      +       + +      S     
Sbjct: 14  DELKHFWKQYGDLITWGLIAVFGIFAAWNGYQYWQRSQAAQASVMYDEIERAVQSGDQAR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
              S   +  +  +         +A+         +A+   L    +  +    +  A L
Sbjct: 74  IDRSLADMKDRFGRTTYAQQAGLLAARAYYDKGNLDASRAALTGVAEKASDEGYQAIARL 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L++  +Y+E  + L             A +  G      GK  +A+  +E+  K 
Sbjct: 134 RLAGLLLEKKAYDEALQQLSA--SFPKDFAALAADRRGDILAAQGKKTEARVEYEKAYKG 191

Query: 192 NNSPFGISTRSQMILANII 210
            +         ++ L  + 
Sbjct: 192 LDERAEYRRLVEVKLNALG 210


>gi|300691804|ref|YP_003752799.1| hypothetical protein RPSI07_2160 [Ralstonia solanacearum PSI07]
 gi|299078864|emb|CBJ51525.1| conserved protein of unknown function [Ralstonia solanacearum
           PSI07]
          Length = 211

 Score = 80.4 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/213 (9%), Positives = 68/213 (31%), Gaps = 3/213 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K        +   + +++L     ++ +     K+       + Q 
Sbjct: 1   MAYDLEEQEQLESLKHWWRDNGNVVTWIAIVVLLAVAAWFGWKNWQRKQAGEASVLYEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  ++   +  + +   +  +  +          A+  + + +    A+  L+   D  
Sbjct: 61  QKAVDAKDAEKIKRAAADMEDKFGRTAYAQMAALSAAKALYEANDAAGAKAQLQWTLDHA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           +    +  A L+ A +L+D  +Y++   ++    + +        +  G       K  +
Sbjct: 121 SDDEYKAVAKLRLAGLLLDEKAYDQGLALVSG--DVAPAFAALYADRRGDLLAAQNKKDE 178

Query: 181 AKTIFEELAKD-NNSPFGISTRSQMILANIIAS 212
           A+  ++   +    +        Q  L  +  +
Sbjct: 179 ARAAYKLALEKFGQADASARQIVQFKLDALGGA 211


>gi|270264727|ref|ZP_06192992.1| tetratricopeptide TPR_4 [Serratia odorifera 4Rx13]
 gi|270041410|gb|EFA14509.1| tetratricopeptide TPR_4 [Serratia odorifera 4Rx13]
          Length = 206

 Score = 80.4 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 75/211 (35%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +            +++ +A
Sbjct: 1   MEVYTTENEQVDAVRRFFAENGKALAVGVVLGIGALVGWRFWQNHQNSNMMAASQSYQEA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +   + K DD  S+ E     ++  Y  L+++ +A   V + D   A +  L +A    
Sbjct: 61  SDHLAAGKPDDV-SAAEAFAKANSNSYGVLASLELAKHFVEQNDFAKAEQ-QLVLAQGQT 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +    +L+ A + +     +E  K L  +          A +  G + L  G  + 
Sbjct: 119 KDDNLLAMVSLRLARVQLQEKKLDEALKTLDGVKGEG--WAAMAQDARGDALLAKGDTKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +  +  N+   +    +M L N+ +
Sbjct: 177 AREAYSKGIES-NASQALQVLLRMKLNNLSS 206


>gi|197104997|ref|YP_002130374.1| hypothetical protein PHZ_c1534 [Phenylobacterium zucineum HLK1]
 gi|196478417|gb|ACG77945.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 256

 Score = 80.4 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 74/173 (42%), Gaps = 1/173 (0%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           ++ +D    ++     E +  A E   +     A+  + ++       Y  L+ M + ++
Sbjct: 42  YWGWDTWRSREVAKASEQYQAAGEALAAGDRAKAQQLWTEVSQSSAGGYKSLALMQLGAL 101

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            + +  T  A ++F + A        +  AA L++A  ++DT+ Y+++   L  L +   
Sbjct: 102 NLDENKTDEAVKLFDQ-AASAAPDELIGDAARLKSAFAVLDTAPYKDVEARLTPLIKDGR 160

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           P    A E L  + L  G    A+  F  L +  ++  G+  R+Q  ++ I +
Sbjct: 161 PYRVQAREALAFAKLMAGDTAGARGDFVVLQQMLDASDGVRARAQAAISLIDS 213


>gi|90579363|ref|ZP_01235173.1| hypothetical protein VAS14_06638 [Vibrio angustum S14]
 gi|90440196|gb|EAS65377.1| hypothetical protein VAS14_06638 [Vibrio angustum S14]
          Length = 203

 Score = 80.4 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 37/198 (18%), Positives = 72/198 (36%), Gaps = 8/198 (4%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K           L  ++ L     +  +       K+   +++ Q +   + N  D 
Sbjct: 12  EAIKSWWQENGKAVVLGAVIGLGGLWGWRYYQSEVHAAKHAASDSYTQVVSALDENSKDA 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
              +   I +     Y  L+ + +A + V   D   A      V N+     A+   AT 
Sbjct: 72  VAEAKTFIDANKGSQYAVLTALQLAKVQVDNKDLDGAVTQLQWVLNNTK-DEAILPLATT 130

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A I  +   ++E    L+K++ PS        E+ G   L+ G +  A+  + E  ++
Sbjct: 131 RLARIYAEQQKFDEALAELKKVTVPS--WKSKVAELRGDILLQKGDITGAREAYVEAQQE 188

Query: 192 NNSPFGISTRSQMILANI 209
            +SP       QM L ++
Sbjct: 189 GSSPA-----LQMKLDDL 201


>gi|291085039|ref|ZP_06570911.1| putative inner membrane protein [Citrobacter youngae ATCC 29220]
 gi|291071732|gb|EFE09841.1| putative inner membrane protein [Citrobacter youngae ATCC 29220]
          Length = 221

 Score = 80.4 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 75/210 (35%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E  ++ N      K           + +++ +   + +  +     +        +   
Sbjct: 16  VEIYDNENDQIDAVKRFFAENGKALAVGVILGVGALVGWRYWTSHQTESARSASLAYQNT 75

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   ++ K D    + EK  +++   Y  L+++ +A   V + + + AA    +  +   
Sbjct: 76  VTAVSAGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDQNELEKAASQLQQGLSATS 134

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 135 -DENLKAVINLRLARVQVQLKQADTALKTLDAIKGEG--WTAIVADLRGEALLSKGDKQG 191

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  ++   +S   QM + N+ 
Sbjct: 192 ARSAWEAGVKS-DASPALSEMMQMKINNLS 220


>gi|293604543|ref|ZP_06686948.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292817124|gb|EFF76200.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 212

 Score = 80.4 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/215 (12%), Positives = 64/215 (29%), Gaps = 6/215 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K     Y  +   L  ++      ++ +      + N     F   
Sbjct: 1   MAYDLEEQEKLDAIKAWWARYGTLVVTLFAVVALAWGGWWGWKAYESHRANQAMGYFEAL 60

Query: 61  LELFNSNKLDDA---RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
            +       D A   +++   +  Q            +A+  +        A   L+   
Sbjct: 61  EDAARLGGADSAVRIKTAAATLREQYPATGYAARGALVAAQALQAQKDDAGAREQLEWLA 120

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
                 +++  A L+ A +L+D   Y+       +L+ P         +  G      GK
Sbjct: 121 AQGKNPSMQSVARLRLAGMLLDQKQYDAALA---QLNNPPAAFAALFADRRGDILAAQGK 177

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
             +A+  ++       +   ++   Q+ L  +  +
Sbjct: 178 RDEARAAWQSAIDGLGTANPLTQVVQLKLDALSGA 212


>gi|238027073|ref|YP_002911304.1| hypothetical protein bglu_1g14520 [Burkholderia glumae BGR1]
 gi|237876267|gb|ACR28600.1| Hypothetical protein bglu_1g14520 [Burkholderia glumae BGR1]
          Length = 209

 Score = 80.4 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/207 (11%), Positives = 60/207 (28%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   ++  +L +A  +  ++     +       +    +  +
Sbjct: 5   DEQESIESVKAWWARWGDLTTWILTAVLVVAAAWNGWNYWQRHQAAQASGLYEAVQQAVS 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           S        +   +  +  +          A+  +        A+  L+   D     A 
Sbjct: 65  SGDKAKIARAASDMEDKYGRTAYAQMTALAAAKALYMAGDTAGAKAQLQWTIDHAQDDAY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L++  +Y+    +L     P +       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLEEKAYDAGLALLSG--TPDDGFKGLVADRRGDLLAAQGKRGDARAAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +                 Q  L  + +
Sbjct: 183 QLALDALPKEDASARRLVQFKLDALGS 209


>gi|238794828|ref|ZP_04638429.1| hypothetical protein yinte0001_7860 [Yersinia intermedia ATCC
           29909]
 gi|238725841|gb|EEQ17394.1| hypothetical protein yinte0001_7860 [Yersinia intermedia ATCC
           29909]
          Length = 206

 Score = 80.4 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 70/211 (33%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +              + QA
Sbjct: 1   MEVYTTENDQVDAVRRFFSENGKALAVGVVLGIGALVGWRYWQSHQNTVLTEASSAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               ++N  D    + EK +  +N  Y  L+ + +A   V +     AA+   +      
Sbjct: 61  SNALSANSADGVAFA-EKFVQGNNNNYGVLAGLELAHHFVEQNVFDKAAQQLTQALGQTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     ++  K L  +    +     A ++ G + L  G    
Sbjct: 120 -DENLLSLINLRLARLQLQLKKPDDALKTLDAV--QGDGWTAMAQDVRGDALLSKGDTAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +  +  N+   +    +M L N+ +
Sbjct: 177 ARAAYSKGVES-NASQALQALLRMKLNNLSS 206


>gi|123441420|ref|YP_001005407.1| hypothetical protein YE1075 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088381|emb|CAL11172.1| putative membrane protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 206

 Score = 80.4 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 71/211 (33%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +              + QA
Sbjct: 1   MEVYTTENDQVDAVRRFFSENGKALAVGVVLGIGALVGWRYWQSHQNTVLTEASSAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  ++N  D    + EK +  +   Y  L+ + +A   V + +   AA+   +      
Sbjct: 61  SDALSANSADGVAVA-EKFVQSNKNNYGVLAGLELAHHFVEQNEFDKAAQQLTQALGQTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     +E  K L  +    +     A ++ G + L  G    
Sbjct: 120 -DENLLSLINLRLARLQLQLKKPDEALKTLDAV--QGDGWTAMAQDVRGDALLSKGDTAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +  +  N+   +    +M L N+ +
Sbjct: 177 ARAAYSKGVES-NASQALQALLRMKLNNLSS 206


>gi|53802990|ref|YP_115283.1| hypothetical protein MCA2890 [Methylococcus capsulatus str. Bath]
 gi|53756751|gb|AAU91042.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath]
          Length = 211

 Score = 80.0 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 69/210 (32%), Gaps = 4/210 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K             + + +++ + +  +  S E+K  + G  + Q 
Sbjct: 1   MEVYLTEEERLEALKRWWKANANSIVWGVALGIAVIVGWGAWKRSQEEKALLGGTLYQQL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L+   + + + A    E+I  Q                L  +      A+  L+      
Sbjct: 61  LDAVANKQTEAAVQLGERISQQFPGSAYDTYGKLFLVRLKVEAGDLAGAKTQLQQLIATT 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   A L+ A I +     EE  ++ + L+  +        E+ G   L   + ++
Sbjct: 121 KDEKILQIARLRLAEIQLGLGETEEALRLAESLTGSTPESAALREELKGDVYLAMNRPEE 180

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + +  +D      +    ++ L ++ 
Sbjct: 181 ARAAYLKARRDGQPSPLL----ELKLTDLG 206


>gi|332162634|ref|YP_004299211.1| hypothetical protein YE105_C3014 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325666864|gb|ADZ43508.1| hypothetical protein YE105_C3014 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 206

 Score = 80.0 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 72/211 (34%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +              + QA
Sbjct: 1   MEVYTTENDQVDAVRRFFSENGKALAVGVVLGIGALVGWRYWQSHQNTVLTEASSAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  ++N  D    + EK +  +   Y  L+ + +A   V + +   AA+   +  +   
Sbjct: 61  SDALSANSADGVAVA-EKFVQSNKNNYGVLAGLELAHHFVEQNEFDKAAQQLTQALSQTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     +E  K L  +    +     A ++ G + L  G    
Sbjct: 120 -DENLLSLINLRLARLQLQLKKPDEALKTLDAV--QGDGWTAMAQDVRGDALLSKGDTAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +  +  N+   +    +M L N+ +
Sbjct: 177 ARAAYSKGVES-NASQALQALLRMKLNNLSS 206


>gi|110806444|ref|YP_689964.1| hypothetical protein SFV_2560 [Shigella flexneri 5 str. 8401]
 gi|110615992|gb|ABF04659.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|332754200|gb|EGJ84568.1| hypothetical protein SF434370_2727 [Shigella flexneri 4343-70]
 gi|333001734|gb|EGK21300.1| hypothetical protein SFK218_3509 [Shigella flexneri K-218]
 gi|333002308|gb|EGK21872.1| hypothetical protein SFK272_3305 [Shigella flexneri K-272]
 gi|333016131|gb|EGK35463.1| hypothetical protein SFK227_3142 [Shigella flexneri K-227]
          Length = 206

 Score = 80.0 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 72/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           +  ++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGGILGVGALIGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|190574022|ref|YP_001971867.1| putative transmembrane protein [Stenotrophomonas maltophilia K279a]
 gi|190011944|emb|CAQ45565.1| putative transmembrane protein [Stenotrophomonas maltophilia K279a]
          Length = 212

 Score = 80.0 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/218 (15%), Positives = 74/218 (33%), Gaps = 10/218 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ++   D +    + +             + + +     +  +      K       + +A
Sbjct: 3   IDDLLDEHEQSERVRSWLRKNGASILGGVAIAIGAIAGWQWYQKDQGGKLASANVEYQKA 62

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L     NKLDDA  + + + +  + +Y  L+ + +A   V  G  + A    L       
Sbjct: 63  LVGLQQNKLDDAAKAVKALEAGPSSIYGDLAALQLAKAQVDAGKNEEA----LATLRAVK 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  A  + A +LV T   +E  K+L       +     + EI G + +  GK   
Sbjct: 119 VESDLQRVADQRVARLLVATGKSDEAIKLL------GSATDSSSLEIHGDALMAQGKRDD 172

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
           A+  +E+  K  +         +  + +   +     +
Sbjct: 173 ARAQYEKALKSLDVAAPQRRLLETKVMDAGGTVAAPAE 210


>gi|330446669|ref|ZP_08310321.1| histidyl-tRNA synthetase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490860|dbj|GAA04818.1| histidyl-tRNA synthetase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 203

 Score = 80.0 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 74/198 (37%), Gaps = 8/198 (4%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K           L  ++ L     +  +       K++  +++ Q +   + N  D 
Sbjct: 12  EAIKSWWQENGKAVVLGAVIGLGGLWGWRYYQSEVHAAKHVASDSYTQVVSALDENSKDA 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
              +   I +     Y  L+ + +A + V   D   A E    V N+     A+   AT 
Sbjct: 72  VAEAKTFIDANKGSQYAVLTALQLAKVQVENKDLNGAVEQLQWVLNNTK-DEAILPLATT 130

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A I  +   ++E    L+K++ PS        E+ G   L+ G +  A+  + E  +D
Sbjct: 131 RLARIYAEQQKFDEALAELKKVTVPS--WKSKVAELRGDILLQKGDITGAREAYVEAQQD 188

Query: 192 NNSPFGISTRSQMILANI 209
            +SP       QM L ++
Sbjct: 189 GSSPA-----LQMKLDDL 201


>gi|238763552|ref|ZP_04624513.1| hypothetical protein ykris0001_7670 [Yersinia kristensenii ATCC
           33638]
 gi|238698184|gb|EEP90940.1| hypothetical protein ykris0001_7670 [Yersinia kristensenii ATCC
           33638]
          Length = 206

 Score = 80.0 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/211 (13%), Positives = 69/211 (32%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +              + QA
Sbjct: 1   MEVYTTDNDQVDAVRRFFSENGKALAVGVVLGIGALVGWRYWQSHQNTVLTEASSAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +   +N  D    + + +    N  Y  L+ + +A   V + +   AA+   +      
Sbjct: 61  SDALLANSADSVALAEKFVQGNKN-NYGVLAGLELAHHFVEQNEFDKAAQQLTQALGQTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     +E  K L  +    +     A ++ G + L  G    
Sbjct: 120 -DENLLSLINLRLARLQLQLKKPDEALKTLDAV--QGDGWTAMAQDVRGDALLSKGDTAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +  +  N+   +    +M L N+ +
Sbjct: 177 ARAAYSKGVES-NASQALQALLRMKLNNLSS 206


>gi|78484968|ref|YP_390893.1| hypothetical protein Tcr_0623 [Thiomicrospira crunogena XCL-2]
 gi|78363254|gb|ABB41219.1| conserved hypothetical protein [Thiomicrospira crunogena XCL-2]
          Length = 213

 Score = 80.0 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/213 (12%), Positives = 66/213 (30%), Gaps = 2/213 (0%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M             K             IL+I+     +  +  +   K       F   
Sbjct: 1   MSRYETDEEQVEAIKSWWKKNGTQLLSGILVIVLAWTGWTYWQNTQTTKALNASAVFEVM 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               + N L D      K++ +            + +         + A    +   +  
Sbjct: 61  QVKQSQNALGDVLRDGLKLMEEQPDSPYASGVALMIAKHYFDEKAFDKAIENYQWTIEHA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEP--SNPMHQFANEILGISALKFGKV 178
              +++  A L+  ++ V    +E+  ++L  + +   S       +  +   AL  G +
Sbjct: 121 PDHSIQLIARLRLVTVYVQEKMFEKADQVLAGVDQKALSLAEKGNYDFQVAELALTEGDL 180

Query: 179 QKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
            +AK  +  +  +  +P  +   +++ LA++  
Sbjct: 181 SQAKEAYNRVISNAEAPESVQNLARLKLADLAG 213


>gi|254449221|ref|ZP_05062670.1| conserved hypothetical protein [gamma proteobacterium HTCC5015]
 gi|198261198|gb|EDY85494.1| conserved hypothetical protein [gamma proteobacterium HTCC5015]
          Length = 220

 Score = 79.7 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 69/207 (33%), Gaps = 3/207 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K         A L +++ LS    +Y +      ++      F + L     +  D+
Sbjct: 13  EALKRWWSENAVSAVLGVVLGLSGLFGWYQWQDYQGGQQAGASAVFTELLRGVQEDNTDN 72

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A +  ++++S     +        A+ +  +      A   L+   D+ +       ATL
Sbjct: 73  APALADQLVSDYAGTHYANLGQLAAARVAVEAGDLETAASRLQWVVDNASASHFEQVATL 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A + +      +  ++L       +     A E+ G  A+  G    A+  ++     
Sbjct: 133 RLAQLALGQDQLAKAEQLLSG--TFPSSYMAIAEELRGDLAVAQGDSNAARVAYDRALN- 189

Query: 192 NNSPFGISTRSQMILANIIASDQRNKK 218
              P     R +M   N+   D  N +
Sbjct: 190 AELPLQNPMRVEMKRDNLGNVDLTNTE 216


>gi|218548050|ref|YP_002381841.1| hypothetical protein EFER_0659 [Escherichia fergusonii ATCC 35469]
 gi|218355591|emb|CAQ88202.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
 gi|324113007|gb|EGC06983.1| yfgM [Escherichia fergusonii B253]
 gi|325496454|gb|EGC94313.1| hypothetical protein ECD227_0551 [Escherichia fergusonii ECD227]
          Length = 206

 Score = 79.7 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 72/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++    +        +  A
Sbjct: 1   MEIYENENDQVDAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVETARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   ++ K +    + + +    N  Y  L+++ +A   V K + + A     +      
Sbjct: 61  VTEASAGKPEGIVVAEKFVTENKN-TYGALASLELAQQFVDKNELQKAEAQLQQGLTATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  ++   +S   +M + N+ 
Sbjct: 177 ARSAWEAGVKS-DASPALSEMMRMKINNLS 205


>gi|312884306|ref|ZP_07744015.1| hypothetical protein VIBC2010_11051 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368079|gb|EFP95622.1| hypothetical protein VIBC2010_11051 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 204

 Score = 79.7 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 71/209 (33%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +       + K     Y  +     ++ L     +  +  S    +    +++   
Sbjct: 1   MELYDTEEQQIERIKELWNEYGKVIVASAVIGLGGLFGWNQYQDSVIATQEATSDSYVAV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +E      +  A      I       Y+ L+ + +A + V  G+   A    L+ A    
Sbjct: 61  IEELADKGVSAANDVQTFIDDNQKTQYSVLAALQLAKLQVEAGNLDEAL-AQLEWAKSAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+      + A + ++  +Y+     L  + +          E+ G   L+ G  + 
Sbjct: 120 QDTAISAVILHRLARLKLEQGNYDAALAELNLVKDQGWAGRV--AELKGDIFLRQGNTEA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A T + E  +D ++   +    QM L ++
Sbjct: 178 AYTAYTEAQQDGDASQTL----QMKLDDL 202


>gi|296446240|ref|ZP_06888187.1| Protein of unknown function DUF2133 [Methylosinus trichosporium
           OB3b]
 gi|296256277|gb|EFH03357.1| Protein of unknown function DUF2133 [Methylosinus trichosporium
           OB3b]
          Length = 241

 Score = 79.7 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 39/208 (18%), Positives = 84/208 (40%), Gaps = 1/208 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + +       Y+    +   +I++    +  ++    +      + +  A EL 
Sbjct: 8   VDEDVRRDQAANLWKRYRTPVIVAAALIVAGTAAWSFYENKRLEAAFAANQRYGAAAELA 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            + K  +A ++FE +  +  K Y  L+ +  A  L      + A   F  VA D      
Sbjct: 68  AAGKSAEAAAAFEAVAKETPKGYATLARLRAAEELAKSDK-EKALAAFDAVAQDKSVDRL 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            +  A L+A  + ++     ++   L +L     P    A E++G+ AL  G   +A+ +
Sbjct: 127 TQEVAKLRAGLVALEQGDRSKMVDRLGELVTSDGPFRYTAQELIGLDALNDGDFDEAQRV 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIAS 212
           F+ L  + ++P  +  R+    A + A+
Sbjct: 187 FKLLLDNLDAPHAMRQRASAYQALLNAA 214


>gi|271501569|ref|YP_003334595.1| hypothetical protein Dd586_3054 [Dickeya dadantii Ech586]
 gi|270345124|gb|ACZ77889.1| Protein of unknown function DUF2133 [Dickeya dadantii Ech586]
          Length = 206

 Score = 79.7 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 20/211 (9%), Positives = 60/211 (28%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +    E         + Q 
Sbjct: 1   MEVYTTENEQVEVIRRFFVENGKALAIGVVLGVGALVGWRFWQNHQESSAMAASAAYQQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E  ++   +    + + +           +       +          ++ L ++    
Sbjct: 61  TESLSAGTAEGVAGAQKFVAGDHGNYAALTALALAHQFVEKNDIANAEQQLRLALSQTKD 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A +L+     +E  K L  +            ++ G      G  Q 
Sbjct: 121 GD--LQALINLRLARVLLQQKKPDEALKTLDAIKLEG--WAAMVADVRGDVLASKGDNQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +         G+ +  ++ L N+ +
Sbjct: 177 ARDAYSKGMA-AKPSQGLQSLLRIKLNNLPS 206


>gi|194290004|ref|YP_002005911.1| hypothetical protein RALTA_A1907 [Cupriavidus taiwanensis LMG
           19424]
 gi|193223839|emb|CAQ69848.1| conserved hypothetical protein yfgM [Cupriavidus taiwanensis LMG
           19424]
          Length = 210

 Score = 79.7 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 30/213 (14%), Positives = 73/213 (34%), Gaps = 4/213 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K     Y       +++ L     +  +     K+       + Q 
Sbjct: 1   MAYDLEEQEQLENLKAWWRQYGNALTWALIVALLAFAGWNGWKYWERKQAGEAAVLYEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +   +  + +   +  +  +      +  +AS ++      +AA+  L+ A D  
Sbjct: 61  MKAAEARDAERIKRAATDLEGKYGRTAYGQMSALVASRVLYDAGDLSAAKSQLQWAIDHG 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A  + A ++ A +L+D  +Y++   +L+   EP         +  G       K   
Sbjct: 121 -DEAYSHLARVRLAGVLLDEKAYDQGLALLKD--EPPAAFVALYADRRGDLLAAQDKRDD 177

Query: 181 AKTIFEELAK-DNNSPFGISTRSQMILANIIAS 212
           A+T + +       +  G+    Q  L  + A+
Sbjct: 178 ARTAYRKALDTLGQAEAGMRQIIQFKLDALGAA 210


>gi|24113842|ref|NP_708352.1| hypothetical protein SF2559 [Shigella flexneri 2a str. 301]
 gi|30063905|ref|NP_838076.1| hypothetical protein S2731 [Shigella flexneri 2a str. 2457T]
 gi|82544962|ref|YP_408909.1| hypothetical protein SBO_2537 [Shigella boydii Sb227]
 gi|24052933|gb|AAN44059.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30042160|gb|AAP17886.1| hypothetical protein S2731 [Shigella flexneri 2a str. 2457T]
 gi|81246373|gb|ABB67081.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|281601915|gb|ADA74899.1| conserved hypothetical protein [Shigella flexneri 2002017]
 gi|313650999|gb|EFS15399.1| UPF0070 protein yfgM [Shigella flexneri 2a str. 2457T]
 gi|332755563|gb|EGJ85927.1| hypothetical protein SFK671_3110 [Shigella flexneri K-671]
 gi|332756318|gb|EGJ86669.1| hypothetical protein SF274771_3063 [Shigella flexneri 2747-71]
 gi|332766346|gb|EGJ96556.1| hypothetical protein SF293071_3050 [Shigella flexneri 2930-71]
 gi|333016243|gb|EGK35574.1| hypothetical protein SFK304_3329 [Shigella flexneri K-304]
          Length = 206

 Score = 79.7 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 71/210 (33%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           +  ++ +     +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGGILGVGALTGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +  K D    + EK  +++   Y  L+++ +A   V K + + AA    +   D  
Sbjct: 61  VTAVSEGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  +    +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DVTPALSEMMQMKINNLS 205


>gi|16125898|ref|NP_420462.1| hypothetical protein CC_1652 [Caulobacter crescentus CB15]
 gi|221234661|ref|YP_002517097.1| hypothetical protein CCNA_01724 [Caulobacter crescentus NA1000]
 gi|13423058|gb|AAK23630.1| hypothetical protein CC_1652 [Caulobacter crescentus CB15]
 gi|220963833|gb|ACL95189.1| hypothetical membrane associated protein [Caulobacter crescentus
           NA1000]
          Length = 250

 Score = 79.7 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 40/181 (22%), Positives = 80/181 (44%), Gaps = 4/181 (2%)

Query: 33  LSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSN 92
           + +  ++  +        +   + +  AL+   +     A + F+ +   + K Y  L+ 
Sbjct: 37  IGVGGYW-GWTSYQTGLTDKASQAYQAALQTAQTQGPAKAFAGFKAVADTNAKGYKSLAL 95

Query: 93  MYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQK 152
           M + +I + +  T+ A   F + A        +   A L++A  L+DT+SY++I   L  
Sbjct: 96  MQMGAIRLEEKKTQEAVGYFDE-AAKVAPSPMIGDLARLKSAFALMDTASYKDIETRLTP 154

Query: 153 LSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK--DNNSPFGISTRSQMILANII 210
           L+   +P   +A E L  + L+ G +  A++ F  LA   D N+   I  R+Q  +  I 
Sbjct: 155 LAGEKSPYRVYAKEALAFAKLQAGDLAGARSEFVILANSLDANTSEAIRQRAQAAMQLID 214

Query: 211 A 211
           +
Sbjct: 215 S 215


>gi|283786129|ref|YP_003365994.1| hypothetical protein ROD_24561 [Citrobacter rodentium ICC168]
 gi|282949583|emb|CBG89201.1| putative membrane protein [Citrobacter rodentium ICC168]
          Length = 206

 Score = 79.7 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/210 (15%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  +     +       ++   
Sbjct: 1   MEMYENENDQVEAIKRFFAENGKALAVGVILGVGALIGWRYWTSHQTESARSASLSYQNV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   N+ K ++  ++ EK  +++   Y  L++M +A   V +     A     +      
Sbjct: 61  VSSLNAGKAENLTTA-EKFAAENKNTYGALASMELAQQFVERSQLDKAVAQLQQGLAATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++   +L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVISLRLARVQVQLKQADTALKTLDTIKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E       SP  +S   QM + N+ 
Sbjct: 177 ARSAWEAGVNSKASPA-LSEMLQMKINNLS 205


>gi|170023541|ref|YP_001720046.1| hypothetical protein YPK_1295 [Yersinia pseudotuberculosis YPIII]
 gi|169750075|gb|ACA67593.1| conserved hypothetical protein [Yersinia pseudotuberculosis YPIII]
          Length = 211

 Score = 79.7 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/215 (14%), Positives = 69/215 (32%), Gaps = 8/215 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKW-IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ 59
           ME     N      +         +A  ++L I +L  W   + G+           + +
Sbjct: 1   MEVYTTENDQVDAVRRFFSENGKALAVGVVLGIGALVGWR-YWQGNQNTVMTEASSAYQK 59

Query: 60  ---ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
              AL   ++  +     +  +   Q NK    +      +    + +  + A   L  A
Sbjct: 60  VSTALSTNSAGNVSADSIALAEKFVQSNKNNYGVLVGLELAHDFVEQNAFDKAAQQLSQA 119

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
                   +     L+ A + +     +E  K L  +    +     A ++ G + L  G
Sbjct: 120 LGQTKDENLLSLINLRLARVQLQLKKPDEALKTLDAV--QGDGWTAMAQDVRGDALLSKG 177

Query: 177 KVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
               A+  + +  +  N+   +    +M L N+ +
Sbjct: 178 DTAGARAAYSKAIES-NASQALQALLRMKLNNLSS 211


>gi|22125254|ref|NP_668677.1| hypothetical protein y1355 [Yersinia pestis KIM 10]
 gi|45442515|ref|NP_994054.1| hypothetical protein YP_2743 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597155|ref|YP_071346.1| hypothetical protein YPTB2839 [Yersinia pseudotuberculosis IP
           32953]
 gi|108808311|ref|YP_652227.1| hypothetical protein YPA_2317 [Yersinia pestis Antiqua]
 gi|108811424|ref|YP_647191.1| hypothetical protein YPN_1261 [Yersinia pestis Nepal516]
 gi|145599494|ref|YP_001163570.1| hypothetical protein YPDSF_2222 [Yersinia pestis Pestoides F]
 gi|149365337|ref|ZP_01887372.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|153948923|ref|YP_001400169.1| hypothetical protein YpsIP31758_1188 [Yersinia pseudotuberculosis
           IP 31758]
 gi|162419351|ref|YP_001605022.1| hypothetical protein YpAngola_A0416 [Yersinia pestis Angola]
 gi|165925919|ref|ZP_02221751.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165937074|ref|ZP_02225639.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166008103|ref|ZP_02229001.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212296|ref|ZP_02238331.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167398834|ref|ZP_02304358.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421303|ref|ZP_02313056.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167423399|ref|ZP_02315152.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167470076|ref|ZP_02334780.1| hypothetical protein YpesF_19823 [Yersinia pestis FV-1]
 gi|186896250|ref|YP_001873362.1| membrane protein [Yersinia pseudotuberculosis PB1/+]
 gi|218929937|ref|YP_002347812.1| hypothetical protein YPO2877 [Yersinia pestis CO92]
 gi|229838456|ref|ZP_04458615.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229895158|ref|ZP_04510334.1| conserved protein [Yersinia pestis Pestoides A]
 gi|229899023|ref|ZP_04514167.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901681|ref|ZP_04516803.1| conserved protein [Yersinia pestis Nepal516]
 gi|270489876|ref|ZP_06206950.1| conserved hypothetical protein [Yersinia pestis KIM D27]
 gi|294504561|ref|YP_003568623.1| hypothetical protein YPZ3_2451 [Yersinia pestis Z176003]
 gi|21958125|gb|AAM84928.1|AE013738_5 hypothetical protein y1355 [Yersinia pestis KIM 10]
 gi|45437380|gb|AAS62931.1| putative membrane protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|51590437|emb|CAH22077.1| putative membrane protein [Yersinia pseudotuberculosis IP 32953]
 gi|108775072|gb|ABG17591.1| membrane protein [Yersinia pestis Nepal516]
 gi|108780224|gb|ABG14282.1| putative membrane protein [Yersinia pestis Antiqua]
 gi|115348548|emb|CAL21488.1| putative membrane protein [Yersinia pestis CO92]
 gi|145211190|gb|ABP40597.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149291750|gb|EDM41824.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|152960418|gb|ABS47879.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           31758]
 gi|162352166|gb|ABX86114.1| conserved hypothetical protein [Yersinia pestis Angola]
 gi|165914937|gb|EDR33549.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165922123|gb|EDR39300.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165992485|gb|EDR44786.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206227|gb|EDR50707.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960792|gb|EDR56813.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167051338|gb|EDR62746.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057569|gb|EDR67315.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|186699276|gb|ACC89905.1| membrane protein [Yersinia pseudotuberculosis PB1/+]
 gi|229681610|gb|EEO77704.1| conserved protein [Yersinia pestis Nepal516]
 gi|229687968|gb|EEO80040.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229694822|gb|EEO84869.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701920|gb|EEO89943.1| conserved protein [Yersinia pestis Pestoides A]
 gi|262362444|gb|ACY59165.1| hypothetical protein YPD4_2258 [Yersinia pestis D106004]
 gi|262366549|gb|ACY63106.1| hypothetical protein YPD8_2431 [Yersinia pestis D182038]
 gi|270338380|gb|EFA49157.1| conserved hypothetical protein [Yersinia pestis KIM D27]
 gi|294355020|gb|ADE65361.1| hypothetical protein YPZ3_2451 [Yersinia pestis Z176003]
 gi|320016013|gb|ADV99584.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 211

 Score = 79.7 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/215 (14%), Positives = 69/215 (32%), Gaps = 8/215 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKW-IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ 59
           ME     N      +         +A  ++L I +L  W   + G+           + +
Sbjct: 1   MEVYTTENDQVDAVRRFFSENGKALAVGVVLGIGALVGWR-YWQGNQNTAMTEASSAYQK 59

Query: 60  ---ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
              AL   ++  +     +  +   Q NK    +      +    + +  + A   L  A
Sbjct: 60  VSTALSTNSAGNVSADSIALAEKFVQSNKNNYGVLVGLELAHDFVEQNAFDKAAQQLSQA 119

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
                   +     L+ A + +     +E  K L  +    +     A ++ G + L  G
Sbjct: 120 LGQTKDENLLSLINLRLARVQLQLKKPDEALKTLDAV--QGDGWTAMAQDVRGDALLSKG 177

Query: 177 KVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
               A+  + +  +  N+   +    +M L N+ +
Sbjct: 178 DTAGARAAYSKAIES-NASQALQALLRMKLNNLSS 211


>gi|300717949|ref|YP_003742752.1| hypothetical protein [Erwinia billingiae Eb661]
 gi|299063785|emb|CAX60905.1| Conserved uncharacterized protein [Erwinia billingiae Eb661]
          Length = 206

 Score = 79.3 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/211 (13%), Positives = 70/211 (33%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  ++ N      +           + +++ +     +  +    +         + Q 
Sbjct: 1   MEVYSNENEQVDALRGFFAQNGKALVIGVIIGIGALAGWRYWSSHEDGSSRETSAAYQQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               +S+K  +  ++  K  S+++  Y  L+++ +A           AA        D  
Sbjct: 61  SGALDSSKP-ETLAAAAKFASENSNTYGALASLDVAKRYADGNQLDQAAAQLQSGLKDTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I +     +E  K L  +            ++ G + L  G  + 
Sbjct: 120 -DANLQAVLNLRLARIQLQQKKPDEAVKTLDLIKGDG--WTAIVADVRGEALLSKGDTKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A   + +   D+++   +    QM + N+  
Sbjct: 177 AHDAWSKGI-DSDASPALKEMLQMKMNNLPG 206


>gi|295689709|ref|YP_003593402.1| hypothetical protein Cseg_2324 [Caulobacter segnis ATCC 21756]
 gi|295431612|gb|ADG10784.1| Protein of unknown function DUF2133 [Caulobacter segnis ATCC 21756]
          Length = 249

 Score = 79.3 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 75/174 (43%), Gaps = 2/174 (1%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           ++ +      + +   E +  ALE   +     A   F+ +     + Y  L+ + +  I
Sbjct: 42  YWGWKSYQTSQADRASEAYQAALETAQTAGPAKAFGQFKAVADGGARGYKALALLQMGDI 101

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            + +  TK A   F + A        +   A L++A  L+DT+SY++I   L  L+   +
Sbjct: 102 RIEENKTKEAVAYFDE-AAKAAPDAILGDLARLKSAFALMDTASYKDIESRLTPLAGEKS 160

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKD-NNSPFGISTRSQMILANIIA 211
           P   +A E L  + L+ G V  A+  F  LA   +N+   +  R+Q  +  I +
Sbjct: 161 PYRVYAKEALAFAKLQAGDVAGARGDFVVLANSLDNTSEEVRQRAQAAMQLIDS 214


>gi|99080830|ref|YP_612984.1| hypothetical protein TM1040_0989 [Ruegeria sp. TM1040]
 gi|99037110|gb|ABF63722.1| hypothetical protein TM1040_0989 [Ruegeria sp. TM1040]
          Length = 222

 Score = 79.3 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/209 (18%), Positives = 81/209 (38%), Gaps = 4/209 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +  +    Y WI    +L+I+  A W    +         VG+  + AL    ++  
Sbjct: 16  RRDRLFLMLKRYGWIGAAAVLLIVGGASWREYSNAKAVGAAQDVGDKISAAL----ASDA 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
            +AR++    +S D      + +   A+ LV  G+ + AA +   +A +       R  A
Sbjct: 72  PEARAAALAEISADQAGAQAVVDFAQAAALVDAGEVEQAAALLDGIAQNGDLAQVYRDIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             ++ ++  +T + EE    L+ L+     M   A+E L +  ++ G+   A     ++A
Sbjct: 132 AFKSVTLQAETLAPEERRLRLETLAAAGGTMQFLASEQLALLDIEEGETDAALARLRDIA 191

Query: 190 KDNNSPFGISTRSQMILANIIASDQRNKK 218
                   +  R   ++  +  S     +
Sbjct: 192 ASAGVSRDLQERVSQVIVALGGSLDEAAQ 220


>gi|238788168|ref|ZP_04631963.1| hypothetical protein yfred0001_36160 [Yersinia frederiksenii ATCC
           33641]
 gi|238723755|gb|EEQ15400.1| hypothetical protein yfred0001_36160 [Yersinia frederiksenii ATCC
           33641]
          Length = 206

 Score = 79.3 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 71/210 (33%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +              + QA
Sbjct: 1   MEVYTTENDQVDAVRRFFSENGKALAVGVVLGIGALVGWRYWQSHQNSAMTEASSAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  ++N  D    + EK +  +N  Y  L+ + +A   V + +   AA+   +      
Sbjct: 61  SDALSANSADGVALA-EKFVQGNNNNYGVLAGLELAHHFVEQNEFDKAAQQLTQALGQTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     +E  K L  +    +     A ++ G + L  G    
Sbjct: 120 -DENLLSLINLRLARLQLQLKKPDEALKTLDAV--QGDGWTAMAQDVRGDALLSKGDTAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + +  +  N+   +    +M L N+ 
Sbjct: 177 ARAAYSKGVES-NASQALQALLRMKLNNLS 205


>gi|89072704|ref|ZP_01159269.1| hypothetical protein SKA34_19279 [Photobacterium sp. SKA34]
 gi|89051524|gb|EAR56978.1| hypothetical protein SKA34_19279 [Photobacterium sp. SKA34]
          Length = 203

 Score = 78.9 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 74/198 (37%), Gaps = 8/198 (4%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K           L  ++ L     +  +       K+I  +N+ Q +   + N  D 
Sbjct: 12  EAIKSWWQENGKAVVLGAVIGLGGLWGWRYYQSEVHVAKHIASDNYTQVVSALDENSKDA 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
              +   I +  +  Y  L+ + +A + V   D   A E    V  +     A+   AT 
Sbjct: 72  VAEAKTFIDANKDSQYAVLTALQLAKVQVDNKDLDGAVEQLQWVI-NHTKDEAILPLATT 130

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A I  +   ++E    L+K++ PS        E+ G   L+ G +  A+  + E  ++
Sbjct: 131 RLARIYAEQQKFDEALAELKKVTVPS--WKSKVAELRGDILLQKGDINGAREAYVEAQQE 188

Query: 192 NNSPFGISTRSQMILANI 209
            +SP       QM L ++
Sbjct: 189 GSSPA-----LQMKLDDL 201


>gi|121593584|ref|YP_985480.1| hypothetical protein Ajs_1172 [Acidovorax sp. JS42]
 gi|120605664|gb|ABM41404.1| conserved hypothetical protein [Acidovorax sp. JS42]
          Length = 225

 Score = 78.9 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/200 (12%), Positives = 60/200 (30%), Gaps = 2/200 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     +       +++I+     +  +     ++                +  L  
Sbjct: 14  EQIKHFWNTWGTPITWALIVIMGGLAAWNGYRLWQGRQAQQATALAEAVEMAVQAGDLAR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
              +   + S             +A+  +A     +AA+  L    +  +    +  A L
Sbjct: 74  VEQAVGDLKSSYGGTAQAWQAGLLAAKALADAGKWDAAKSTLAWVAEKASDEGYQALARL 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + AS+L++  +Y+E S  L    +          +  G      GK Q+A   +    + 
Sbjct: 134 RLASVLIEQKAYDEASAQLSG--KFPAEFAATVADRKGDVFALQGKKQEAIAEYRRAYQA 191

Query: 192 NNSPFGISTRSQMILANIIA 211
            +         +  L  + A
Sbjct: 192 FDERVEYRRLVEAKLNALGA 211


>gi|261345332|ref|ZP_05972976.1| putative membrane protein [Providencia rustigianii DSM 4541]
 gi|282566666|gb|EFB72201.1| putative membrane protein [Providencia rustigianii DSM 4541]
          Length = 207

 Score = 78.9 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 24/212 (11%), Positives = 67/212 (31%), Gaps = 5/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +     +  +              +   
Sbjct: 1   MEVYTNENDQVDAVKRFFANNGVALVIGLVIGVGGVFGWNYWQSHKSNVLQESAAKYESV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               ++        + +K  ++ + +Y+ +  + +A + V KGD  +A +          
Sbjct: 61  STQLHTGS-AQGIEAAKKFAAETDDVYSAMMGLELAQVSVDKGDLASADKALTDALAKAK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
             + ++    L+ A + +   + +     + K+          A ++ G + L  G    
Sbjct: 120 T-VDMQDVINLRLARVQLAQGNADAALASIAKI--QGKSWQAAAQDVRGDALLHKGDKSG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           AK  + +  +       +     + L N+  S
Sbjct: 177 AKAAYTQGLESEG-SQSLRGLLTLKLNNVSNS 207


>gi|290475997|ref|YP_003468893.1| hypothetical protein XBJ1_3005 [Xenorhabdus bovienii SS-2004]
 gi|289175326|emb|CBJ82129.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004]
          Length = 206

 Score = 78.9 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 74/211 (35%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K           + +++ + +   ++ +      +       F + 
Sbjct: 1   MEVYTTETEQIDVIKRFFANNGKYLAVGLVLGIGVLAGWHYWQSHQTNQLQDTAATFEKL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +   S    ++  + EK  ++ N +Y  +++M +A   V + D   A +  L  A+   
Sbjct: 61  NKSLESGSK-ESVVATEKFANETNNIYGVMADMDLAKRAVEQNDLAQAEKRLLA-ASGKA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  A+++ A +       +   K L+++             I G    K G +  
Sbjct: 119 KDENMQALASIRLARVQFAEDKTDAALKTLEQVKGKG--WLVAVENIRGDILTKKGDIAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  +    +  + P  + +  Q+ L N+ +
Sbjct: 177 ARAAYSRGLE-ADGPQSLKSSIQIKLNNLSS 206


>gi|291613883|ref|YP_003524040.1| hypothetical protein Slit_1416 [Sideroxydans lithotrophicus ES-1]
 gi|291583995|gb|ADE11653.1| Protein of unknown function DUF2133 [Sideroxydans lithotrophicus
           ES-1]
          Length = 212

 Score = 78.9 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 72/196 (36%), Gaps = 3/196 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K   KW+   L++  +        +      +     + +A+ ++   SN       + 
Sbjct: 19  WKANGKWVVGALLVGSIG-FAGTTYWRNHKASQAAEAAKLYAEVVKQVASNDAKRISDAA 77

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
           + ++S+            +A+    +      A++ L+   +      ++  A L+ AS+
Sbjct: 78  DALVSRYGSSAYAPRAQLLAAQANLQARDAAHAKVELQWVIEHADETGLQDTARLKLASV 137

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           L+D   Y+E  K L       +      +++ G      GK+ +A+  +++     ++  
Sbjct: 138 LLDEKKYDEALKQLDA--AHPDSFTGLYSDLRGDVLSAQGKIAEARVAYQQAYDKMDAKS 195

Query: 197 GISTRSQMILANIIAS 212
           G     Q+ L  +  +
Sbjct: 196 GYRNLIQLKLDGLGNA 211


>gi|206578036|ref|YP_002237137.1| hypothetical protein KPK_1277 [Klebsiella pneumoniae 342]
 gi|206567094|gb|ACI08870.1| conserved hypothetical protein [Klebsiella pneumoniae 342]
          Length = 206

 Score = 78.5 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 31/210 (14%), Positives = 72/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME+ N+ N      K           + +++ +   + +  +    +         + QA
Sbjct: 1   METFNNENDQVDALKRFFAENGKALAVGVILGIGALVGWRYWTSHQQDTARDASLAYEQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                SN  +    + EK  S +   Y   +++ +A   V + D  NA +   +      
Sbjct: 61  TSALKSNTPEVLSGA-EKFASDNKNTYGAFASLELAQHFVEQNDLPNAEKQLQQGLAAAS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++   +++ A + +     +   K L  +            ++ G   L  G  Q 
Sbjct: 120 -DDNLKSVISMRLARVQLQMKQADAALKTLDSIKGEG--WTAIVADLRGEILLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  +E   K  ++   +S   +M + N+ 
Sbjct: 177 ARAAWEAGVKS-DASPALSEMMRMKMNNLS 205


>gi|330994710|ref|ZP_08318633.1| hypothetical protein SXCC_04598 [Gluconacetobacter sp. SXCC-1]
 gi|329758351|gb|EGG74872.1| hypothetical protein SXCC_04598 [Gluconacetobacter sp. SXCC-1]
          Length = 232

 Score = 78.5 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 72/223 (32%), Gaps = 13/223 (5%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D      + +     Y  +A +++  I   A  +        +    V   +  A+   
Sbjct: 9   VDEEIRAERIRALARRYLVVAGVVVAGICIGAGGWQYSLSRAHRADAAVSAAYFTAMADA 68

Query: 65  N-------------SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEI 111
                         + +     +  + + ++       L+ M  A++L   GD   A  +
Sbjct: 69  ARAPDAPATGVTPLTTRQKTGLAELQALDAKARPPLRILARMERAALLAGSGDLPGALAL 128

Query: 112 FLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGIS 171
           +  VA +      +   A+L      +D+     +   L  L     P    A E   + 
Sbjct: 129 WDGVAQEKAVDPTIAALASLLWVQHQIDSGDPATLRSRLAVLDGTGQPWRGQAIEAEALL 188

Query: 172 ALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
            L+ GK   A+  F  LA D     G+ +R++ +L  +     
Sbjct: 189 DLRAGKDADARARFTRLAMDMGVGDGVRSRAEAMLQTMGGDAG 231


>gi|317490871|ref|ZP_07949307.1| hypothetical protein HMPREF0864_00069 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920418|gb|EFV41741.1| hypothetical protein HMPREF0864_00069 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 206

 Score = 78.5 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 31/210 (14%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +  N      +           + +++ +   + +  +    + +     +++ QA
Sbjct: 1   MEVYSTENEQVDALRRFFIENGKALAIGVVIGIGALLGWRYWQNHQQAEMTGASQSYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E     K D    + + I    N  Y  L+ + +A   V + D   A    L  A    
Sbjct: 61  SEALTGGKADGVALAEKFIEKNAN-NYGVLAALQLAQHEVDQKDFAKAEH-QLAWAQGQA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + +  +  ++  K L  +          A ++ G   +K G V+ 
Sbjct: 119 KDENLKSLIDLRLARVQLQENKLDDALKTLDLVKATG--WVAMAQDVRGDVLVKKGDVKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + +     ++   +    +M L N+ 
Sbjct: 177 AREAYSKGLAS-DASQSLQALLRMKLNNLS 205


>gi|238785323|ref|ZP_04629312.1| hypothetical protein yberc0001_29830 [Yersinia bercovieri ATCC
           43970]
 gi|238713776|gb|EEQ05799.1| hypothetical protein yberc0001_29830 [Yersinia bercovieri ATCC
           43970]
          Length = 206

 Score = 78.5 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 28/211 (13%), Positives = 72/211 (34%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ ++  + +  +              + QA
Sbjct: 1   MEVYTTDNDQVDAVRRFFSENGKALAVGVVLGIAALVGWRYWQSHQNSAMTEASTAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  ++N  D    + + +    N  Y  L+ + +A   V + +   AA+   +      
Sbjct: 61  SDALSANSADGVALAEKFVQGNKN-NYGVLAGLELAHHFVEQNEFDKAAQQLTQALGQTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     +E  K L  +    +     A ++ G + L  G +  
Sbjct: 120 -DENLLSLINLRLARLQLQLKKPDEALKTLDAV--QGDGWTAMAQDVRGDALLSKGDISG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +  +  N+   +    +M L N+ +
Sbjct: 177 ARAAYSKGVES-NASQALQALLRMKLNNLSS 206


>gi|113868336|ref|YP_726825.1| transmembrane protein [Ralstonia eutropha H16]
 gi|113527112|emb|CAJ93457.1| Transmembrane protein [Ralstonia eutropha H16]
          Length = 210

 Score = 78.5 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/213 (12%), Positives = 69/213 (32%), Gaps = 4/213 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K     Y      ++++ L     +  +     K+       + Q 
Sbjct: 1   MAYDLEEQEQLENLKAWWRQYGNALTWVLIVALLAFAGWNGWKYWERKQAGEAAVLYEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L+   +  ++  + +   +  +  +      +  +A  ++       AA+  L+ A D  
Sbjct: 61  LKAAEARDIERIKRAATDLEDKYGRTAYGQMSALVAGRVLYDAGDLAAAKSQLQWAIDHG 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                 + A ++ A +L+D  +Y++   +L+   EP         +  G       K   
Sbjct: 121 -DQEYSHLARVRLAGVLLDEKAYDKGLALLKD--EPPAAFVALYADRRGDLLAAQDKRDD 177

Query: 181 AKTIFEELAK-DNNSPFGISTRSQMILANIIAS 212
           A+T + +           +    Q  L  +  +
Sbjct: 178 ARTAYRKALDKLGQEEPAMRQIIQFKLDALGTA 210


>gi|157144553|ref|YP_001451872.1| hypothetical protein CKO_00273 [Citrobacter koseri ATCC BAA-895]
 gi|157081758|gb|ABV11436.1| hypothetical protein CKO_00273 [Citrobacter koseri ATCC BAA-895]
          Length = 206

 Score = 78.5 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 75/210 (35%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   + +  +     +        +  A
Sbjct: 1   MEIYENENDQVDAIKRFFAENGKALAVGVILGVGALLGWRYWTSHQTESARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   ++ K D   S+ EK  +++   Y  L++M +A   V + + + AA    +      
Sbjct: 61  VTAVSAGKPDSI-SAAEKFATENKNTYGALASMELAQQFVDQNELEKAAAQLQQGLAATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADTALKTLDTVKGEG--WAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  ++   +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DASPALSEMMQMKINNLS 205


>gi|258619959|ref|ZP_05714999.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|262172168|ref|ZP_06039846.1| membrane protein [Vibrio mimicus MB-451]
 gi|258587692|gb|EEW12401.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|261893244|gb|EEY39230.1| membrane protein [Vibrio mimicus MB-451]
          Length = 204

 Score = 78.1 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 71/209 (33%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S    +     +++QA
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVSAQEAASHSYSQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +   +   S    I +     Y  L+ M +A + V  G    A    L+ A    
Sbjct: 61  IDALVAKGTEAESSIQTFIDANKETEYAVLAAMQLAKVQVEAGQLDEAL-AQLEWAKGAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
             +A++   T + A +  +   ++E    L  + E +        E+ G   ++ G    
Sbjct: 120 KDVALKPLLTYRVARLQAEQGQFDEALTQLSNIQEKTWAGRV--AELRGDILMRKGDSAG 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  + +++   +    QM L ++
Sbjct: 178 AYAAYTEAQQADDASQTL----QMKLDDL 202


>gi|288934096|ref|YP_003438155.1| hypothetical protein Kvar_1215 [Klebsiella variicola At-22]
 gi|290508294|ref|ZP_06547665.1| hypothetical protein HMPREF0485_00065 [Klebsiella sp. 1_1_55]
 gi|288888825|gb|ADC57143.1| Protein of unknown function DUF2133 [Klebsiella variicola At-22]
 gi|289777688|gb|EFD85685.1| hypothetical protein HMPREF0485_00065 [Klebsiella sp. 1_1_55]
          Length = 206

 Score = 78.1 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 72/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME+ N+ N      K           + +++ +   + +  +    +         + QA
Sbjct: 1   METFNNENDQVDALKRFFAENGKALAVGVILGIGALVGWRYWTSHQQDTARDASLAYEQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                SN  +    + EK  + +   Y   +++ +A   V + D  NA +   +      
Sbjct: 61  TSALKSNTPEVLSGA-EKFAADNKNTYGAFASLELAQHFVEQNDLPNAEKQLQQGLAAAS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++   +++ A + +     +   K L  +            ++ G   L  G  Q 
Sbjct: 120 -DDNLKSVISMRLARVQLQMKQADAALKTLDSIKGEG--WTAIVADLRGEILLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  +E   K  ++   +S   +M + N+ 
Sbjct: 177 ARAAWEAGVKS-DASPALSEMMRMKMNNLS 205


>gi|148255172|ref|YP_001239757.1| hypothetical protein BBta_3774 [Bradyrhizobium sp. BTAi1]
 gi|146407345|gb|ABQ35851.1| hypothetical protein BBta_3774 [Bradyrhizobium sp. BTAi1]
          Length = 217

 Score = 78.1 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 94/210 (44%), Gaps = 1/210 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    + + K     Y      + ++I++    +  +  +  KK    G  F +A+EL 
Sbjct: 8   VDEEVRREQLKRLWDRYSIFIIAIAVLIIAGVGGWRGYQYAEGKKAAEAGSAFNKAIELS 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
             NK ++A  +F ++ +     Y  L+  + A+    +     A  ++ ++A D      
Sbjct: 68  EQNKREEAEKAFAEVAATAPAGYRMLARFHQAAEAAGRDKAA-AVRLYDELAADRSIGAE 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            +  A L+AA +LVDT+ Y ++ + L+  +    P    A E+L +SA K      A+  
Sbjct: 127 QQSMARLRAAGLLVDTAPYPDLKQRLEGEAASGAPFRHAARELLALSAWKANDAAAARQW 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQ 214
            + +A D  +P G+ +R++ + A + A  +
Sbjct: 187 LDMIALDGETPPGLRSRAEALQALLPAVAK 216


>gi|254480142|ref|ZP_05093390.1| hypothetical protein GPB2148_3179 [marine gamma proteobacterium
           HTCC2148]
 gi|214039704|gb|EEB80363.1| hypothetical protein GPB2148_3179 [marine gamma proteobacterium
           HTCC2148]
          Length = 242

 Score = 78.1 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 63/213 (29%), Gaps = 5/213 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K           + I++ L L   +  +    + +      ++   
Sbjct: 1   MEQYRTEEEQVEALKRWWDENGRSTMVAIIVALGLGFGWQGWQKYQQDELEGASTSYQSM 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNK-LYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           L++ +    + A +    I    ++  Y   S +++A I V +GD   A      V    
Sbjct: 61  LQMLSEQDDEGAAAVAVDIKQNYSRSTYAQFSALHLARIAVNEGDLATAESELRWVLGRA 120

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
                    A L+ A +L      ++   IL                  G   L  G+  
Sbjct: 121 DKGSDSAQLAQLRLARVLASGDDAQQALTILDS--TDPGAYASAYQVARGDILLSQGRSD 178

Query: 180 KAKTIFEELAKDNNSPFGISTRS--QMILANII 210
           +A+  +       +   G    +  Q  L ++ 
Sbjct: 179 EARQAYSSALMLASRGEGQVNMAMLQQKLQSLS 211


>gi|56461132|ref|YP_156413.1| hypothetical protein IL2032 [Idiomarina loihiensis L2TR]
 gi|56180142|gb|AAV82864.1| Uncharacterized conserved membrane protein [Idiomarina loihiensis
           L2TR]
          Length = 204

 Score = 78.1 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 71/207 (34%), Gaps = 6/207 (2%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
            +N       + K     +       +++   L   +  +D    + +     N+ Q   
Sbjct: 1   MDNTEEQQVERLKEFWKEHGKGIVAGVVIGFGLFYGWRYYDQHTLETQQRASANYEQLTA 60

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +    +    + E +      +Y  L  + +A   V + D   A    L+   D    
Sbjct: 61  ELSEGSENAVLEAQEFVSENPKNVYAQLVALQLAQHSVERADLATAVTA-LQSVVDSAED 119

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   A+++ A +L+     +    +++K          FA E+ G    + G  ++A+
Sbjct: 120 ENMSALASIRLARVLIAQEQLDAALSLVKK--PLPEAYAGFAAELEGDILAEQGNTEEAR 177

Query: 183 TIFEELAKDNNSPFGISTRSQMILANI 209
             +E   +   S   ++   QM L ++
Sbjct: 178 AAYERALQAGES---LTPALQMKLNSL 201


>gi|296532291|ref|ZP_06895030.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296267367|gb|EFH13253.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 216

 Score = 78.1 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 73/174 (41%), Gaps = 2/174 (1%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLD--DARSSFEKILSQDNKLYNPLSNMYIA 96
           +  +    +++       F +      +   D       F  + S   + Y  LS +  A
Sbjct: 42  WQGWRWYQQREATQSAAIFLEQHRAAEAQGADLRAIGDRFAGLASSGPEGYRILSALRAA 101

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
           ++    GD   A  ++ +++ D+ AP   R  A+L  A   +D+    ++S  L  L+  
Sbjct: 102 ALKAETGDRDGALALWNQLSADNAAPRIYRDLASLMWALHGIDSQDPAQLSARLGPLAAE 161

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
            +     A E+ G+ AL+ G    AK  F+ LA+D  +P G+  R+  + A + 
Sbjct: 162 GSAWRASARELQGLLALRQGDKATAKREFDALAQDVTAPQGLRERAGRLAAGLG 215


>gi|161502325|ref|YP_001569437.1| hypothetical protein SARI_00358 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160863672|gb|ABX20295.1| hypothetical protein SARI_00358 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 206

 Score = 78.1 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 75/210 (35%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + +      K           + +++ +   + +  ++    +        +  A
Sbjct: 1   MEIYENEHDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWNSHQTESARAASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +++K D    + EK  +++   Y  L++M +A   V K + K A     +      
Sbjct: 61  VTAISADKPDSI-PAAEKFAAENKNTYGALASMELAQQFVDKNELKKAETQLQQGLAATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G ++ 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADAALKTLDAIKGEG--WTAIVADLRGEALLSKGDIKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E      ++   +S   QM + N+ 
Sbjct: 177 ARSAWEAGVNS-DASPALSEMMQMKINNLS 205


>gi|163746869|ref|ZP_02154226.1| hypothetical protein OIHEL45_15739 [Oceanibulbus indolifex HEL-45]
 gi|161379983|gb|EDQ04395.1| hypothetical protein OIHEL45_15739 [Oceanibulbus indolifex HEL-45]
          Length = 234

 Score = 78.1 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 38/213 (17%), Positives = 78/213 (36%), Gaps = 4/213 (1%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + +       Y WIA + ++ I+  A W          +   +G+    ALE  
Sbjct: 11  VNEEVRRDRLYGLMRRYGWIAVVAVIAIVGGAAWNEYSKAQERAQAEALGDAMLAALEAD 70

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            SN   +A       +  +    N + N   A  L   G+   A E    +A D      
Sbjct: 71  ASNARAEAL----APIEAEGPGANAVLNFMRADALAEAGEIDAAVEQLDAIALDGDLAPI 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A  +A ++   +    E  + L+ L++P   +   A E L +  ++ G+  KA   
Sbjct: 127 YRQLAQFKAVTLQGQSVPVAERRQALEALAQPGAALRLLAEEQLALIDIQEGETGKAVAR 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           ++ +  D  +   +  R+  ++  +    + + 
Sbjct: 187 YQSILSDAETTPDLQQRALQVIVALGKEPELDG 219


>gi|300704412|ref|YP_003746015.1| hypothetical protein RCFBP_20216 [Ralstonia solanacearum CFBP2957]
 gi|299072076|emb|CBJ43408.1| conserved protein of unknown function [Ralstonia solanacearum
           CFBP2957]
          Length = 211

 Score = 78.1 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 20/213 (9%), Positives = 66/213 (30%), Gaps = 3/213 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K        +   + +++L     +  +     K+       + Q 
Sbjct: 1   MAYDLEEQEQLESLKHWWRDNGNVVTWVAIVVLLAVAAWLGWKNWQRKQAAEATVLYEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  ++   +  + +   +  +  +          A+  + +      A+  L+   D  
Sbjct: 61  QKAVDAKDAEKIKRAAADMEDKFGRTAYAQMTALSAAKALYEASDAAGAKAQLQWTIDHA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           +    +  A L+ A +L+D  +Y++   ++    + +        +  G       K   
Sbjct: 121 SDDEYKAVAKLRLAGLLLDEKAYDQGLALVSG--DVAPAFAALYADRRGDLLAAQNKRDD 178

Query: 181 AKTIFEELAKD-NNSPFGISTRSQMILANIIAS 212
           A+  ++   +  + +        Q  L  +  +
Sbjct: 179 ARAAYKLALEKFSQADASARQIVQFKLDALGGA 211


>gi|237732492|ref|ZP_04562973.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908031|gb|EEH93949.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 206

 Score = 77.7 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + +      K           + I++ +   + +  +     +        +   
Sbjct: 1   MEIYENEHDQVDAVKRFFAENGKALAVGIILGVGALVGWRYWTSHQTESARSASLAYQNT 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   ++ K D    + EK  +++   Y  L+++ +A   V + + + AA    +      
Sbjct: 61  VTAVSAGKPDSI-PAAEKFAAENKNTYGALASLELAQQFVDQNELEKAASQLQQGLAATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + V     +   K L  +            ++ G + L  G  Q 
Sbjct: 120 -DENLKAVINLRLARVQVQLKQADTALKTLDTIKGEG--WTAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  ++   +S   QM + N+ 
Sbjct: 177 ARSAWEAGVKS-DASPALSEMMQMKINNLS 205


>gi|152971374|ref|YP_001336483.1| hypothetical protein KPN_02843 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238895968|ref|YP_002920704.1| hypothetical protein KP1_4093 [Klebsiella pneumoniae NTUH-K2044]
 gi|262040250|ref|ZP_06013501.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330007781|ref|ZP_08306078.1| tetratricopeptide repeat protein [Klebsiella sp. MS 92-3]
 gi|150956223|gb|ABR78253.1| hypothetical protein KPN_02843 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238548286|dbj|BAH64637.1| hypothetical protein KP1_4093 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259042359|gb|EEW43379.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328535325|gb|EGF61810.1| tetratricopeptide repeat protein [Klebsiella sp. MS 92-3]
          Length = 206

 Score = 77.7 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 72/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME+ N+ N      K           + +++ +   + +  +    +         + +A
Sbjct: 1   METFNNENDQVDALKRFFAENGKALAVGVILGIGALVGWRYWTSHQQDTARDASLAYEKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                SN  +    + EK  + +   Y   +++ +A   V + D  NA +   +      
Sbjct: 61  TSALKSNTPEVLSGA-EKFAADNKNTYGAFASLELAQHFVEQNDLPNAEKQLQQGLAAAS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++   +++ A + +     +   K L  +            ++ G   L  G  Q 
Sbjct: 120 -DDNLKSVISMRLARVQLQMKQADAALKTLDSIKGEG--WTAIVADLRGEILLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  +E   K  ++   +S   +M + N+ 
Sbjct: 177 ARAAWEAGVKS-DASPALSEMMRMKMNNLS 205


>gi|32455225|gb|AAP83327.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Enteritidis]
          Length = 206

 Score = 77.7 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + +      K           + +++ +   + +  +     +        +  A
Sbjct: 1   MEIYENEHDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWSSHQTESARAASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +++K D    + EK  +++   Y  L++M +A   V K + K A     +      
Sbjct: 61  VTAVSADKPDSI-PAAEKFAAENKNTYGALASMELAQQFVDKNELKKAEAQLQQGLVATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + +     +   K L  +            ++ G + L  G  + 
Sbjct: 120 -DENLKAVINLRLARVQLQLKQADAALKTLDAVKGEG--WTAIVADLRGEALLSKGDKKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E      ++   +S   QM + N+ 
Sbjct: 177 ARSAWEAGVNS-DASPALSEMMQMKINNLS 205


>gi|238752473|ref|ZP_04613949.1| hypothetical protein yrohd0001_22450 [Yersinia rohdei ATCC 43380]
 gi|238709322|gb|EEQ01564.1| hypothetical protein yrohd0001_22450 [Yersinia rohdei ATCC 43380]
          Length = 206

 Score = 77.7 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 68/210 (32%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +  +           + QA
Sbjct: 1   MEVYTTENDQVDAVRRFFSENGKALAVGVVLGIGALVGWRYWQSNQNTAMTEASSAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  ++N  D    + + +    N  Y  L+ + +A   V + +   AA+   +      
Sbjct: 61  SDALSANSADGVALAEKFVQGNKN-NYGVLAGLELAHHFVEQNEFDKAAQQLTQALGQTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     +E  K L  +          A ++ G   L  G    
Sbjct: 120 -DENLLSLINLRLARLQLQLKKPDEALKTLDAVQGEG--WTAMAQDVRGDVLLSKGDTAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + +  +  N+   +    +M L N+ 
Sbjct: 177 ARAAYSKGIES-NASQALQALLRMKLNNLS 205


>gi|156932944|ref|YP_001436860.1| hypothetical protein ESA_00747 [Cronobacter sakazakii ATCC BAA-894]
 gi|156531198|gb|ABU76024.1| hypothetical protein ESA_00747 [Cronobacter sakazakii ATCC BAA-894]
          Length = 206

 Score = 77.7 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/210 (17%), Positives = 78/210 (37%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   + +  ++GS          ++   
Sbjct: 1   MEIYENENEQLDAVKRFFAENGKALAVGVVLGIGALVGWRFWNGSQVDSAREASLHYQNV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    ++      S+ ++ ++Q+   Y  L+ + +A   V K D  NAA+   K   +  
Sbjct: 61  MTDVRADDP-KTLSAAQQFVAQNQNTYGALAALELAQRYVDKNDLTNAAQQLQKGLENTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +R    L+ A I +     +   K L+ +            ++ G + L  G  Q 
Sbjct: 120 -DENLRSLINLRLARIQIQQKQADAALKTLESVK--GENWSAMVADLRGDALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + + A D NSP  +    QM + N+ 
Sbjct: 177 ARDAWSKGADDKNSPA-LGDMMQMKINNLS 205


>gi|149926360|ref|ZP_01914621.1| hypothetical protein LMED105_13213 [Limnobacter sp. MED105]
 gi|149824723|gb|EDM83937.1| hypothetical protein LMED105_13213 [Limnobacter sp. MED105]
          Length = 214

 Score = 77.7 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/197 (12%), Positives = 58/197 (29%), Gaps = 3/197 (1%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
            K     Y      +++++         +     ++       + +         ++   
Sbjct: 15  LKAFWSKYGSFILTVLILVFGAFALNNGWKWWQARQSTEAVVVYERLEAASREGNIELVG 74

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
              + +  +            IA+         + A+  LK A+++         A L  
Sbjct: 75  EIQKTLFEEHAGSPYAQRGALIAAKAFFDEGKLDEAKASLKWASEEAKLDEYVATARLML 134

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           A IL++ S ++        LSE         ++ LG  AL    V  A+  +E       
Sbjct: 135 AGILIEQSEFDAAKA---ALSEDYPGFEGLFHDRLGDLALAQKDVATARKEYELALGTIQ 191

Query: 194 SPFGISTRSQMILANII 210
           S        +  ++ + 
Sbjct: 192 SDSPWKQVIERKISALP 208


>gi|329850800|ref|ZP_08265645.1| TPR repeat-containing protein [Asticcacaulis biprosthecum C19]
 gi|328841115|gb|EGF90686.1| TPR repeat-containing protein [Asticcacaulis biprosthecum C19]
          Length = 246

 Score = 77.7 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 43/172 (25%), Positives = 76/172 (44%), Gaps = 1/172 (0%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           F+ F    +K+     E F   +E         A++SFE+     N  Y  +S M +A +
Sbjct: 42  FWGFTTWQDKEVAKASEVFQAGIEAAAKGDSTAAKASFEQTAKGSNSTYKAMSLMQLAGL 101

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
               G T  A ++F   A    +   V   A L+AA +++D   + +  K L  L++   
Sbjct: 102 AHRDGKTDEAIKLFDD-AAKASSDPRVADLAALKAAYLVMDKGVFADSQKRLTPLTDAKR 160

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
           P    A E L ++ L+ G    A+     L+ + ++P G+  R+Q ++A I 
Sbjct: 161 PYTFLAKEALAMAKLQNGDAAGARADLNALSFELDAPEGVKQRAQRVVAAID 212


>gi|295676901|ref|YP_003605425.1| Protein of unknown function DUF2133 [Burkholderia sp. CCGE1002]
 gi|295436744|gb|ADG15914.1| Protein of unknown function DUF2133 [Burkholderia sp. CCGE1002]
          Length = 209

 Score = 77.3 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/207 (12%), Positives = 62/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +      ++L++L     +  ++    ++       + Q  +   
Sbjct: 5   DEQESIESLKAWWNQWGNATTWIVLVVLLAGASWNGWNFWQRRQAAEAAVLYDQVQQATA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +            +  +  +           +  +     +  A+  L+ A D       
Sbjct: 65  TGDKARIARVAADMEDKFGRTAYAQMTALGVAKALYAAGDEAGAKAQLQWAIDHAKDDEF 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y++   +L +    S+       +  G      GK   A+  +
Sbjct: 125 KQVAKLRMASLLLDDKAYDQGLALLAE--PQSDAFKGVVADRRGDLLAAQGKRDDARAAY 182

Query: 186 EEL-AKDNNSPFGISTRSQMILANIIA 211
           +      + S        Q  L  +  
Sbjct: 183 KLALDSLSKSDSSARQLIQFKLDALGG 209


>gi|307946714|ref|ZP_07662049.1| putative TPR repeat-containing protein [Roseibium sp. TrichSKD4]
 gi|307770378|gb|EFO29604.1| putative TPR repeat-containing protein [Roseibium sp. TrichSKD4]
          Length = 227

 Score = 77.3 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 76/181 (41%), Gaps = 1/181 (0%)

Query: 35  LAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMY 94
               +  +    E +    G+ F  A+EL  S  ++ A  + + +  +    Y  L+ + 
Sbjct: 38  GTGGYRGWQYWQETQAQEAGDKFMAAVELSESANIEGAIEALDAL-GEAGGGYPQLAKLR 96

Query: 95  IASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLS 154
           +A+  +       A E F + + D     +++  A L+A  + VD   Y  ++  ++ L+
Sbjct: 97  VATEHIKADRKIEALEAFDQASRDPSVEASLQSIAALRAGYLAVDLEDYAGVADRVEGLT 156

Query: 155 EPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
             ++P    A E+L ++A K G  + A+     +  D  +P  +S R  ++   I +   
Sbjct: 157 GEADPFRAAARELLALAAWKAGNAEDARKWVSAIENDTETPAEVSRRVGILSEVIRSQFG 216

Query: 215 R 215
            
Sbjct: 217 A 217


>gi|261252180|ref|ZP_05944753.1| membrane protein [Vibrio orientalis CIP 102891]
 gi|260935571|gb|EEX91560.1| membrane protein [Vibrio orientalis CIP 102891]
          Length = 204

 Score = 77.3 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 66/209 (31%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K           L  ++ L     +  +  S    +    E++ +A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVILGAVVGLGGLFGWRYYQDSVTAAQEAASESYTKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +++               I    +  Y  L+ + +A + V  G+   A    L+ A    
Sbjct: 61  VQVLAEKGASAEGDIQTFIDGNKDTEYATLAALQLAKVQVEAGNFDEAL-AQLEWAKSAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              AV      + A +  +   ++     L  ++           E+ G   L+ G  Q 
Sbjct: 120 KDAAVLSVVNYRLARVKAEQGEFDAAVAELANIT--DESWAGRVAELKGDILLRKGDEQA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  +  ++   +    QM L ++
Sbjct: 178 AYAAYTEAQQSGDASQTL----QMKLDDL 202


>gi|322613734|gb|EFY10673.1| hypothetical protein SEEM315_21653 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619523|gb|EFY16399.1| hypothetical protein SEEM971_02860 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625028|gb|EFY21857.1| hypothetical protein SEEM973_02612 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629529|gb|EFY26305.1| hypothetical protein SEEM974_03895 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634040|gb|EFY30777.1| hypothetical protein SEEM201_22080 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635522|gb|EFY32233.1| hypothetical protein SEEM202_06950 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322639802|gb|EFY36481.1| hypothetical protein SEEM954_07743 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322648569|gb|EFY45018.1| hypothetical protein SEEM675_20865 [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655211|gb|EFY51520.1| hypothetical protein SEEM965_04201 [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658258|gb|EFY54524.1| hypothetical protein SEEM19N_02597 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664259|gb|EFY60456.1| hypothetical protein SEEM801_05276 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669426|gb|EFY65575.1| hypothetical protein SEEM507_17689 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673153|gb|EFY69259.1| hypothetical protein SEEM877_16601 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676545|gb|EFY72613.1| hypothetical protein SEEM867_11678 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683295|gb|EFY79309.1| hypothetical protein SEEM180_08706 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322685819|gb|EFY81812.1| hypothetical protein SEEM600_02542 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323194762|gb|EFZ79950.1| hypothetical protein SEEM581_11406 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199550|gb|EFZ84641.1| hypothetical protein SEEM501_17794 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204675|gb|EFZ89673.1| hypothetical protein SEEM460_01767 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323208123|gb|EFZ93068.1| hypothetical protein SEEM020_00580 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210153|gb|EFZ95054.1| hypothetical protein SEEM6152_19905 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217021|gb|EGA01743.1| hypothetical protein SEEM0077_09954 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221819|gb|EGA06223.1| hypothetical protein SEEM0047_01578 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225002|gb|EGA09257.1| hypothetical protein SEEM0055_13382 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229291|gb|EGA13415.1| hypothetical protein SEEM0052_10668 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235394|gb|EGA19478.1| hypothetical protein SEEM3312_10711 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237420|gb|EGA21483.1| hypothetical protein SEEM5258_15794 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245174|gb|EGA29175.1| hypothetical protein SEEM1156_08080 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323248877|gb|EGA32803.1| hypothetical protein SEEM9199_11063 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253164|gb|EGA36996.1| hypothetical protein SEEM8282_06350 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255398|gb|EGA39166.1| hypothetical protein SEEM8283_21542 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323263531|gb|EGA47058.1| hypothetical protein SEEM8284_00752 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266354|gb|EGA49842.1| hypothetical protein SEEM8285_17597 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
          Length = 206

 Score = 77.3 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + +      K           + +++ +   + +  +     +        +  A
Sbjct: 1   MEIYENEHDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWSSHQTESARAASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +++K D    + EK  +++   Y  L++M +A   V K + K A     +      
Sbjct: 61  VTAVSADKPDSI-PAAEKFAAENKNTYGALASMELAQQFVDKNELKKAEAQLQQGVAATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + +     +   K L  +            ++ G + L  G  + 
Sbjct: 120 -DENLKAVINLRLARVQLQLKQADAALKTLDAVKGEG--WTAIVADLRGEALLSKGDKKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E      ++   +S   QM + N+ 
Sbjct: 177 ARSAWEAGVNS-DASPALSEMMQMKINNLS 205


>gi|258627191|ref|ZP_05721979.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|262165073|ref|ZP_06032810.1| membrane protein [Vibrio mimicus VM223]
 gi|258580493|gb|EEW05454.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|262024789|gb|EEY43457.1| membrane protein [Vibrio mimicus VM223]
          Length = 204

 Score = 77.3 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 71/209 (33%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S    +     +++QA
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVSAQEAASHSYSQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +   +   S    I +     Y  L+ M +A + V  G    A    L+ A    
Sbjct: 61  IDALVAKGAEAESSIQTFIDANKETEYAVLAAMQLAKVQVEAGQLDEAL-AQLEWAKGAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
             +A++   T + A +  +   ++E    L  + E +        E+ G   ++ G    
Sbjct: 120 KDVALKPLLTYRVARLQAEQGQFDEALTQLSNIQEKTWAGRV--AELRGDILMRKGDSAG 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  + +++   +    QM L ++
Sbjct: 178 AYAAYTEAQQADDASQTL----QMKLDDL 202


>gi|71084011|ref|YP_266731.1| hypothetical protein SAR11_1323 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71063124|gb|AAZ22127.1| unknown membrane protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 214

 Score = 77.3 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 39/203 (19%), Positives = 77/203 (37%), Gaps = 1/203 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D N+   + K      K    ++I +IL + I +  F+ S EK +  +   +  AL   
Sbjct: 8   IDTNARNERIKNFFINNKKKLIIIISIILVIIIGYLSFENSKEKNRIKLANQYNLALIDL 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           N             ++  ++  Y+PL+  ++    + + + +    +F ++  +      
Sbjct: 68  NPENKQKTIDEMVNVVKSNDATYSPLALYHLLDNNLLENNDEINI-LFNELIENTKLDNE 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           ++     + A    D  S  E+ KIL  +    +     A  +L        + QKAK  
Sbjct: 127 IKNLIIYKKALFNSDFVSENELLKILNPVINSESIWKSHALYLLAEFFYSKDEKQKAKEF 186

Query: 185 FEELAKDNNSPFGISTRSQMILA 207
           F ++    N+   I T SQ  L 
Sbjct: 187 FNQIIILPNANSTIKTESQKRLN 209


>gi|329297580|ref|ZP_08254916.1| hypothetical protein Pstas_15361 [Plautia stali symbiont]
          Length = 205

 Score = 77.3 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/210 (14%), Positives = 66/210 (31%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  ++ N      +           + +++ ++    +  +    E         + Q 
Sbjct: 1   MEVYSNENEQVDALRRFFANNGKALAVAVIVGIAALGGWRFWSSHQEGADKAASAQYQQ- 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L             +     S++N  Y  L+ + +A   VA      A  +      D  
Sbjct: 60  LTSAMQVDKPQTLEAVASFASENNNTYGALAALDLAKQYVAANQLDKAITLLQSGLTDTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I +  +  +     L  +            +I G + L  G  Q 
Sbjct: 120 -DANLQAVINLRLARIQLQQNQADAALTTLNNVKGDG--WTAIVADIRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + + A+   SP  +    QM + N+ 
Sbjct: 177 ARDAWSKGAESQASPA-LKQMLQMKMNNLS 205


>gi|268593182|ref|ZP_06127403.1| putative inner membrane protein [Providencia rettgeri DSM 1131]
 gi|291311228|gb|EFE51681.1| putative inner membrane protein [Providencia rettgeri DSM 1131]
          Length = 207

 Score = 77.3 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/212 (14%), Positives = 69/212 (32%), Gaps = 5/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +     +  +            + F   
Sbjct: 1   MEVYTNENDQVDAIKRFFANNGVALVIGLVIGVGGVFGWNYWQSHKTNVLQESAQKFETV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                S   D A ++ +K  ++ + +Y+ +  + +A I V KGD  NA            
Sbjct: 61  NAQLRSGS-DQAIAAAQKFAAETDDVYSAMMGLELAQIAVDKGDLANAQTALTNALAKAK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
             + ++    L+ A + +   + +     +  +   S      A ++ G + L  G    
Sbjct: 120 T-VDMQDLINLRLARVQLAQGNADGAIASVANIKSKS--WQATAQDVRGDALLHKGDKAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           AK  + +  +       I     + L N+  S
Sbjct: 177 AKAAYTQGLESEG-SQSIRGILTLKLNNVSNS 207


>gi|16761436|ref|NP_457053.1| hypothetical protein STY2766 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16765841|ref|NP_461456.1| inner membrane protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29140867|ref|NP_804209.1| hypothetical protein t0335 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56412600|ref|YP_149675.1| hypothetical protein SPA0346 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62181088|ref|YP_217505.1| hypothetical protein SC2518 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161612721|ref|YP_001586686.1| hypothetical protein SPAB_00420 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167549459|ref|ZP_02343218.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167991829|ref|ZP_02572928.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168232088|ref|ZP_02657146.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168238258|ref|ZP_02663316.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168243300|ref|ZP_02668232.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168261441|ref|ZP_02683414.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168466729|ref|ZP_02700583.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194445044|ref|YP_002041779.1| hypothetical protein SNSL254_A2715 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194451252|ref|YP_002046579.1| hypothetical protein SeHA_C2778 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194473001|ref|ZP_03078985.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194735489|ref|YP_002115583.1| hypothetical protein SeSA_A2759 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197251319|ref|YP_002147474.1| hypothetical protein SeAg_B2672 [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197265697|ref|ZP_03165771.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197361535|ref|YP_002141171.1| hypothetical protein SSPA0326 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198243484|ref|YP_002216584.1| hypothetical protein SeD_A2889 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200387924|ref|ZP_03214536.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204929435|ref|ZP_03220509.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205353620|ref|YP_002227421.1| hypothetical protein SG2556 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207857929|ref|YP_002244580.1| hypothetical protein SEN2501 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213161950|ref|ZP_03347660.1| hypothetical protein Salmoneentericaenterica_18907 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213425333|ref|ZP_03358083.1| hypothetical protein SentesTyphi_06383 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213581533|ref|ZP_03363359.1| hypothetical protein SentesTyph_10117 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213861386|ref|ZP_03385856.1| hypothetical protein SentesT_27905 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224582942|ref|YP_002636740.1| hypothetical protein SPC_1133 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238912641|ref|ZP_04656478.1| hypothetical protein SentesTe_16122 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289825428|ref|ZP_06544665.1| hypothetical protein Salmonellentericaenterica_08533 [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|25323209|pir||AH0821 probable membrane protein STY2766 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16421065|gb|AAL21415.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16503736|emb|CAD02724.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136492|gb|AAO68058.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56126857|gb|AAV76363.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62128721|gb|AAX66424.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161362085|gb|ABX65853.1| hypothetical protein SPAB_00420 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403707|gb|ACF63929.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194409556|gb|ACF69775.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194459365|gb|EDX48204.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194710991|gb|ACF90212.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195630849|gb|EDX49441.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197093011|emb|CAR58444.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197215022|gb|ACH52419.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197243952|gb|EDY26572.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197288833|gb|EDY28206.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197938000|gb|ACH75333.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199605022|gb|EDZ03567.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204321154|gb|EDZ06354.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205273401|emb|CAR38376.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205325230|gb|EDZ13069.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205329907|gb|EDZ16671.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205333593|gb|EDZ20357.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205337701|gb|EDZ24465.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205349439|gb|EDZ36070.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206709732|emb|CAR34084.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224467469|gb|ACN45299.1| hypothetical protein SPC_1133 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261247717|emb|CBG25545.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267994638|gb|ACY89523.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159070|emb|CBW18584.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913508|dbj|BAJ37482.1| hypothetical protein STMDT12_C25390 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321222778|gb|EFX47849.1| hypothetical protein SEE_04090 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322715575|gb|EFZ07146.1| UPF0070 protein yfgM [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323130849|gb|ADX18279.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|326624340|gb|EGE30685.1| UPF0070 protein yfgM [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326628720|gb|EGE35063.1| Putative membrane protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332989448|gb|AEF08431.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 206

 Score = 77.3 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + +      K           + +++ +   + +  +     +        +  A
Sbjct: 1   MEIYENEHDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWSSHQTESARAASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +++K D    + EK  +++   Y  L++M +A   V K + K A     +      
Sbjct: 61  VTAVSADKPDSI-PAAEKFAAENKNTYGALASMELAQQFVDKNELKKAEAQLQQGLAATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + +     +   K L  +            ++ G + L  G  + 
Sbjct: 120 -DENLKAVINLRLARVQLQLKQADAALKTLDAVKGEG--WTAIVADLRGEALLSKGDKKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E      ++   +S   QM + N+ 
Sbjct: 177 ARSAWEAGVNS-DASPALSEMMQMKINNLS 205


>gi|254468250|ref|ZP_05081656.1| hypothetical protein KB13_475 [beta proteobacterium KB13]
 gi|207087060|gb|EDZ64343.1| hypothetical protein KB13_475 [beta proteobacterium KB13]
          Length = 208

 Score = 77.0 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/210 (12%), Positives = 68/210 (32%), Gaps = 3/210 (1%)

Query: 1   MESNNDANSYK-GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ 59
           M  + + NS +  K K      K +   L++ +  + I    +    E+      + F +
Sbjct: 1   MAQDIENNSEQLEKIKEFAQRNKKLLIGLVVALFIILIGNDFYKSKQEQNTGEASQLFQK 60

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
            L    ++  +    + +   +  N  Y   + +     ++         +  L+  +  
Sbjct: 61  LLISKMTDTENLKSIADDLRKNYANTPYAARAQIIYVKTILKNDSIDEDVKDRLQWVSQQ 120

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
               +++  +      I +     E+  +  + +         F  ++    A K G   
Sbjct: 121 AIEPSIKSLSVYYLGLISLSEDDLEKAKQFSEMIKTKG--FLGFKFDLQADIAKKEGDTD 178

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMILANI 209
           KAK ++ +     +     S   +  L N+
Sbjct: 179 KAKELYAKAISSFSPQSDFSRVIEYKLQNL 208


>gi|257093697|ref|YP_003167338.1| hypothetical protein CAP2UW1_2113 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257046221|gb|ACV35409.1| conserved hypothetical protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 227

 Score = 77.0 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/213 (11%), Positives = 62/213 (29%), Gaps = 19/213 (8%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
            K     Y  +   ++       I +  ++     +       +    +    N     +
Sbjct: 15  IKAWWKQYGNLLLGIVTAASIGVIAWQGWNWYQRNQAAQASMVYGVLQKAVRENDAQRIK 74

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
           ++  ++L +             A+  +        A + L    +      +R  A L+ 
Sbjct: 75  TAAGELLEKYGSTAYAPMAALSAAKAMFAAGDTKTASLQLVWVVEHGKDE-LRDLARLRL 133

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL----- 188
           A++L+D  +Y+E  K L   +     +        G      GK  +A+  ++E      
Sbjct: 134 AAVLLDEKAYDEALKQLAGNTTGGFAVR--FLGSRGDVLSAQGKTAEARAAYQEALVRLD 191

Query: 189 -----------AKDNNSPFGISTRSQMILANII 210
                       +D  +        ++ L  + 
Sbjct: 192 EGDKTGKGKNTLQDRQANAAFREMLELKLDALG 224


>gi|83952355|ref|ZP_00961086.1| hypothetical protein ISM_09396 [Roseovarius nubinhibens ISM]
 gi|83836028|gb|EAP75326.1| hypothetical protein ISM_09396 [Roseovarius nubinhibens ISM]
          Length = 206

 Score = 77.0 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/193 (21%), Positives = 80/193 (41%), Gaps = 5/193 (2%)

Query: 20  CYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKI 79
            Y WIA L +L+++  A +      +       +G+    ALE    ++ +   ++ + I
Sbjct: 3   RYGWIAVLAVLLLVGGAAYNEWRKANERAAAEALGDGILAALE---QDEAEARVTALQAI 59

Query: 80  LSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
            + D      ++   +A+      D K  AE  + +A     P+  R  ATL+AA+I  +
Sbjct: 60  DAPDPSADAVVT--LLAAGESLGSDPKATAEALVALAERGDVPMVYRQIATLKAAAIGAE 117

Query: 140 TSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
             + E   ++L  L+  +  +   A E L    ++ G  + A T  E L  D  +  G+ 
Sbjct: 118 GLAAETRRELLDGLALGTGTIRVLAEEQLAYLDIETGNQEAALTRLEALYVDAEASEGLR 177

Query: 200 TRSQMILANIIAS 212
            R   I+  +   
Sbjct: 178 QRVGQIVLALGGE 190


>gi|121607082|ref|YP_994889.1| hypothetical protein Veis_0078 [Verminephrobacter eiseniae EF01-2]
 gi|121551722|gb|ABM55871.1| conserved hypothetical protein [Verminephrobacter eiseniae EF01-2]
          Length = 226

 Score = 77.0 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/203 (9%), Positives = 60/203 (29%), Gaps = 2/203 (0%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     +      +++++      +  +     ++       +  A     +     
Sbjct: 14  DRLKHFWRAWGTPITSVLIVVAGAIAGWNGYQYWQNRQAAQAAALWDVADMAVRAGDQAR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
              +F  + ++              +  +      + A+  L+      A   +   A L
Sbjct: 74  MEQAFGDLKAKYPGTAQAAQAGLALAKALQDAGKTDGAKQALEWVAQQSADEGLEALARL 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + +S+L+D  ++EE  + L      +        +  G       K  +A   + +  + 
Sbjct: 134 RLSSLLMDQKNHEEALQQLSG--NFAPAFAAIVADRKGDILWLQDKRPQAIAEYRKAYQG 191

Query: 192 NNSPFGISTRSQMILANIIASDQ 214
                      ++ L  + A+ Q
Sbjct: 192 FEDGLEYRRLVEIKLDALGAAPQ 214


>gi|222110305|ref|YP_002552569.1| hypothetical protein Dtpsy_1092 [Acidovorax ebreus TPSY]
 gi|221729749|gb|ACM32569.1| conserved hypothetical protein [Acidovorax ebreus TPSY]
          Length = 225

 Score = 76.6 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/200 (11%), Positives = 59/200 (29%), Gaps = 2/200 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     +      ++++I+     +  +     ++                +  L  
Sbjct: 14  EQIKHFWNTWGTPITWVLIVIMGGLAAWNGYRLWQGRQAQQATALAEAVEMAVQAGDLAR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
              +   + S             +A+  +A     +AA+  L    +  +    +  A L
Sbjct: 74  VEQAVGDLKSSYGGTAQAGQAGLLAAKALADAGKWDAAKSTLAWVAEKASDEGYQALARL 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + AS+L++  +Y+E S  L    +          +  G       K  +A   +    + 
Sbjct: 134 RLASVLIEQKAYDEASAQLSG--KFPAEFAATVADRKGDVFALQDKKPEAIAEYRRAYQA 191

Query: 192 NNSPFGISTRSQMILANIIA 211
            +         +  L  + A
Sbjct: 192 FDERVEYRRLVEAKLNALGA 211


>gi|262402854|ref|ZP_06079415.1| membrane protein [Vibrio sp. RC586]
 gi|262351636|gb|EEZ00769.1| membrane protein [Vibrio sp. RC586]
          Length = 204

 Score = 76.6 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 69/209 (33%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S    +     N++QA
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVAAQEAASHNYSQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +   +   S    I +     Y  L+ M +A + V  G    A    L+ AN   
Sbjct: 61  MDALVAKGAEAEASIQTFIDANKETEYAVLAAMQLAKVQVDAGQLDEAL-AQLEWANGVT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A++   T + A +  +   +EE    L  +            E+ G   ++ G    
Sbjct: 120 KDPALKPLLTYRVARLQAEQGQFEEALAQLGNI--QEKSWLGRVAELRGDILMRKGDSTG 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  + +++   +    QM L ++
Sbjct: 178 AYAAYTEAQQADDASQTL----QMKLDDL 202


>gi|91762925|ref|ZP_01264890.1| unknown membrane protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718727|gb|EAS85377.1| unknown membrane protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 214

 Score = 76.6 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/203 (19%), Positives = 77/203 (37%), Gaps = 1/203 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D N+   + K      K    ++I +IL + I +  F+ S EK K  +   +  AL   
Sbjct: 8   IDTNARNERIKNFFINNKKKLIIIISIILVIIIGYLSFENSKEKNKIKLANQYNLALIDL 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           N             ++  ++  Y+PL+  ++    + + + +    +F ++  +      
Sbjct: 68  NPENKQKTIDEMVNVVKSNDATYSPLALYHLLDNNLLENNDEINI-LFNELIENTKLDNE 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           ++     + A    D  S  E+ KIL  +    +     A  +L        + QKAK  
Sbjct: 127 IKNLIIYKKALFNSDFVSENELLKILNPVINSESIWKSHALYLLAEFFYSKDEKQKAKEF 186

Query: 185 FEELAKDNNSPFGISTRSQMILA 207
           F ++    N+   I T SQ  L 
Sbjct: 187 FNQIIILPNANGTIKTESQKRLN 209


>gi|224826451|ref|ZP_03699553.1| conserved hypothetical protein [Lutiella nitroferrum 2002]
 gi|224601552|gb|EEG07733.1| conserved hypothetical protein [Lutiella nitroferrum 2002]
          Length = 209

 Score = 76.6 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/200 (12%), Positives = 56/200 (28%), Gaps = 2/200 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     +       +L      +    +    + +       + +      +  L  
Sbjct: 12  DELKAFWAQWGKWISAAVLAAALGYLGTKGWTYYQQSQAEKASAVYDEVAGAAQAGDLAK 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            +SS   + S   +         +A+           A+  L  A +     A++  A L
Sbjct: 72  MKSSMAVLQSDYGRTAYASRAALLAAKTAFDKQDLALAKSQLTWAAEHAKEPALQAVARL 131

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A++L+D   Y+     L +  E  +       ++ G      G  + A+  +      
Sbjct: 132 RLAAVLLDEKRYDAAIAELNQ--EHVSAYDALFLDLKGDVYAAKGDSKAARDQYRSALAK 189

Query: 192 NNSPFGISTRSQMILANIIA 211
                      Q  L  +  
Sbjct: 190 LAGDSPNRQYIQTKLDALGG 209


>gi|220935215|ref|YP_002514114.1| tetratricopeptide repeat family protein [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996525|gb|ACL73127.1| tetratricopeptide repeat family protein [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 209

 Score = 76.2 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 56/192 (29%), Gaps = 2/192 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M             K             I++ +     +  +   +E +     + F   
Sbjct: 1   MSEYTTDEEKVEAIKKWWQENGKAVIAGIVLGVGGLFGWRYWVDLNETRAERASDLFLAV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                +  L+ AR   + + +   +           + L A     ++AE  L+ A    
Sbjct: 61  DRASRAGDLEQARQQADLLRADYARTPYAPLAALELARLQAARGELDSAEENLRWAIGQG 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               V + A ++ A +LV     +E  + +               E+ G +    G   +
Sbjct: 121 RSEEVTWTARVRLARVLVALERADEALETVAGSHPQG--FEALVEEVRGDAWRAKGDRDQ 178

Query: 181 AKTIFEELAKDN 192
           A+  ++     +
Sbjct: 179 ARAAYDRAIAAS 190


>gi|323499820|ref|ZP_08104779.1| hypothetical protein VISI1226_15271 [Vibrio sinaloensis DSM 21326]
 gi|323315061|gb|EGA68113.1| hypothetical protein VISI1226_15271 [Vibrio sinaloensis DSM 21326]
          Length = 204

 Score = 76.2 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/202 (13%), Positives = 62/202 (30%), Gaps = 3/202 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S    +    E++ +A
Sbjct: 1   MELYDSEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVTAAQEAASESYTKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +   +   +    I +     Y  L+ + +A + V  G+   A    L+ A    
Sbjct: 61  VQALAAKGAEGEAAVQSFIDANKETQYAVLAALQLAKVQVEAGNLDEAL-AQLEWAKTAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              AV      + A +  +   ++     L  +            E+ G   L+ G  Q 
Sbjct: 120 KDEAVSAVINYRLARLKAEQGDFDAAIAELSAI--GDESWAGRVAELRGDILLRKGDSQA 177

Query: 181 AKTIFEELAKDNNSPFGISTRS 202
           A   + E  +  ++   +  + 
Sbjct: 178 AYAAYTEAQQAGDASQTLQMKL 199


>gi|160900449|ref|YP_001566031.1| hypothetical protein Daci_5017 [Delftia acidovorans SPH-1]
 gi|160366033|gb|ABX37646.1| conserved hypothetical protein [Delftia acidovorans SPH-1]
          Length = 227

 Score = 76.2 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/202 (9%), Positives = 53/202 (26%), Gaps = 3/202 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     +  +   ++++I      +  +    +++                      
Sbjct: 14  EQLKHFWNTWGTLITGVLVVIFVGFAGWNGYQYWEKRQATQAAALAHAVDVALAGKDAAR 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A  +F  +  +            + +         + A+  L    D       +  A L
Sbjct: 74  AGQAFADLKDKYAGTTQAAQAGLLLAKAAVDEGKLDDAKAALSWVADKG-DEGYKALAKL 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + +++L     Y+E  K L+              +  G      GK  +A   ++     
Sbjct: 133 RLSAVLEQQKQYDEALKALEG--SMPESFAGIVADRRGDILAAQGKQAEAIDAYQRAHAA 190

Query: 192 NNSPFGISTRSQMILANIIASD 213
            +         +  L  + A  
Sbjct: 191 LDKGVDYGRLIEFKLNALGAEP 212


>gi|302878618|ref|YP_003847182.1| hypothetical protein Galf_1392 [Gallionella capsiferriformans ES-2]
 gi|302581407|gb|ADL55418.1| Protein of unknown function DUF2133 [Gallionella capsiferriformans
           ES-2]
          Length = 212

 Score = 76.2 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 63/199 (31%), Gaps = 2/199 (1%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
            K            ++L+          +     K+       + Q  E   SN +    
Sbjct: 15  LKSWWKDNGNWIVGIVLIATLAMAGVRGYHYYQNKQTTEAATLYQQFTEQLASNDVKRVN 74

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
            +   ++ +            IA+ +   G     A+  L+   +  +   ++  A+L+ 
Sbjct: 75  DAAAAVMDKYASTPYAARAALIAAQVNESGKEPLRAKTQLQWVIEHASEDGLKSVASLRM 134

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           AS+L+D  +Y    K+L+   + +        ++ G      GK   AK  ++      +
Sbjct: 135 ASLLLDEKNYAGALKLLEA--KHAASFDALYADLKGDVLTAQGKPGDAKQAYKLAYDKLD 192

Query: 194 SPFGISTRSQMILANIIAS 212
                    QM L     +
Sbjct: 193 EKSAYRNLVQMKLDAAGDA 211


>gi|171463404|ref|YP_001797517.1| hypothetical protein Pnec_0666 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|171192942|gb|ACB43903.1| conserved hypothetical protein [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 219

 Score = 76.2 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/219 (10%), Positives = 67/219 (30%), Gaps = 5/219 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K     Y+ +   ++  +L     +  +      +     + +   
Sbjct: 1   MPLDLEEQEQLDQFKAFWQKYRNLITGVLTALLFAYAAYSGYQWWRNNQALEASKLYETM 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +        D    + + +    ++      +  +A+ + +       A  +L+ A    
Sbjct: 61  VSAIAKGDKDQTLRAADDLQKDFSRTSYAAMSSLVAARIASDAGDSAKALEYLRWAAKSA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEE-ISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
           +       A L+  + L++  S ++          +P         E  G   L   K +
Sbjct: 121 SNDGYLALAKLRLVTQLIEQGSEKDFAEADQILNQKPIAGFESLWLERRGDWYLAQKKNE 180

Query: 180 KAKTIFEELA----KDNNSPFGISTRSQMILANIIASDQ 214
           +AK  ++E      +    P       ++ L  +  + Q
Sbjct: 181 QAKQSYQEAWKKLDQAKEFPEEAPRLLKVKLDAVGGATQ 219


>gi|117618106|ref|YP_856297.1| TPR repeat-containing protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559513|gb|ABK36461.1| tetratricopeptide repeat family [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 216

 Score = 76.2 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/193 (17%), Positives = 64/193 (33%), Gaps = 6/193 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKW-IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ 59
           ME            K         +    ++ ++ L  W Y  +     +     + + +
Sbjct: 1   MEVYTTEEQQVEVIKSWWKENGTSVIAGTVIGLVGLFGWRYYNEHQQTSQ-ETASQAYNE 59

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
                          +   I +     Y  L+ + +A+  V  G    A E   +VA   
Sbjct: 60  MAAQLAKGDAAGFEQAQSFISAHKGDSYAELAALQLAAAAVKAGKLDLAVEQLTQVAT-- 117

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
               ++R  A L+ A +L D    +E    L K++   +       E+ G   LK GK +
Sbjct: 118 SGDESIRPIAALRLARVLNDQGKADEALAQLGKINN--DAFKAQVAEVRGDVLLKQGKAE 175

Query: 180 KAKTIFEELAKDN 192
           +A+  ++  A   
Sbjct: 176 EARDAYQAAADAG 188


>gi|212634301|ref|YP_002310826.1| putative membrane-associated protein with TPR-like domain
           [Shewanella piezotolerans WP3]
 gi|212555785|gb|ACJ28239.1| putative membrane-associated protein with TPR-like domain
           [Shewanella piezotolerans WP3]
          Length = 206

 Score = 76.2 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/212 (15%), Positives = 74/212 (34%), Gaps = 6/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      +     E+F QA
Sbjct: 1   MEVYSTEEQQVDAIKQFWKDYGSSVVIGAVVGLGGLFGWNYYSDYQLAQAEAASESF-QA 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   N+       ++         + Y  L  + +A   V  GD + A      V     
Sbjct: 60  LSSQNTADAAMLSAAETFAKEHGQQGYQSLLELMVAKSAVETGDLEKAEATLKNVIA-VN 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A  ++   AT++ A +  +   +      L+++ + ++      +E+ G   ++ G+  K
Sbjct: 119 ADSSIVLIATMRLARVQAEQGQFATAITTLEQIKDVASA--AQRDELKGDFLVRQGETDK 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           A+  ++   ++  +        QM L N+  +
Sbjct: 177 ARLAYQAAVENGGTMSS--PTLQMKLDNLNKA 206


>gi|134094493|ref|YP_001099568.1| hypothetical protein HEAR1266 [Herminiimonas arsenicoxydans]
 gi|133738396|emb|CAL61441.1| conserved hypothetical protein; putative TPR domain [Herminiimonas
           arsenicoxydans]
          Length = 216

 Score = 76.2 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/204 (13%), Positives = 67/204 (32%), Gaps = 2/204 (0%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
            K     Y  +   L++++L     +  +     K+ N   + + +  +   +   D  +
Sbjct: 14  LKSWWKQYGNLITWLLIIVLGAYAAWAAWGAYQNKQANQAAQLYEELQKAVTAQDKDQVQ 73

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
                +  +             A+      +    A+  L+   D       +  A+++ 
Sbjct: 74  RVAADMEGKFPGTAYAQMTALAAAKSAFDANDFKTAKAQLQWVIDKGVSDDYKAIASIRL 133

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           A IL+D  +Y+E  K+L               +  G   +   K+ +A+T ++   +  +
Sbjct: 134 AGILLDEKAYDEGLKLLSA--SFPAQFAGVVEDRKGDILMAQNKLDEARTAYQAALEKTD 191

Query: 194 SPFGISTRSQMILANIIASDQRNK 217
           +        Q+ L  I     +  
Sbjct: 192 AKNPGRQLIQIKLDAIGGGAAKKA 215


>gi|260598899|ref|YP_003211470.1| hypothetical protein CTU_31070 [Cronobacter turicensis z3032]
 gi|260218076|emb|CBA32823.1| UPF0070 protein yfgM [Cronobacter turicensis z3032]
          Length = 206

 Score = 76.2 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 76/210 (36%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   + +  ++GS          ++   
Sbjct: 1   MEIYENENEQLDAVKRFFAENGKALAVGVVLGIGALVGWRFWNGSQVDSARESSLHYQNV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    ++      S+ ++ ++Q+   Y  L+ + +A   V K D   A +   +   +  
Sbjct: 61  MTDARADDP-KTLSAAQQFVAQNQNSYGALAALELAQRYVDKNDLAQAVQQLQQGIENTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +R    L+ A I +     +   K L+ +            ++ G + L  G  Q 
Sbjct: 120 -DENLRSLINLRLARIQIQQKQADAALKTLENVK--GENWSAMVADLRGDALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + + A D NSP  +    QM + N+ 
Sbjct: 177 ARDAWSKGADDKNSPA-LGDMMQMKINNLS 205


>gi|168821505|ref|ZP_02833505.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205342006|gb|EDZ28770.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320087016|emb|CBY96785.1| UPF0070 protein 1057 [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 206

 Score = 75.8 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 72/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   +        K           + +++ +   + +  +     +        +  A
Sbjct: 1   MEIYENEYDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWSSHQTESARAASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +++K D    + EK  +++   Y  L++M +A   V K + K A     +      
Sbjct: 61  VTAVSADKPDSI-PAAEKFAAENKNTYGALASMELAQQFVDKNELKKAEAQLQQGLAATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + +     +   K L  +            ++ G + L  G  + 
Sbjct: 120 -DENLKAVINLRLARVQLQLKQADAALKTLDAVKGEG--WTAIVADLRGEALLSKGDKKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E      ++   +S   QM + N+ 
Sbjct: 177 ARSAWEAGVNS-DASPALSEMMQMKINNLS 205


>gi|114799082|ref|YP_759500.1| hypothetical protein HNE_0772 [Hyphomonas neptunium ATCC 15444]
 gi|114739256|gb|ABI77381.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 238

 Score = 75.8 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 44/212 (20%), Positives = 91/212 (42%), Gaps = 3/212 (1%)

Query: 5   NDANSYKGKCK-MGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
            D    + K   + K    ++   +  +I+ +A+  ++     E+++          +  
Sbjct: 8   VDEGIRQEKLAGLWKKWRPFVYGGVAALIIGVAVNEFVLKPQAEQRRQERALALESGIRA 67

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
               + ++A ++F KI+++D KL    ++    +     GD   AAE+   V   +  P 
Sbjct: 68  LEDARYEEAEAAFTKIMNEDPKLAPLAAHFLAQTKYEGGGDAAAAAELLASVGGTEGGP- 126

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
                A L++A    DT S EE+   L  L+   + +   A E++   A + G   +A+T
Sbjct: 127 -YERLALLKSAYFKADTQSLEELELSLGSLANDDSTVGALARELIAAKAFEAGDFARART 185

Query: 184 IFEELAKDNNSPFGISTRSQMILANIIASDQR 215
            +  L  D  +P G+  R+++ LA I  + + 
Sbjct: 186 AYNRLRLDAFAPQGLVRRAEIALAAIPVTAET 217


>gi|293394877|ref|ZP_06639167.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291422628|gb|EFE95867.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 206

 Score = 75.8 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 74/211 (35%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + + ++  +         +++ Q 
Sbjct: 1   MEVYTTENEQVDAVRRFFAENGKALAVGVVLGIGALVGWRVWQSNQNSNMMAASQSYQQT 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E   + K DD  ++ + I +  N  Y  ++ + +A   V + D   A +  L VA    
Sbjct: 61  SEALAAGKADDVAAAEKFIQANGN-NYGVMAALELAKHYVEQNDVAKAEQ-QLIVAQGQA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +     +E  K L  +            ++ G   L  G  + 
Sbjct: 119 KDDNLLSVINLRLARVQLQEKKLDEALKTLDGVKGEG--WAALQADLRGDVLLAKGDAKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +  +  N+   +    +M L N+ +
Sbjct: 177 AREAYSKGIES-NASQTLQLLLRMKLNNLSS 206


>gi|319943738|ref|ZP_08018019.1| tetratricopeptide repeat protein [Lautropia mirabilis ATCC 51599]
 gi|319742971|gb|EFV95377.1| tetratricopeptide repeat protein [Lautropia mirabilis ATCC 51599]
          Length = 213

 Score = 75.8 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 72/211 (34%), Gaps = 2/211 (0%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  N        + K            L ++ L++   +  ++  H+ +       +A  
Sbjct: 1   MAYNLQDQEQIDELKAFWANNGNRLMWLAVIALAVFAGWRAWNWYHDSQAQDAAREYAGL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   +S K++  R  ++ I                A+   AK +  +AA   L+    + 
Sbjct: 61  LSAADSGKIEQVRERYDAIQKGYGSSVYAGMAGLRAAEAFAKANQPDAAVAALESVMKNS 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQK--LSEPSNPMHQFANEILGISALKFGKV 178
                +  A ++ A +L+D   Y+E +K +    +   S  M     +  G      GK 
Sbjct: 121 TEPGFKPIAGVRLAGLLLDQKKYDEATKAIDSGNIGPVSGEMAASVADRRGDILAAQGKA 180

Query: 179 QKAKTIFEELAKDNNSPFGISTRSQMILANI 209
             AK  +EE  K       + +  Q  L  +
Sbjct: 181 SDAKAAWEEALKLLPRHNQLRSLVQYKLDAV 211


>gi|153216244|ref|ZP_01950344.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124114389|gb|EAY33209.1| conserved hypothetical protein [Vibrio cholerae 1587]
          Length = 204

 Score = 75.8 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/209 (14%), Positives = 71/209 (33%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S    +    +++++A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVAAQEAASQSYSKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +  ++   +    I +     Y  L+ M +A   V  G    A    L+ A    
Sbjct: 61  MDALQAKGIESEGTIQTFIDANKETEYAVLAAMQLAKAQVEAGQLDEAL-AQLEWAKGAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A++   T + A +  +   +++    L  + E S        E+ G   ++ G    
Sbjct: 120 KDAALKPLLTFRVARLQAEQGQFDDALTQLTSIQEKSWAGRV--AELRGDILMRKGDSAA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A + + E  +  ++   +    QM L ++
Sbjct: 178 AYSAYTEAQQAEDASQTL----QMKLDDL 202


>gi|255261721|ref|ZP_05341063.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255104056|gb|EET46730.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 231

 Score = 75.8 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 39/213 (18%), Positives = 85/213 (39%), Gaps = 5/213 (2%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           +  +    + +       Y W+A L+++ ++  A W        E +   +G+     L+
Sbjct: 9   NEVNDEVREDQLFQTFRKYGWVAALVVVALVGGAAWSEFSKSRTENQAKALGDA---VLD 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
              + +  DA ++ E I +  N     ++ +  A+ L       +AA++   V+ D    
Sbjct: 66  ALETEEPVDAVAALETIDATGNA--AAVTALLRAAELQRADAAADAADVLDSVSLDGDVD 123

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              R  AT +A  +  DT    E       LS+P NP    + E + +  ++   ++ A 
Sbjct: 124 PIYRDLATFKALLLRADTLDASERRAGFHALSQPGNPYRLMSVEQIALLDVEADDLEAAL 183

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
             F  + +D  +  G+  R++ ++  + A    
Sbjct: 184 RGFAAILEDAEATTGLRRRARGMIVALGADPDE 216


>gi|292492500|ref|YP_003527939.1| hypothetical protein Nhal_2464 [Nitrosococcus halophilus Nc4]
 gi|291581095|gb|ADE15552.1| Tetratricopeptide TPR_4 [Nitrosococcus halophilus Nc4]
          Length = 212

 Score = 75.8 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 66/209 (31%), Gaps = 2/209 (0%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ++            K           + I++ L        +    + +       + Q 
Sbjct: 3   LDIYASDQEKSEAIKQWWRENARAVLVGIIIGLLALFGLRGWTEYKQNRIREASSLYQQI 62

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L         +  +S E+++   +     L ++ + +          AA    K A +  
Sbjct: 63  LTAKAQEAGAEIYNSAERLVQDYSDTPYGLFSVLMLAKEDQARGDAEAAAERFKNALEHT 122

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +R    L+ A +L+   + EE    L ++            E+ G + ++ G++ +
Sbjct: 123 QNTGLRRVIYLRLARLLLAEGNPEEALTTLAEI--EPGSFASAYAELRGDAHVELGQLPE 180

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A+  ++E   D            M L NI
Sbjct: 181 ARQAYQEALLDLGPGEPRRQILSMKLDNI 209


>gi|28199498|ref|NP_779812.1| hypothetical protein PD1621 [Xylella fastidiosa Temecula1]
 gi|182682231|ref|YP_001830391.1| hypothetical protein XfasM23_1713 [Xylella fastidiosa M23]
 gi|28057613|gb|AAO29461.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|182632341|gb|ACB93117.1| conserved hypothetical protein [Xylella fastidiosa M23]
 gi|307578505|gb|ADN62474.1| hypothetical protein XFLM_02375 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 212

 Score = 75.4 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 74/207 (35%), Gaps = 10/207 (4%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D   +  + +             +L+       +   +     +     + FA   +L  
Sbjct: 8   DEQEHGERIRSWLRKNGVGLLCGVLLGFVFIAAWQWREAKQVDQFTSAAQQFAVFGKLLQ 67

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + +L +A  +  K+    + LY  L  + +A      G+T  A +I              
Sbjct: 68  AKELGNAAQALAKLNGAPSGLYAELGALQLAKAQSEAGNTAEAIKI----LRTLPVDSQF 123

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A  + A +LV T   +E +K+L   ++  +       EI G + L  GK ++A+  +
Sbjct: 124 KLIADQRLARLLVATGKADEANKLLATRNDDVS------FEIQGDALLVLGKREQARERY 177

Query: 186 EELAKDNNSPFGISTRSQMILANIIAS 212
            +     +S        ++ L ++  +
Sbjct: 178 AKALAMGDSAAPQRRILEIKLMDVGGT 204


>gi|323491633|ref|ZP_08096812.1| hypothetical protein VIBR0546_18526 [Vibrio brasiliensis LMG 20546]
 gi|323314209|gb|EGA67294.1| hypothetical protein VIBR0546_18526 [Vibrio brasiliensis LMG 20546]
          Length = 204

 Score = 75.4 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 67/209 (32%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K           L  ++ L     +  +  S    +    E++ +A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVILGAVVGLGGLFGWRYYQDSVTAAQEAASESYTKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++                I +     Y  L+ + +A + V  G+   A    L+ A    
Sbjct: 61  VQTLAEKGASAEGDIQAFIDANKETEYAVLAALQLAKVQVEAGNLDEAL-AQLEWAKSTT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              AV      + A +  +   ++     L  +++ S        E+ G   L+ G  Q 
Sbjct: 120 KDAAVSAVLNYRLARVKAEQGEFDAAVSELANITDQSWAGRV--AELKGDILLRKGDAQG 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + +  +  ++   +    QM L ++
Sbjct: 178 AYAAYTQAQQSGDASQTL----QMKLDDL 202


>gi|253996243|ref|YP_003048307.1| hypothetical protein Mmol_0871 [Methylotenera mobilis JLW8]
 gi|253982922|gb|ACT47780.1| conserved hypothetical protein [Methylotenera mobilis JLW8]
          Length = 207

 Score = 75.4 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 72/210 (34%), Gaps = 3/210 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K     Y  +    ++ +L   + +  +     K+       +   
Sbjct: 1   MAYDLEEQEQLDELKAWWKTYGKMVINSVIGLLVAYVAYQGWTYYQTKQAVNASTEYQAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L +   +       +   +       Y   + ++ A       D   +A+  L+ A  + 
Sbjct: 61  LVVDAKDLKGVQAKTAVLMDKYSATPYAGRAVVFAAKANYEANDI-KSAKAQLEWAVSNA 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              +V   A+LQ A+IL + ++++   K+L+   +          ++ G   L  GK  +
Sbjct: 120 KETSVSAIASLQLANILAEENNFDAALKVLEAKHDAG--FDGLFLDMKGDVLLGLGKRDE 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           AK  +E      +        +Q  + ++ 
Sbjct: 178 AKAAYELALTKLDVQGRYRHLTQQKIDSLG 207


>gi|15837065|ref|NP_297753.1| hypothetical protein XF0463 [Xylella fastidiosa 9a5c]
 gi|9105309|gb|AAF83273.1|AE003896_10 hypothetical protein XF_0463 [Xylella fastidiosa 9a5c]
          Length = 218

 Score = 75.4 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 73/207 (35%), Gaps = 10/207 (4%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D   +  + +             +L+       +   +     +     + FA   +L  
Sbjct: 14  DEQEHGERIRSWLRKNGVGLLCGVLLGFVFIAAWQWREAKQVDQFTSAAQQFAVFGKLLQ 73

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + +L +A  +  K+      LY  L  + +A      G+T  A +I              
Sbjct: 74  AKELGNAAQALAKLNGAPAGLYAELGALQLAKAQSEAGNTAEAIKI----LRTLPVDSQF 129

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A  + A +LV T   +E +K+L   ++  +       EI G + L  GK ++A+  +
Sbjct: 130 KLIADQRLARLLVATGKADEANKLLATRNDDVS------FEIQGDALLVLGKREQARERY 183

Query: 186 EELAKDNNSPFGISTRSQMILANIIAS 212
            +     +S        ++ L ++  +
Sbjct: 184 AKALAMGDSAAPQRRILEIKLMDVGGT 210


>gi|85059736|ref|YP_455438.1| hypothetical protein SG1758 [Sodalis glossinidius str. 'morsitans']
 gi|84780256|dbj|BAE75033.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 204

 Score = 75.0 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 70/211 (33%), Gaps = 7/211 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +  N  +   +           + +++ +   + +  +   H          +   
Sbjct: 1   MEVYSTDNEQRDALRRFFVDNGKALAIGVVLGVGALVGWRYWHNHHNDAMMAASSAWQPV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               +         + +     ++  Y  L++M +A     +GD   AAE  L+ A    
Sbjct: 61  NAGLSGQAAQPQLDAAQHFADANDNNYGALTSMGLARQFAERGDFP-AAEKQLQKALGQT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + +   + +   K L  + +        A +  G + +  G  Q 
Sbjct: 120 REANLQSLINLRLARVQLQQKNVDGALKTLDGVKDQG--WTALAEDTRGDAQVIKGDQQA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+T +E+  +            +M L N+ +
Sbjct: 178 ARTAYEKALQSGAP----QALVRMKLNNLSS 204


>gi|170694781|ref|ZP_02885932.1| Tetratricopeptide TPR_2 repeat protein [Burkholderia graminis
           C4D1M]
 gi|170140412|gb|EDT08589.1| Tetratricopeptide TPR_2 repeat protein [Burkholderia graminis
           C4D1M]
          Length = 209

 Score = 75.0 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/207 (12%), Positives = 61/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +      ++L+ L  A  +  ++    ++       + Q  +   
Sbjct: 5   DEQESIEGLKAWWAQWGNATTWIVLVALVAAAGWNGWNFWQRRQAAEAAVLYDQVQQAVA 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           S            +  + ++          A+  +     +  A+  L+   D       
Sbjct: 65  SGDKAKISRVAADMEDKFSRTAYAQMTALGAAKALYAAGDEAGAKAQLQWTIDHAKDDEF 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y++   +L +    S+          G      GK   A+  +
Sbjct: 125 KQIARLRLASLLLDEKAYDQGLALLAE--PQSDAFKGIVANGRGDLLAAQGKRDDARAAY 182

Query: 186 EELAKDNNSPFGI-STRSQMILANIIA 211
           +   +             Q  L  +  
Sbjct: 183 KLALESLPKNDSSERQLIQFKLDALGG 209


>gi|127512224|ref|YP_001093421.1| tetratricopeptide TPR_4 [Shewanella loihica PV-4]
 gi|126637519|gb|ABO23162.1| Tetratricopeptide TPR_4 [Shewanella loihica PV-4]
          Length = 207

 Score = 75.0 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 32/212 (15%), Positives = 68/212 (32%), Gaps = 5/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      +     E F   
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGNSIVIGAVVGLGGLYSWNYYSDYKVAQAEEASEAFQTI 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                ++    A +          + Y  L  + +A   V  G+   A +   ++     
Sbjct: 61  SNSVKADSSMLAAAESFAKDHDGQQGYQALLQLIVAKAAVEAGELDKAEQALKQILV-SK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   ATL+ A +  +          L++L+ PS       +E+ G   ++ G   K
Sbjct: 120 PEEGLVAVATLRLARVQAEQGQLATALATLEQLNTPS--FAVQRDELKGDFLVRQGDADK 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           AK+ ++    +  +    +   QM L N+  +
Sbjct: 178 AKSAYQSALDNGGATSSPA--LQMKLDNLNKA 207


>gi|294140148|ref|YP_003556126.1| hypothetical protein SVI_1377 [Shewanella violacea DSS12]
 gi|293326617|dbj|BAJ01348.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 206

 Score = 75.0 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 30/212 (14%), Positives = 66/212 (31%), Gaps = 6/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      +  +  E F   
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGSSIAVGAVVGLGGLFGWNYYSDHQITQAELASEAFQAV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                S+      ++ E      ++         I +    +      AE  LK      
Sbjct: 61  SASNISDN--GMLTAAENFAKDHSQKGYQSLLELIVAKAAVEAGDLEKAEATLKSVVASA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   AT++ A +  +          L ++S+P        +E+ G   ++ G  ++
Sbjct: 119 PDKGLVMVATMRLARVQAEQGQIATAITTLSQVSDP--AFTAQRDELKGDFLVRKGDDEQ 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           AK  ++   K+  +    +   QM L N+  +
Sbjct: 177 AKAAYQAAVKNGGTSASPA--LQMKLDNLNKA 206


>gi|218708643|ref|YP_002416264.1| hypothetical protein VS_0621 [Vibrio splendidus LGP32]
 gi|218321662|emb|CAV17616.1| Conserved hypothetical protein [Vibrio splendidus LGP32]
          Length = 204

 Score = 75.0 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 68/202 (33%), Gaps = 3/202 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S  + +    E++  A
Sbjct: 1   MELYDSEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVEAREAASESYTSA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   ++  +D        I +  +  Y+ L+ M +A   V  GD   A E  L+ A    
Sbjct: 61  ISALDAKGVDAQSDIQAFIDANKDAEYSVLAAMQLAKAQVQAGDLTAALE-QLEWAKSAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    T + A I  +   ++     L+ ++           E+ G  +L+ G    
Sbjct: 120 KDAALAPLLTYRVARIKAEQGEFDAALTDLEAMT--DESWTGRVAELRGDISLRKGDTDA 177

Query: 181 AKTIFEELAKDNNSPFGISTRS 202
           A + + E  +  ++   +  + 
Sbjct: 178 AYSAYSEAQQAADASQTLQIKL 199


>gi|114771863|ref|ZP_01449256.1| hypothetical protein OM2255_13007 [alpha proteobacterium HTCC2255]
 gi|114547679|gb|EAU50570.1| hypothetical protein OM2255_13007 [alpha proteobacterium HTCC2255]
          Length = 225

 Score = 75.0 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 76/203 (37%), Gaps = 7/203 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            K K       Y WI  ++I  ++  A +      +     +  G+    AL    +   
Sbjct: 27  RKDKLFALYKKYAWIPVVVICSLVGGAGFLEYQKSAKANAASARGDALIAAL----NQDD 82

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
              R+S   ++S++     P++ ++ A +L+ + D   +  ++  +             A
Sbjct: 83  ASIRASELALISENGGDEAPIAKLHRAGVLLEQDDIAGSLAVYDSM---SGGDDIYSQVA 139

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            L+A  I  +    +   + L  ++ P N     A E   I+ +  G   KA  IF  L 
Sbjct: 140 MLKAIMIRGNKMDNDTRMQALDAIATPGNAFRVIAMEQKAIAYIDMGNSDKAIEIFSTLI 199

Query: 190 KDNNSPFGISTRSQMILANIIAS 212
           ++ +    +  RS+ ++  +   
Sbjct: 200 EEADVSQALIARSKQMILALGGE 222


>gi|261212139|ref|ZP_05926425.1| membrane protein [Vibrio sp. RC341]
 gi|260838747|gb|EEX65398.1| membrane protein [Vibrio sp. RC341]
          Length = 204

 Score = 75.0 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 70/209 (33%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  +    +     N++QA
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDTVVAAQEAASHNYSQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +   D   S    I +     Y  L+ M +A   V  G    A    L+ A    
Sbjct: 61  MDALVAKGADAESSIQTFIDANKETEYAVLAAMQLAKAQVDAGQLDEAL-AQLEWAKGAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A++   T + A +  + S +++    L  + E S        E+ G   ++ G    
Sbjct: 120 QDPALKPLLTFRVARLQAEQSQFDDALTQLSNIQEKSWAGRV--AELRGDILMRKGDSAG 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  + +++   +    QM L ++
Sbjct: 178 AYAAYTEAQQADDASQTL----QMKLDDL 202


>gi|33152174|ref|NP_873527.1| hypothetical protein HD1040 [Haemophilus ducreyi 35000HP]
 gi|33148396|gb|AAP95916.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 207

 Score = 75.0 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/193 (12%), Positives = 59/193 (30%), Gaps = 3/193 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K           + I++   +   +  +     +      EN+   +E +      +
Sbjct: 15  EEAKNWFKENGTPILVAIVIACCVTFGWNFWKNHQLQIAQQTSENYQAVMESYLQAPEKN 74

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
                + I       Y   + +  A   V K D    A+I L  A      + ++     
Sbjct: 75  QPLLVKFIEDHKASSYATFAQLEQARQAVDKADFA-TAKIILTDALTSTTDVTLQAVIRF 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +      Y+     L +L EP+    +      G      G  ++AK  +++    
Sbjct: 134 RLAMVDFQLKEYDTALATLAQLKEPAWEQRKHLL--RGDIFAIKGDSEQAKQAYKQALAL 191

Query: 192 NNSPFGISTRSQM 204
            +    +    ++
Sbjct: 192 ADEQDKLLIEVRL 204


>gi|88858478|ref|ZP_01133120.1| putative membrane-associated protein with TPR-like domain
           [Pseudoalteromonas tunicata D2]
 gi|88820095|gb|EAR29908.1| putative membrane-associated protein with TPR-like domain
           [Pseudoalteromonas tunicata D2]
          Length = 211

 Score = 75.0 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 69/209 (33%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K           + +++ L     +  ++ +  +      + + + 
Sbjct: 1   MEIYSTEEQQAEAIKRFFRENGTALVIGVVLGLGGLYGWKAYNQNQVESAEAASDAYEKL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++    NK +    + E I +  +  Y  L+    A   V K D   A E  L     + 
Sbjct: 61  VKADAQNKTNALAGADEFIKNNKDSSYAVLAAFVAAKEAVEKADFNLAKEK-LTWITQNN 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   A  + A I ++  +Y+   K+L               E+ G      G + +
Sbjct: 120 KNPELNAIANSRIARIELELKNYDAALKVLS--VTMPEAFKASVAELKGDVYRAQGDLGQ 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A++ ++  A         +   QM L ++
Sbjct: 178 ARSAYQAAADAGGLTNNAT--LQMKLDDL 204


>gi|260776631|ref|ZP_05885526.1| membrane protein [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607854|gb|EEX34119.1| membrane protein [Vibrio coralliilyticus ATCC BAA-450]
          Length = 204

 Score = 74.7 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 68/209 (32%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S    +    E++ +A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVTAAQEAASESYTKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +   +   +    I +     Y  L+ + +A + V  G    A    L+ A    
Sbjct: 61  VQELAAKGAEGEGAVQSFIDANKETQYAVLAALQLAKVQVEAGSLDEAL-AQLEWAKTAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    + + A +  +   ++     L  ++           E+ G   L+ G  + 
Sbjct: 120 EDQALISVISFRLARLKAEQGEFDAAVSELAAIN--DESWAGRVAELKGDILLRKGDAEG 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  + +++   I    QM L ++
Sbjct: 178 AYAAYTEAQQADDASQTI----QMKLDDL 202


>gi|254506813|ref|ZP_05118953.1| Tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           16]
 gi|219550394|gb|EED27379.1| Tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           16]
          Length = 204

 Score = 74.7 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 28/202 (13%), Positives = 63/202 (31%), Gaps = 3/202 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S    +    E++ QA
Sbjct: 1   MELYDSEEQQVEAIKDWWKENGKAVIFGAVLGLGGLFGWRYYQDSVTAAQEAASESYTQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +N      +    I +     Y  L+ + +A + V   +   A    L+ A    
Sbjct: 61  VQELAANGAAGEAAVQSFIDANKETQYAVLAALQLAKVQVEANNLDEAL-AQLEWAKTAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              AV      + A +  +  +++     L  +++ S           G   L+ G  Q 
Sbjct: 120 KDEAVLSVINYRLARLKAEQGNFDAALSELAAITDESWAGRVAEQ--KGDILLRKGDEQA 177

Query: 181 AKTIFEELAKDNNSPFGISTRS 202
           A   + E  +  ++   +  + 
Sbjct: 178 AYAAYTEAQQSGDASQTLQMKL 199


>gi|317049134|ref|YP_004116782.1| hypothetical protein Pat9b_2927 [Pantoea sp. At-9b]
 gi|316950751|gb|ADU70226.1| Protein of unknown function DUF2133 [Pantoea sp. At-9b]
          Length = 205

 Score = 74.7 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 65/210 (30%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  ++ N      +           + +++ ++    +  +              + + 
Sbjct: 1   MEVYSNENEQVDALRRFFANNGKALAVGVIIGIAALGGWRFWASHEAGNDKAASAEYQK- 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L             +     S++N  Y  L+++ +A   V       A  +      D  
Sbjct: 60  LTSAMQADKPQTLEAVASFASENNNTYGALASLDLAKQYVETNQLDKAIALLQSGLKDTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I +  +  +     L  +            +I G + L  G  Q 
Sbjct: 120 -DANLQAVINLRLARIQLQQNQADAALSTLNNVKGDG--WTAIVADIRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + + A+   SP  +    QM + N+ 
Sbjct: 177 ARDAWSKGAESQASPA-LKQMLQMKMNNLS 205


>gi|237747711|ref|ZP_04578191.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229379073|gb|EEO29164.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 214

 Score = 74.7 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 26/214 (12%), Positives = 72/214 (33%), Gaps = 4/214 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K     +      +++++L+    +  +     K+     + + + 
Sbjct: 1   MAYDLEEQEKLDSLKAWWKRHGNWITWVLIVVLAGYAAYAYWGYYQRKQAAQASQLYYEM 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKL-YNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
                +   + A+   +    +  +  Y P+ ++  A +     D   A      V ++ 
Sbjct: 61  QNAVVAGDNERAQRIAKDTQDKFGRTAYAPMISLVAAKMAYDAKDIDEAKTQLKWVIDNG 120

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
                 +  A ++ A IL++  +Y+E  KI+             A +  G   +   K+ 
Sbjct: 121 SLD-GYKAMARVRLAGILLEEKAYDEGMKIMS--VTFPESFVSLAEDRKGDLLVAQDKIP 177

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           +A+  ++   +  +         ++ L  I  S 
Sbjct: 178 EARKAYQTALEKASPDDPGKQLIELKLEEIGGSA 211


>gi|226328003|ref|ZP_03803521.1| hypothetical protein PROPEN_01894 [Proteus penneri ATCC 35198]
 gi|225203707|gb|EEG86061.1| hypothetical protein PROPEN_01894 [Proteus penneri ATCC 35198]
          Length = 206

 Score = 74.7 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 31/210 (14%), Positives = 64/210 (30%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +  N      K     Y     L  ++       +  +      +       FA  
Sbjct: 1   MEVYSTENEQVDAIKQFFKNYGLTIVLAAVIGFGGVFGWKYWQSHQTNRLQESAGAFATI 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E       ++   + EK +++ N +Y  L+++ +A I +   D  +             
Sbjct: 61  SEALAKPTPENIALA-EKFVTETNDIYGALASLELAQIAIDANDLVSGERHLTNAVAKVK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                     L+ A + +     +     L+++       +   N I G    K G    
Sbjct: 120 NDA-FADMLNLRLARVQLALDKTDAALVSLEQVK--GKAWNGMKNYIRGDVLAKKGDNAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A   +     D N+   I +  ++ L N+ 
Sbjct: 177 AAAAYRSALTDENA-GAIRSLVELKLNNLS 205


>gi|85712735|ref|ZP_01043780.1| Uncharacterized conserved membrane protein [Idiomarina baltica
           OS145]
 gi|85693467|gb|EAQ31420.1| Uncharacterized conserved membrane protein [Idiomarina baltica
           OS145]
          Length = 205

 Score = 74.3 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 39/212 (18%), Positives = 77/212 (36%), Gaps = 7/212 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+   +      + K     +        ++ L L   +  +D +  + +N     +   
Sbjct: 1   MDQTEEQQV--ERIKEFWAEHGKGIIAGAIIGLGLFFGWRYYDKATIEAQNTASRGYEAV 58

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   N+ +     ++   I S  N  Y  L+ + +      +GD   A   F  V  D  
Sbjct: 59  VSQLNAGEEGAISNAQNFIKSHQNSQYGYLAALQLGRFAADEGDLATAVTSFQSVI-DGG 117

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   +   A ++ A +L   + Y+    +L    E       FANEI G   +  G   K
Sbjct: 118 ADDNLAAIARVRLARVLAAQAQYQPALDVLN--VELPKAYLAFANEIKGDVYVAQGDTAK 175

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           A+  +E+    + S   +S   ++ L ++  S
Sbjct: 176 AREAYEKALNSDGST--LSPAVELKLNSLAKS 205


>gi|71898144|ref|ZP_00680330.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|71732118|gb|EAO34174.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
          Length = 212

 Score = 74.3 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 73/207 (35%), Gaps = 10/207 (4%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D   +  + +             +L+       +   +     +     + FA   +L  
Sbjct: 8   DEQEHGERIRSWLRKNGVGLLCGVLLGFVFIAAWQWREAKQVDQFTSAAQQFAVFGKLLQ 67

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + +L +A  +  K+      LY  L  + +A      G+T  A +I              
Sbjct: 68  AKELGNAAQALAKLNGAPAGLYAELGALQLAKAQSEAGNTAEAIKI----LRTLPVDSQF 123

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A  + A +LV T   +E +K+L   ++  +       EI G + L  GK ++A+  +
Sbjct: 124 KLIADQRLARLLVATGKADEANKLLATRNDDVS------FEIQGDALLVLGKREQARERY 177

Query: 186 EELAKDNNSPFGISTRSQMILANIIAS 212
            +     +S        ++ L ++  +
Sbjct: 178 AKALAMGDSAAPQRRILEIKLMDVGGT 204


>gi|325981899|ref|YP_004294301.1| hypothetical protein NAL212_1229 [Nitrosomonas sp. AL212]
 gi|325531418|gb|ADZ26139.1| Protein of unknown function DUF2133 [Nitrosomonas sp. AL212]
          Length = 212

 Score = 74.3 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 70/209 (33%), Gaps = 2/209 (0%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
           N++        K     Y     +++  +L+ A     ++   +K+    G+ +    ++
Sbjct: 5   NHEDQEKVDGFKGWWDKYGTAIVIIMTGMLATAGAIKAWEYYQQKQAQQAGDLYVLLKQV 64

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
              N  +    + + ++   +          IA+   A       A   L+   D     
Sbjct: 65  QAGNDSEKINDTAQLLMQGYSSSGYAPRAALIAAQADAHAGNNKRAIQNLQWILDHAKET 124

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            +R  A L+ + IL+D   Y+E  + L      S        +  G   +   ++ +A+ 
Sbjct: 125 EMRDLARLRISGILLDEGKYDEALRFLDD--GYSEAFSGLYLDRKGDIQVATQRISEARL 182

Query: 184 IFEELAKDNNSPFGISTRSQMILANIIAS 212
            ++E     +         QM L  +  S
Sbjct: 183 SYQEAINALDKSNNYYNIVQMKLDGLGNS 211


>gi|198283715|ref|YP_002220036.1| hypothetical protein Lferr_1607 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218665406|ref|YP_002426344.1| hypothetical protein AFE_1935 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198248236|gb|ACH83829.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218517619|gb|ACK78205.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 203

 Score = 74.3 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/198 (16%), Positives = 72/198 (36%), Gaps = 4/198 (2%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
               ++      I+++L  A+ F+ ++     +       + + ++   + +   AR+S 
Sbjct: 9   FLYRHRVSVIAGIIIVLLAAMGFFGYEKYQRHQVERAAVLYNELVDTLVAGQTSTARASA 68

Query: 77  EKILSQDNKL-YNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAAS 135
           + ++ Q     Y   +  ++A +         A      V     AP  ++  ATL  A 
Sbjct: 69  DTLVHQYGHTPYAIFARFFLARMDSESNQIPAAEAELNSVIQAKNAPRGLKSIATLSLAR 128

Query: 136 ILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSP 195
           + +D    ++   +   L  P        NEI G + +   +  KA   ++       + 
Sbjct: 129 LYLDQKQAQKALDM---LKAPDAAFATLQNEIQGDAYVALHQDGKAMRAYQAAIAALPAA 185

Query: 196 FGISTRSQMILANIIASD 213
               +  QM +ANI  + 
Sbjct: 186 DPYRSYLQMKMANIGVAP 203


>gi|148979609|ref|ZP_01815614.1| hypothetical protein VSWAT3_08983 [Vibrionales bacterium SWAT-3]
 gi|145961694|gb|EDK26991.1| hypothetical protein VSWAT3_08983 [Vibrionales bacterium SWAT-3]
          Length = 204

 Score = 74.3 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 67/202 (33%), Gaps = 3/202 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S  + +    E++   
Sbjct: 1   MELYDSEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVEAREAASESYTTV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   ++  +D        I +  +  Y+ L+ M +A + V  G+   A E  L+ A    
Sbjct: 61  ISALDAKGVDAQSDIQAFIDANKDAEYSVLAAMQLAKVQVQAGELSAALE-QLEWAKAAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    T + A I  +   ++     L  ++           E+ G  +L+ G    
Sbjct: 120 KDAALSPLLTYRVARIKAEQGEFDAALSDLAAVT--DESWKGRVAELRGDISLRKGDTDA 177

Query: 181 AKTIFEELAKDNNSPFGISTRS 202
           A + + E  +  ++   +  + 
Sbjct: 178 AYSAYTEAQQAVDASQTLQIKL 199


>gi|54307960|ref|YP_128980.1| hypothetical protein PBPRA0765 [Photobacterium profundum SS9]
 gi|46912386|emb|CAG19178.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 203

 Score = 74.3 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 69/209 (33%), Gaps = 8/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K           L  ++ L     +  + G  +  K +  + ++Q 
Sbjct: 1   MEVYETEEQQVEALKSWWKENGKAVVLGAVIGLGGLYGWRYYQGEVQTTKELTSDAYSQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +S   +        I + ++  Y+ L+ + +A   V   D   A +      +   
Sbjct: 61  MTTLDSGSENAVADVQAFISANESSQYSVLAALQLAKTQVELSDLDGAIKQLTWAISQTK 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+   A  + A I  +   ++E    L K++  S        E+ G   L  G V  
Sbjct: 121 -DQAILPLAQTRLARIYAEQQKFDEALAELDKVTATS--WQSKIAELRGDILLLKGDVIA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A+  +    +   SP       QM L ++
Sbjct: 178 ARKAYISAQQLGASPA-----LQMKLDDL 201


>gi|84387627|ref|ZP_00990644.1| hypothetical protein V12B01_09156 [Vibrio splendidus 12B01]
 gi|84377472|gb|EAP94338.1| hypothetical protein V12B01_09156 [Vibrio splendidus 12B01]
          Length = 204

 Score = 74.3 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 68/202 (33%), Gaps = 3/202 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S  + + +  E +   
Sbjct: 1   MELYDSEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVEAREVASEGYTSV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   ++  +D        I +  +  Y+ L+ M +A   V  GD   A E  L+ A    
Sbjct: 61  ISALDAKGVDAQSDIQAFIDANKDAEYSVLAAMQLAKAQVQAGDLAAALE-QLEWAKSAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    T +AA I  +   ++     L+ ++           E+ G  +L+ G    
Sbjct: 120 KDAALTPLLTYRAARIKAEQGEFDAALTDLEAMT--DESWTGRVAELRGDISLRKGDTDA 177

Query: 181 AKTIFEELAKDNNSPFGISTRS 202
           A + + E  +  ++   +  + 
Sbjct: 178 AYSAYSEAQQAADASQTLQIKL 199


>gi|28897384|ref|NP_796989.1| hypothetical protein VP0610 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838547|ref|ZP_01991214.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|260876343|ref|ZP_05888698.1| tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           AN-5034]
 gi|260898614|ref|ZP_05907110.1| tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           Peru-466]
 gi|260899286|ref|ZP_05907681.1| tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           AQ4037]
 gi|28805596|dbj|BAC58873.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748062|gb|EDM58921.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|308086924|gb|EFO36619.1| tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           Peru-466]
 gi|308092840|gb|EFO42535.1| tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           AN-5034]
 gi|308106655|gb|EFO44195.1| tetratricopeptide repeat family protein [Vibrio parahaemolyticus
           AQ4037]
 gi|328472594|gb|EGF43457.1| hypothetical protein VP10329_12226 [Vibrio parahaemolyticus 10329]
          Length = 204

 Score = 73.9 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 73/209 (34%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K           +  ++ L     +  +  +  +      +++  A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQDTVIQASETASQSYTTA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +       +D        I S + K Y+ L+ + +A   V   D   A E  LK A  + 
Sbjct: 61  MNTLQEKGVDAQSDVQAFIESNEVKEYSVLAALQLAKAQVEAKDFAAALE-QLKWAQSNT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    + + A I  +  +++  +  L K+++          E+ G  AL+ G    
Sbjct: 120 KDAALSPLISYRIARIETEMGNFDAANTELGKVTDT--AWAGRIAELRGDIALRQGDKDA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  +  ++   +    QM L ++
Sbjct: 178 AYAAYTEAQQAADASPTL----QMKLDDL 202


>gi|145589470|ref|YP_001156067.1| hypothetical protein Pnuc_1289 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047876|gb|ABP34503.1| conserved hypothetical protein [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 219

 Score = 73.9 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/219 (10%), Positives = 64/219 (29%), Gaps = 5/219 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K     Y+ +   +    L     +  +      +     + +   
Sbjct: 1   MPLDLEEQEQLDQFKAFWQKYRNLITGVATAALFAYAAYSGYQWWRNNQALEASKLYETM 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +        +    + + +     +      +  +A+ + A       +  +L+    + 
Sbjct: 61  VSAIAKGDKEQTLRAADDLQKDFGRTPYAPMSSLVAARIAADAGDSAKSLDYLRWTAKNA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEE-ISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
           +       A ++  S L++  S ++          +P         E  G   L    + 
Sbjct: 121 SNEGYLALAKMRLVSQLIERGSEKDFAEADQILKDKPVAGFEALWLERRGDWYLAQKNIP 180

Query: 180 KAKTIFE----ELAKDNNSPFGISTRSQMILANIIASDQ 214
           +AK  ++    +L +D   P       ++ L  +    Q
Sbjct: 181 EAKNSYQAAWKKLDQDKEFPEEARRLLKVKLDAVGGVAQ 219


>gi|90410875|ref|ZP_01218889.1| hypothetical protein P3TCK_14620 [Photobacterium profundum 3TCK]
 gi|90328088|gb|EAS44399.1| hypothetical protein P3TCK_14620 [Photobacterium profundum 3TCK]
          Length = 203

 Score = 73.9 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 70/209 (33%), Gaps = 8/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K           L  ++ L     +  + G  +  K +  + ++Q 
Sbjct: 1   MEVYETEEQQVEALKSWWKENGKAVVLGAVIGLGGLYGWRYYQGEVQTTKELTSDAYSQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +S   +        I + ++  Y+ L+ + +A   V  GD   A +      +   
Sbjct: 61  MTTLDSGSENAVADVQAFISANESSQYSVLAALQLAKTQVELGDLDGAIKQLTWAISQTK 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+   A  + A I  +   ++E    L K++  S        E+ G   L  G +  
Sbjct: 121 -DQAILPLAQTRLARIYAEQQKFDEALAELDKVTATS--WQSKIAELRGDILLLKGDIIA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A+  +    +   SP       QM L ++
Sbjct: 178 ARNAYISAQQLGASPA-----LQMKLDDL 201


>gi|251788750|ref|YP_003003471.1| hypothetical protein Dd1591_1120 [Dickeya zeae Ech1591]
 gi|247537371|gb|ACT05992.1| conserved hypothetical protein [Dickeya zeae Ech1591]
          Length = 206

 Score = 73.9 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 71/211 (33%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +    E         + QA
Sbjct: 1   MEVYTTENEQVEVIRRFFVENGKALAIGVVLGIGALVGWRFWQNHQESSAMAASAAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E  ++   +   S+ + I    +  Y  L+++ +A   V K D   A +   +      
Sbjct: 61  TEALSAGTPEGINSAEKFITGD-HGNYGALASLALAHQFVEKNDIAKAEQQLRQALGQTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A +L+     +E  K L  +           +++ G      G  Q 
Sbjct: 120 -DGDLQAMINLRLARVLLQQKKPDEALKALDAIKLEG--WVAMVSDVRGDVLASKGDTQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +      +  G+ +  ++ L N+ +
Sbjct: 177 ARDAYNKGMAAKPA-QGLQSLLRLKLNNLPS 206


>gi|213649665|ref|ZP_03379718.1| hypothetical protein SentesTy_21640 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
          Length = 202

 Score = 73.9 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/196 (13%), Positives = 67/196 (34%), Gaps = 4/196 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + +      K           + +++ +   + +  +     +        +  A
Sbjct: 1   MEIYENEHDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWSSHQTESARAASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +++K D    + EK  +++   Y  L++M +A   V K + K A     +      
Sbjct: 61  VTAVSADKPDSI-PAAEKFAAENKNTYGALASMELAQQFVDKNELKKAEAQLQQGLAATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + +     +   K L  +            ++ G + L  G  + 
Sbjct: 120 -DENLKAVINLRLARVQLQLKQADAALKTLDAVKGEG--WTAIVADLRGEALLSKGDKKG 176

Query: 181 AKTIFEELAKDNNSPF 196
           A++ +E     + SP 
Sbjct: 177 ARSAWEAGVNSDASPA 192


>gi|162149031|ref|YP_001603492.1| hypothetical protein GDI_3261 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545220|ref|YP_002277449.1| hypothetical protein Gdia_3104 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787608|emb|CAP57204.1| conserved protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532897|gb|ACI52834.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 229

 Score = 73.9 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 71/186 (38%), Gaps = 11/186 (5%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNK---------LDDARSSFEKIL--SQDNKLY 87
           +        +        +  AL   +S++             + + ++           
Sbjct: 43  WQYHAWRGRQADRAWAATYFTALHAADSSQIVPGETARLTPQQQDALKRFATLDTAPPGL 102

Query: 88  NPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEIS 147
             L+ +  A++L + GDT+ A  ++ +VA+D  A   +R  A+L      +D      + 
Sbjct: 103 RTLARLERAALLASSGDTRGALSLWTQVADDGAADPQLRSLASLLWVQRQIDDGDPATLR 162

Query: 148 KILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
             L  L     P    A E   +  L+ G+   A+  F +L+ + + P G+ +R+  +L 
Sbjct: 163 SRLTTLDGVGKPWRALAIECEAMLDLRQGRTADARRRFAQLSAEADVPDGLRSRAGGLLQ 222

Query: 208 NIIASD 213
            + AS 
Sbjct: 223 TLNASP 228


>gi|307250430|ref|ZP_07532377.1| hypothetical protein appser4_12110 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306857559|gb|EFM89668.1| hypothetical protein appser4_12110 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 207

 Score = 73.5 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/177 (11%), Positives = 59/177 (33%), Gaps = 3/177 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K           + +++  +  + +  +     +        +   +E +  +   +
Sbjct: 15  EEAKNWFKENGTPILVAVIIACAATLGWNFWQNHQVQAAQQTSATYQNVMESYLQDPEKN 74

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
                + I    +  Y   S +  A   V K D    A+  L+ A    +  +++     
Sbjct: 75  RPLVEKFISENKDSSYAVFSQLESAKQAVEKADFA-TAKTVLQSALTSTSDASLQTIIRF 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           + A++     +Y++    L ++++           + G   +  G    AK ++E+ 
Sbjct: 134 RLATLDYQLKNYDDALATLGQITDQVWEQR--KLVLTGDILVAKGDKASAKGVYEKA 188


>gi|114320409|ref|YP_742092.1| hypothetical protein Mlg_1253 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226803|gb|ABI56602.1| conserved hypothetical protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 209

 Score = 73.5 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/213 (12%), Positives = 64/213 (30%), Gaps = 4/213 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M S+          K           + +++       ++ +    E+        +A  
Sbjct: 1   MASHPSDEEQLEAIKRWWQENGRSIIIGLILGAGAVGGWWTWGAWQERTAVEAANAYADF 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   N  + + A    E++L    +             L  +    + A   L+ A +  
Sbjct: 61  MAPLNQGEYETAIRHGERVLDNHRRSLYATMTALQMGALHMEQGEPDRAAERLRWAVEHA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+R  A L+ A  L      +E  +      +          E+     L+ G+ ++
Sbjct: 121 DSAALRDLARLRLARALAADGRQQEALEQ----LDDGGAYAGQMAELRADLLLELGREEE 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           A++ +      N+         Q+ L ++    
Sbjct: 177 ARSAYRAALNQNDITPTQRELIQIKLDDLGGGA 209


>gi|86145596|ref|ZP_01063926.1| hypothetical protein MED222_01542 [Vibrio sp. MED222]
 gi|85836567|gb|EAQ54693.1| hypothetical protein MED222_01542 [Vibrio sp. MED222]
          Length = 204

 Score = 73.5 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 68/202 (33%), Gaps = 3/202 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S  + +    E++  A
Sbjct: 1   MELYDSEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVEAREAASESYTSA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   ++  +D        I +  +  Y+ L+ M +A   V  GD   A E  L+ A    
Sbjct: 61  ISALDAKGVDAQSDIQAFIDANKDAEYSVLAAMQLAKAQVQAGDLTAALE-QLEWAKSAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    T + A I  +   ++     L+ ++           E+ G  +L+ G    
Sbjct: 120 KDAALAPLLTYRVARIKAEQGEFDAALTDLEAMT--DESWKDRVAELRGDISLRKGDTDA 177

Query: 181 AKTIFEELAKDNNSPFGISTRS 202
           A + + E  +  ++   +  + 
Sbjct: 178 AYSAYSEAQQAADASQTLQIKL 199


>gi|71908596|ref|YP_286183.1| putative transmembrane protein [Dechloromonas aromatica RCB]
 gi|71848217|gb|AAZ47713.1| putative transmembrane protein [Dechloromonas aromatica RCB]
          Length = 212

 Score = 73.5 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/201 (11%), Positives = 61/201 (30%), Gaps = 4/201 (1%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
            K     Y  +   +I+ +    I +  ++     +       +    +          +
Sbjct: 15  LKTWWKMYGNLVTNVIVALSLAVIGWQGWNWYQGSQATKASAIYGVLEQAAAVGDAQKVK 74

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
           ++  ++  +            +A+    +      A+  L    ++     V+  A L+ 
Sbjct: 75  AAAGELAEKFGGTNYAALGAMLAAKQSFEAGDLKTAKTQLSWVAENGKDE-VKDLARLRL 133

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
            ++ +D  +Y+E  K L      +        E+ G       K  +A+T ++   +   
Sbjct: 134 VAVQLDDKAYDEAMKQLDA--AHAPVFDARFLELKGDVLSAQEKKAEARTAYKAALEKMT 191

Query: 194 SPF-GISTRSQMILANIIASD 213
               G     Q  L  +  + 
Sbjct: 192 GKQGGGRELLQQKLDGLGEAA 212


>gi|71274605|ref|ZP_00650893.1| conserved hypothetical protein [Xylella fastidiosa Dixon]
 gi|71900905|ref|ZP_00683020.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|71164337|gb|EAO14051.1| conserved hypothetical protein [Xylella fastidiosa Dixon]
 gi|71729317|gb|EAO31433.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
          Length = 212

 Score = 73.5 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 73/207 (35%), Gaps = 10/207 (4%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D   +  + +             +L+       +   +     +     + FA   +L  
Sbjct: 8   DEQEHGERIRSWLRKNGVGLLCGVLLGFVFIAAWQWREAKQVDQFTSAAQQFAVFGKLLQ 67

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + +L +A  +  K+      LY  L  + +A      G+T  A +I              
Sbjct: 68  AKELGNAAQALAKLNGASAGLYAELGALQLAKAQSEAGNTAEAIKI----LCTLPVDSQF 123

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A  + A +LV T   +E +K+L   ++  +       EI G + L  GK ++A+  +
Sbjct: 124 KLIADQRLARLLVATGKADEANKLLATRNDDVS------FEIQGDALLLLGKREQARERY 177

Query: 186 EELAKDNNSPFGISTRSQMILANIIAS 212
            +     +S        ++ L ++  +
Sbjct: 178 AKALAMGDSAAPQRRILEIKLMDVGGA 204


>gi|261340817|ref|ZP_05968675.1| putative inner membrane protein [Enterobacter cancerogenus ATCC
           35316]
 gi|288317243|gb|EFC56181.1| putative inner membrane protein [Enterobacter cancerogenus ATCC
           35316]
          Length = 206

 Score = 73.5 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 71/210 (33%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   + +  ++             +   
Sbjct: 1   MEIYENENDQVDAVKRFFAENGKALVVGVILGVGALMGWRYWNSHQADSARGASLAYENT 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    +++     ++ EK ++ +   Y  L+ + +A   V K +   AA    +      
Sbjct: 61  VSDIRADQP-QTLAAAEKFVADNKNTYGALAALEVAQQYVDKNELDKAAAQLSQSLAAAS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I V     ++  K L  +            ++ G + L  G  + 
Sbjct: 120 -DENLKAVINLRLARIQVQQKKADDALKTLDTIKGEG--FAAIVADLRGEALLSKGDKEG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  ++   +   SP  +S   QM + N+ 
Sbjct: 177 ARKAWQAGVESKASPA-LSEMMQMKINNLS 205


>gi|145299529|ref|YP_001142370.1| hypothetical protein ASA_2597 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142852301|gb|ABO90622.1| conserved hypothetical protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 216

 Score = 73.5 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/192 (15%), Positives = 61/192 (31%), Gaps = 4/192 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K              ++ L     +  ++      +    + + + 
Sbjct: 1   MEVYTTEEQQVEVIKSWWKENGTSVLAGTVIGLVGLFGWRYYNDYQLTNQEAASQAYNEI 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                             I     + Y  L+ + +A+  V       AAE   +VA++  
Sbjct: 61  SAQLAKGDAATFEQVQAFITDHKGEAYAELAALQLAAAAVKANKLDLAAEQLTQVASN-- 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              ++R  A L+ A +L D    +E    L K++   +       E+ G    K GK ++
Sbjct: 119 GDESIRPIAALRLARVLNDQGKADEALTQLGKINN--DAFKAQVAEVRGDILYKQGKAEE 176

Query: 181 AKTIFEELAKDN 192
           A+  ++  A   
Sbjct: 177 ARDAYQAAADAG 188


>gi|170730867|ref|YP_001776300.1| hypothetical protein Xfasm12_1777 [Xylella fastidiosa M12]
 gi|167965660|gb|ACA12670.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 212

 Score = 73.5 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 73/207 (35%), Gaps = 10/207 (4%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D   +  + +             +L+       +   +     +     + FA   +L  
Sbjct: 8   DEQEHGERIRSWLRKNGVGLLCGVLLGFVFIAAWQWREAKQVDQFTSAAQQFAVFGKLLQ 67

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + +L +A  +  K+      LY  L  + +A      G+T  A +I              
Sbjct: 68  AKELGNAAQALAKLNGASAGLYAELGALQLAKAQSEAGNTAEAIKI----LRTLPVDSQF 123

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A  + A +LV T   +E +K+L   ++  +       EI G + L  GK ++A+  +
Sbjct: 124 KLIADQRLARLLVATGKADEANKLLATRNDDVS------FEIQGDALLLLGKREQARERY 177

Query: 186 EELAKDNNSPFGISTRSQMILANIIAS 212
            +     +S        ++ L ++  +
Sbjct: 178 AKALAMGDSAAPQRRILEIKLMDVGGA 204


>gi|161830472|ref|YP_001597098.1| hypothetical protein COXBURSA331_A1392 [Coxiella burnetii RSA 331]
 gi|161762339|gb|ABX77981.1| conserved hypothetical protein [Coxiella burnetii RSA 331]
          Length = 206

 Score = 73.1 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 61/183 (33%), Gaps = 2/183 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y     L I++ L +   +  +     +K       + Q   L + N  D 
Sbjct: 12  EMIKKWWRDYGRAIALAIVIGLLIGFGWRYWHRHQLEKTERASALYMQLQILASQNAWDK 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            +   ++++    K        ++ +    + +    A   L+    +     ++  A L
Sbjct: 72  TKPLTDRLIKDYGKTPYAAMASFLNAKRAVEQNHLPLALDQLQWVMKNAIVSDLKQLARL 131

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           +A+ IL+  +  +    +LQ + +          EI G      G  + AK  +E   + 
Sbjct: 132 RASRILLAENRPKAALNLLQTVDDQ--AYQPLVGEIKGDIYAAMGNRESAKQFYETAQQS 189

Query: 192 NNS 194
             +
Sbjct: 190 MKA 192


>gi|29654550|ref|NP_820242.1| hypothetical protein CBU_1247 [Coxiella burnetii RSA 493]
 gi|153208853|ref|ZP_01947077.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154706028|ref|YP_001424684.1| hypothetical protein CBUD_1331 [Coxiella burnetii Dugway 5J108-111]
 gi|165921441|ref|ZP_02219629.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|212218661|ref|YP_002305448.1| hypothetical protein CbuK_1107 [Coxiella burnetii CbuK_Q154]
 gi|29541817|gb|AAO90756.1| hypothetical protein CBU_1247 [Coxiella burnetii RSA 493]
 gi|120575704|gb|EAX32328.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154355314|gb|ABS76776.1| hypothetical protein CBUD_1331 [Coxiella burnetii Dugway 5J108-111]
 gi|165916756|gb|EDR35360.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|212012923|gb|ACJ20303.1| hypothetical protein CbuK_1107 [Coxiella burnetii CbuK_Q154]
          Length = 206

 Score = 73.1 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 62/183 (33%), Gaps = 2/183 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y     L I++ L +   +  +     +K       + Q   L + N  D 
Sbjct: 12  EMIKKWWRDYGRAIALAIVIGLLIGFGWRYWHRHQLEKTERASALYMQLQILASQNAWDK 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            +   ++++    K        ++ +    + +    A   L+    +     ++  A L
Sbjct: 72  TKPLTDRLIKDYGKTPYAAMASFLNAKRAVEQNHLPLALDQLQWVMKNAIVSDLKQLARL 131

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           +A+ IL+  +  +    +LQ + +         +EI G      G  + AK  +E   + 
Sbjct: 132 RASRILLAENRPKAALNLLQTVDDQ--AYQPLVDEIKGDIYAAMGNRESAKQFYETAQQS 189

Query: 192 NNS 194
             +
Sbjct: 190 MKA 192


>gi|167581707|ref|ZP_02374581.1| hypothetical protein BthaT_26419 [Burkholderia thailandensis TXDOH]
          Length = 209

 Score = 73.1 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/207 (13%), Positives = 56/207 (27%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   + + +L+ A  +  ++    ++       + Q      
Sbjct: 5   DEQESIENLKAWWARWGNLTTWIAIAVLAAAAAWNGWNYWQRRQAAQAAVLYEQVQLAVQ 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           SN           +  +             A+  +        A+  L+   D       
Sbjct: 65  SNDKAKVSRIASDMEDKFGSTAYAQMTALEAAKALYGAGDPAGAKAQLQWTVDHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P         +  G      GK  +AK  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPPEAFKGAVADRRGDLLAAQGKNDEAKAAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
                             Q  L  +  
Sbjct: 183 TLALDALPKDDASARQLVQFKLDALGG 209


>gi|83720781|ref|YP_442757.1| hypothetical protein BTH_I2236 [Burkholderia thailandensis E264]
 gi|167619823|ref|ZP_02388454.1| hypothetical protein BthaB_26192 [Burkholderia thailandensis Bt4]
 gi|257138967|ref|ZP_05587229.1| hypothetical protein BthaA_07130 [Burkholderia thailandensis E264]
 gi|83654606|gb|ABC38669.1| conserved hypothetical protein [Burkholderia thailandensis E264]
          Length = 209

 Score = 73.1 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/207 (13%), Positives = 56/207 (27%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   + + +L+ A  +  ++    ++       + Q      
Sbjct: 5   DEQESIENLKAWWARWGNLTTWIAIAVLAAAAAWNGWNYWQRRQATQAAVLYEQVQLAVQ 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           SN           +  +             A+  +        A+  L+   D       
Sbjct: 65  SNDKVKVSRIASDMEDKFGSTAYAQMTALEAAKALYGAGDAAGAKAQLQWTVDHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     P         +  G      GK  +AK  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPPEAFKGAVADRRGDLLAAQGKNDEAKAAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
                             Q  L  +  
Sbjct: 183 TLALDALPKDDASARQLVQFKLDALGG 209


>gi|285018366|ref|YP_003376077.1| hypothetical protein XALc_1588 [Xanthomonas albilineans GPE PC73]
 gi|283473584|emb|CBA16087.1| hypothetical protein, tpr repeat protein [Xanthomonas albilineans]
          Length = 212

 Score = 73.1 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/212 (12%), Positives = 67/212 (31%), Gaps = 10/212 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ++   D +    + +             I + L   + +  +     +        +   
Sbjct: 3   IDDLLDEHEQSERVRTWLRKNGAGLIGGIALGLGAILGWQWWAKQRSENLAQANSRYEAV 62

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L+   + +LD A     ++    + +Y  L+ + +A      G +       L       
Sbjct: 63  LKSIEAKQLDKAGKDLTQLQQGSSDIYVVLAGLRLAKAQADAGKSD----AALATLRALK 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   ++     + A +L+     E+  K+L    +  +       EI G + +  GK   
Sbjct: 119 ADGEIKRLVDQRMAFLLLQAGKPEDALKLLASADDTRS------LEIRGDALIAQGKRDA 172

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           A+ ++ +     +         +M L +   +
Sbjct: 173 ARDVYVKSLAGLDIAAPQRRLLEMKLMDAGGT 204


>gi|327481751|gb|AEA85061.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166]
          Length = 213

 Score = 72.7 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/199 (12%), Positives = 55/199 (27%), Gaps = 6/199 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ---ALELFNSNKLD 70
            K           L  ++ L L   +  +      +       + Q   A          
Sbjct: 13  IKDWWQRNGKPLVLGAVIALVLVFGWQFWQKHQINQAQSASVVYQQLLGAALESGEADAA 72

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT 130
           +       +       +         + +  +    + A   L+   D  A   +   A 
Sbjct: 73  EVSRLGNLLKKDFAGTHYAQYGSLFVAKVAVESGRLDEAASELRAIVDKPADKTLDELAR 132

Query: 131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
            + A +L      +E  K+L    +          E+ G   ++ G+  +A   + +  +
Sbjct: 133 QRLARVLAAQGKADEAIKLLDG--KVDAAFVASREELRGDLLVQLGRNDEAHAAYSKAKE 190

Query: 191 DNNSPFGISTRSQMILANI 209
             +    I    QM L ++
Sbjct: 191 SLSQDAAIGG-LQMKLDDL 208


>gi|53719149|ref|YP_108135.1| hypothetical protein BPSL1515 [Burkholderia pseudomallei K96243]
 gi|53723540|ref|YP_103003.1| hypothetical protein BMA1343 [Burkholderia mallei ATCC 23344]
 gi|67639882|ref|ZP_00438711.1| transmembrane protein [Burkholderia mallei GB8 horse 4]
 gi|76811993|ref|YP_333747.1| hypothetical protein BURPS1710b_2352 [Burkholderia pseudomallei
           1710b]
 gi|121601612|ref|YP_993152.1| hypothetical protein BMASAVP1_A1833 [Burkholderia mallei SAVP1]
 gi|124385333|ref|YP_001026073.1| hypothetical protein BMA10229_A0064 [Burkholderia mallei NCTC
           10229]
 gi|126440459|ref|YP_001059223.1| hypothetical protein BURPS668_2188 [Burkholderia pseudomallei 668]
 gi|126449987|ref|YP_001080659.1| hypothetical protein BMA10247_1105 [Burkholderia mallei NCTC 10247]
 gi|126454178|ref|YP_001066490.1| hypothetical protein BURPS1106A_2226 [Burkholderia pseudomallei
           1106a]
 gi|134277817|ref|ZP_01764532.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|167002241|ref|ZP_02268031.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|167719271|ref|ZP_02402507.1| hypothetical protein BpseD_09617 [Burkholderia pseudomallei DM98]
 gi|167738267|ref|ZP_02411041.1| hypothetical protein Bpse14_09380 [Burkholderia pseudomallei 14]
 gi|167815457|ref|ZP_02447137.1| hypothetical protein Bpse9_09949 [Burkholderia pseudomallei 91]
 gi|167823869|ref|ZP_02455340.1| hypothetical protein Bpseu9_09330 [Burkholderia pseudomallei 9]
 gi|167845408|ref|ZP_02470916.1| hypothetical protein BpseB_08978 [Burkholderia pseudomallei B7210]
 gi|167902399|ref|ZP_02489604.1| hypothetical protein BpseN_09032 [Burkholderia pseudomallei NCTC
           13177]
 gi|167918670|ref|ZP_02505761.1| hypothetical protein BpseBC_08955 [Burkholderia pseudomallei
           BCC215]
 gi|217421822|ref|ZP_03453326.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|226197497|ref|ZP_03793074.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|237812547|ref|YP_002896998.1| hypothetical protein GBP346_A2296 [Burkholderia pseudomallei
           MSHR346]
 gi|242314250|ref|ZP_04813266.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254178474|ref|ZP_04885129.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254179553|ref|ZP_04886152.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|254189057|ref|ZP_04895568.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254197501|ref|ZP_04903923.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|254199949|ref|ZP_04906315.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|254206282|ref|ZP_04912634.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|254259731|ref|ZP_04950785.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|254358303|ref|ZP_04974576.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|52209563|emb|CAH35516.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|52426963|gb|AAU47556.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344]
 gi|76581446|gb|ABA50921.1| putative membrane protein [Burkholderia pseudomallei 1710b]
 gi|121230422|gb|ABM52940.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|124293353|gb|ABN02622.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|126219952|gb|ABN83458.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|126227820|gb|ABN91360.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|126242857|gb|ABO05950.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
 gi|134251467|gb|EBA51546.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|147749545|gb|EDK56619.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|147753725|gb|EDK60790.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|148027430|gb|EDK85451.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|157936736|gb|EDO92406.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|160699513|gb|EDP89483.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|169654242|gb|EDS86935.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|184210093|gb|EDU07136.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|217395564|gb|EEC35582.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|225930876|gb|EEH26886.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|237505672|gb|ACQ97990.1| transmembrane protein [Burkholderia pseudomallei MSHR346]
 gi|238520493|gb|EEP83952.1| transmembrane protein [Burkholderia mallei GB8 horse 4]
 gi|242137489|gb|EES23891.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|243062058|gb|EES44244.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|254218420|gb|EET07804.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 209

 Score = 72.7 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 61/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   + + +L+ A  +  ++    ++       + QA +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWVAIAVLAAAAAWNGWNYWQRRQATQAAVLYEQAQQAVR 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           SN           +  +             A+  +        A+  L+ A D       
Sbjct: 65  SNDKAKISRVASDMEDKFGGTAYAQMTALEAAKALYGAGDAAGAKAQLQWAADHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     PS+       +  G      GK   AK  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPSDAFKGAVADRRGDLLAAQGKSDDAKAAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +                 Q  L  +  
Sbjct: 183 KLALDALPKDDASARQLVQFKLDALGG 209


>gi|330830066|ref|YP_004393018.1| tetratricopeptide repeat family protein [Aeromonas veronii B565]
 gi|328805202|gb|AEB50401.1| Tetratricopeptide repeat family [Aeromonas veronii B565]
          Length = 216

 Score = 72.7 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 67/214 (31%), Gaps = 6/214 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKW-IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ 59
           ME            K         +    ++ ++ L  W Y      E        ++ Q
Sbjct: 1   MEVYTTEEQQVEVIKEWWKENGTSVIAGTVIGLVGLFGWRYYNQHQQET-MEASSHSYNQ 59

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
            +E            + + + +     Y  L+ + +A+  V  G    AAE    VA   
Sbjct: 60  VIEQLAKGDAAGFEQAQQFVTANKGDSYGELAALQLAAAAVKAGKLDLAAEQLNLVAT-- 117

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
               ++R  A L+ A +L D    +E    L  +   +        E  G    K GK +
Sbjct: 118 TGDESIRPIAALRLARVLNDQGKADEALAKLATI--QNEAFKAQVAEARGDVLQKQGKTE 175

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           +A+  ++  A           + +M    + A  
Sbjct: 176 EARDAYQAAADAGGLQGSAELKLKMDDLALPAVA 209


>gi|83594416|ref|YP_428168.1| hypothetical protein Rru_A3086 [Rhodospirillum rubrum ATCC 11170]
 gi|83577330|gb|ABC23881.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 253

 Score = 72.3 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 61/164 (37%), Gaps = 1/164 (0%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
               +      ++      F  A +                + +  +  Y PL+ +  A+
Sbjct: 52  GVQGWRVYQADQRAEQAARFDAARDRLAKGDSAALEDL-AALAADRSSGYAPLAALRRAA 110

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
            L  +G T  A + +  + ND  A    R AA + A    +      EI  +LQ L + +
Sbjct: 111 ALADEGKTDEAIQGYRGLINDSAADPVFRDAARVLAVLHGLTLLDPAEIGGLLQPLRDGT 170

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
            P    A E+  +S+L+ G  + A  I   +  D  +P G+  R
Sbjct: 171 GPWRPLAEELAAVSSLRQGDSKAAIEILRGILGDPQAPRGVRQR 214



 Score = 37.7 bits (85), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/145 (10%), Positives = 41/145 (28%)

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    ++      + F ++                  +++A       A   ++      
Sbjct: 1   MAKPPADTDPQQDALFREVEEDLRHERLAEIWKQYGGLIIAAAVVVVLAVAGVQGWRVYQ 60

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A      AA   AA   +       +  +    ++ S+     A      +    GK  +
Sbjct: 61  ADQRAEQAARFDAARDRLAKGDSAALEDLAALAADRSSGYAPLAALRRAAALADEGKTDE 120

Query: 181 AKTIFEELAKDNNSPFGISTRSQMI 205
           A   +  L  D+ +       ++++
Sbjct: 121 AIQGYRGLINDSAADPVFRDAARVL 145


>gi|320539278|ref|ZP_08038948.1| putative conserved protein [Serratia symbiotica str. Tucson]
 gi|320030670|gb|EFW12679.1| putative conserved protein [Serratia symbiotica str. Tucson]
          Length = 206

 Score = 72.3 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/210 (12%), Positives = 73/210 (34%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ ++  + +  +            +++ + 
Sbjct: 1   MEVYTTENEQVDALRRFFAENGKALAVGVVLGIAALVGWRYWQNHQSVDLMAASQSYQEV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +   + K DD  ++ EK +  ++  Y+ L+ + +A   V + D   A +  ++ A    
Sbjct: 61  SDRLAAGKPDDV-AAAEKFVQANSNSYSVLAALQLAKHFVEQNDVAKAEQQLVQ-AQSQT 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +    ++   K L ++ +          +  G   L  G  Q 
Sbjct: 119 RDDNLLSQINLRLARVQLQEKKWDHALKTLDEVKDAG--WAALVQDTRGDVLLAKGDAQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A   + +  +  N    +    ++ L N+ 
Sbjct: 177 AHEAYSKGLES-NVSQALEVLLRIKLNNLS 205


>gi|300022383|ref|YP_003754994.1| hypothetical protein Hden_0856 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299524204|gb|ADJ22673.1| Protein of unknown function DUF2133 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 264

 Score = 72.3 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 45/175 (25%), Positives = 88/175 (50%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
            +  F+      +   G +++ A  L ++ K ++A ++F+KI  +    Y  L+ + +A+
Sbjct: 45  GYKFFESRRIVAEQAAGADYSAAETLSDNKKKEEAEAAFKKIAEEGPAGYGSLARLQLAA 104

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
            L+  G T +A   +  +A +  A   ++  A LQAAS+ +  + Y EI   L  ++   
Sbjct: 105 ALLKDGKTADAIATYEALAKESGADNLLKSFAQLQAASLRMPDADYAEIQNRLTPIAGDD 164

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
            P  + A E+LG++A K GK  +A+   E L  D N    +  R +++++ I A+
Sbjct: 165 APFSKSARELLGVAAYKAGKFDEARKYLEPLLIDPNVSEALQERVKILMSGIAAA 219


>gi|165976602|ref|YP_001652195.1| hypothetical protein APJL_1195 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|303253249|ref|ZP_07339398.1| hypothetical protein APP2_0556 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307248198|ref|ZP_07530226.1| hypothetical protein appser2_11790 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|165876703|gb|ABY69751.1| hypothetical protein APJL_1195 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|302647931|gb|EFL78138.1| hypothetical protein APP2_0556 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306855375|gb|EFM87550.1| hypothetical protein appser2_11790 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 207

 Score = 72.3 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 18/177 (10%), Positives = 55/177 (31%), Gaps = 3/177 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K           + +++  +  + +  +     +        +   +E +  +   +
Sbjct: 15  EEAKNWFKENGTPILVAVIIACAATLGWNFWQNHQVQAAQQTSATYQNVMESYLQDPEKN 74

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
                + I    +  Y   S +  A   V K D   A  +            +++     
Sbjct: 75  QPLVEKFISENKDSSYAVFSQLESAKQAVEKADFATAKTVLQSALASTS-DASLQTIIRF 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           + A++     +Y++    L ++++           + G   +  G    AK ++E+ 
Sbjct: 134 RLATLDYQLKNYDDALATLGQITDQVWEQR--KLVLTGDILVAKGDKASAKGVYEKA 188


>gi|167910641|ref|ZP_02497732.1| hypothetical protein Bpse112_09110 [Burkholderia pseudomallei 112]
 gi|254297429|ref|ZP_04964882.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|157807047|gb|EDO84217.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
          Length = 209

 Score = 72.3 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 61/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   + + +L+ A  +  ++    ++       + QA +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWVAIAVLAAAAAWNGWNYWQRRQATQAAVLYEQAQQAVR 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           SN           +  +             A+  +        A+  L+ A D       
Sbjct: 65  SNDKAKISRVASDMEDKFGGTAYAQMTALEAAKALYGAGDAAGAKAQLQWAADHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     PS+       +  G      GK   AK  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--SPSDAFKGAVADRRGDLLAAQGKSDDAKAAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +                 Q  L  +  
Sbjct: 183 KLALDALPKDDASARQLVQFKLDALGG 209


>gi|146312648|ref|YP_001177722.1| hypothetical protein Ent638_3007 [Enterobacter sp. 638]
 gi|145319524|gb|ABP61671.1| conserved hypothetical protein [Enterobacter sp. 638]
          Length = 206

 Score = 72.3 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 31/210 (14%), Positives = 75/210 (35%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   + +  ++            ++   
Sbjct: 1   MEMYENENDQVDAVKRFFAENGKALAVGVILGVGALMGWRYWNSHQADSARGASLSYENT 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    +++     ++ EK  + +  +Y  L+++ +A   V K +   AA    +  +   
Sbjct: 61  VSAIRADQP-QTLAAAEKFAADNKNIYGALASLEVAQQFVDKNELDKAAAQLQQGLSATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I V     ++  K L  +            ++ G + L  G  Q 
Sbjct: 120 -DDNLKAVINLRLARIQVQQKKADDALKTLDTIKGEG--FAAIVADLRGEALLSKGDKQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ +E   K  N+   +S   QM + N+ 
Sbjct: 177 ARSAWESGVKS-NASPALSEMMQMKINNLS 205


>gi|296104192|ref|YP_003614338.1| hypothetical protein ECL_03855 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295058651|gb|ADF63389.1| hypothetical protein ECL_03855 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 206

 Score = 72.3 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 71/210 (33%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + +      K           + +++ +   I +  ++            ++   
Sbjct: 1   MEIYENEHDQVDAIKRFFAENGKALVVGVILGVGALIGWRYWNNHQADSARGASLSYENT 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    +++     ++ EK  + +   Y  L+ + +A   + K +   AA    +      
Sbjct: 61  VSAIRADQP-QTLTAAEKFAADNKNTYGALAALEVAQQYIDKNELDKAAAQLSQGLAAAS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I V     +E  K L  +            ++ G + L  G    
Sbjct: 120 -DDNLKAVINLRLARIQVQQKKADEALKTLDTIKGEG--FAAIVADLRGEALLSKGDKAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  ++    D+N+   +S   QM + N+ 
Sbjct: 177 ARKAWQAGV-DSNASPALSEMMQMKINNLS 205


>gi|197285698|ref|YP_002151570.1| hypothetical protein PMI1843 [Proteus mirabilis HI4320]
 gi|227356209|ref|ZP_03840598.1| tetratricopeptide TPR_4 [Proteus mirabilis ATCC 29906]
 gi|194683185|emb|CAR43823.1| putative membrane protein [Proteus mirabilis HI4320]
 gi|227163673|gb|EEI48589.1| tetratricopeptide TPR_4 [Proteus mirabilis ATCC 29906]
          Length = 206

 Score = 72.3 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 36/210 (17%), Positives = 69/210 (32%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +  N      K     Y     L I++ +     +  +      +       FA  
Sbjct: 1   MEVYSTENEQVDAIKQFLKNYGLTIILAIVIGVGGIWGWKYWQSHQANRLQESAGEFATI 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E       ++   + EK +S+ N +Y  L+++ +A + +   D     E  L  A   +
Sbjct: 61  NEALTKPTPENIALA-EKFVSETNDIYGALASLELAQLAIDANDLAKG-ETHLTKAISMV 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A      L+ A + +     +     L+++           N I G    K G    
Sbjct: 119 KNEAFADMLNLRLARVQLALDKTDAALISLEQVKSK--AWDGMKNYIRGDVLAKKGDNAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A   +     D N+   I +  ++ L N+ 
Sbjct: 177 AAAAYRNALNDENA-GAIRSLVELKLNNLS 205


>gi|91225137|ref|ZP_01260359.1| hypothetical protein V12G01_12955 [Vibrio alginolyticus 12G01]
 gi|269965172|ref|ZP_06179306.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|91190080|gb|EAS76351.1| hypothetical protein V12G01_12955 [Vibrio alginolyticus 12G01]
 gi|269830158|gb|EEZ84385.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 204

 Score = 72.3 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/209 (15%), Positives = 71/209 (33%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K           +  ++ L     +  +  S  +      +++  A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQDSVIQASEAASQSYTTA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +        D        I S + K Y+ L+ + +A   V   D   A E  LK A  + 
Sbjct: 61  MNALQDKGTDAQADVKAFIESNEVKEYSVLAALQLAKAQVEAQDLSAALE-QLKWAQSNT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    + + A I  +  +++  +  L  +++          E+ G  A++ G    
Sbjct: 120 QDAALLPLISYRIARIETEMGNFDAATAELSNVTDT--AWTGRIAELRGDIAIRQGDKDA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  +  ++   +    QM L ++
Sbjct: 178 AYAAYTEAQQAADASPTL----QMKLDDL 202


>gi|320157272|ref|YP_004189651.1| hypothetical protein VVM_04008 [Vibrio vulnificus MO6-24/O]
 gi|319932584|gb|ADV87448.1| hypothetical protein VVMO6_02426 [Vibrio vulnificus MO6-24/O]
          Length = 204

 Score = 72.3 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 72/202 (35%), Gaps = 3/202 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  N         K           +  ++ L     +  +  S  + +    +N+  A
Sbjct: 1   MEVYNTEEEQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQDSVTQAREAASQNYTSA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    +   + A      I S D K Y+ L+ + +A   V  GD   AA   LK A  + 
Sbjct: 61  INALQAKGAEAAADVEAFIASNDVKEYSVLAALQLAKAQVTAGDLN-AALTQLKWAQSNS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    T + A +  +  +++     L K++           E+ G  AL+ G  + 
Sbjct: 120 KDAALIPLTTYRIARVEAELGNFDAAKAELAKVT--DASWTGRVAELRGDIALRQGDKEA 177

Query: 181 AKTIFEELAKDNNSPFGISTRS 202
           A + + E  +  ++   +  + 
Sbjct: 178 AYSAYSEAQQAADAGQTLQMKL 199


>gi|254363200|ref|ZP_04979249.1| hypothetical protein MHA_2783 [Mannheimia haemolytica PHL213]
 gi|261493282|ref|ZP_05989809.1| hypothetical protein COK_1691 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496474|ref|ZP_05992854.1| hypothetical protein COI_2192 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|153095094|gb|EDN75645.1| hypothetical protein MHA_2783 [Mannheimia haemolytica PHL213]
 gi|261307677|gb|EEY09000.1| hypothetical protein COI_2192 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261311132|gb|EEY12308.1| hypothetical protein COK_1691 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 206

 Score = 72.0 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 54/183 (29%), Gaps = 4/183 (2%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K           + I++  +    +  +     +       ++   +E +  N   +
Sbjct: 15  EDAKNWFKENGTPILVAIILACAATAGWNFWKNHQLETAQKTSASYQSVMESYLQNPSKN 74

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
                + I    +  Y   +   +A   V KG+   A      V     +   ++  A  
Sbjct: 75  QPLVEKFIADNKDSSYAAFAQFEVAKQAVEKGNFSAAKTALQSVLTY--SDSTLQSIARF 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A I     SY+E    L ++             + G      G +  AK+ +E+    
Sbjct: 133 RLAQIDFQLKSYDEALASLAQI--QDKAWELRKQILTGDILAAKGDIPAAKSAYEQAKTT 190

Query: 192 NNS 194
            N 
Sbjct: 191 ANP 193


>gi|326570124|gb|EGE20169.1| hypothetical protein E9U_04475 [Moraxella catarrhalis BC8]
          Length = 277

 Score = 72.0 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/226 (10%), Positives = 61/226 (26%), Gaps = 22/226 (9%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----- 59
           ND N    K       +       +L++L++   +  +  ++ K   +  + +       
Sbjct: 7   NDNNFTDQKSLNALKLHGEKIIYAVLLVLAVFFGWQYYQKNYAKIDTVAADAYTSISVRD 66

Query: 60  ---------------ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
                          A +     +          + +  N +Y   + M  A       D
Sbjct: 67  ERLVQAYLNPQLDEVAKQALAEEEKQLFGDIDALVAAHGNTVYAWQALMIKARHQTNNND 126

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFA 164
              A     +  + +L    +   A ++ A  ++          I  +            
Sbjct: 127 LDGAVTTLGQATSINLDDDGLTAIAKIRHARAMLANGDTNGALSIANE--AMPTAFEASR 184

Query: 165 NEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
            E+LG       ++  AK+ +    +             + L ++ 
Sbjct: 185 QELLGDIYHAKNEIDNAKSAYTNAWEVLRERQENRAVLALKLQSLG 230


>gi|284006776|emb|CBA72039.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 206

 Score = 72.0 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 77/210 (36%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      K           + +++ +   I +  +            ++F Q 
Sbjct: 1   MEVYTTENEQIDAIKRFFVNKGKALLIGLVIGVGAIIGWNYWQSHQANSLQESAQSFEQI 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                +   + A ++ E+  ++ N +Y  L+N+ +A I V K D   A +  LK      
Sbjct: 61  SSQLQTGS-NQALAAAEQFANETNNIYGVLTNIELAKIAVEKNDIAGAEKALLKALTIAK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    ++ A + +  +  ++    L ++ +          +I G   LK G +  
Sbjct: 120 VDD-LKDLLNVRLARVQLALNKPDQALISLTQVQDKG--WSSIVEDIRGDILLKKGDIAS 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  + +  + + +   + T  ++ + ++ 
Sbjct: 177 ARAAYSKGIESSGADM-MKTILKIKINSLP 205


>gi|126208642|ref|YP_001053867.1| hypothetical protein APL_1174 [Actinobacillus pleuropneumoniae L20]
 gi|190150502|ref|YP_001969027.1| hypothetical protein APP7_1233 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303250076|ref|ZP_07336278.1| hypothetical protein APP6_1488 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307246090|ref|ZP_07528172.1| hypothetical protein appser1_12930 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307252815|ref|ZP_07534705.1| hypothetical protein appser6_13280 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307255071|ref|ZP_07536889.1| hypothetical protein appser9_13050 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259508|ref|ZP_07541233.1| hypothetical protein appser11_13050 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307261657|ref|ZP_07543324.1| hypothetical protein appser12_12170 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307263845|ref|ZP_07545450.1| hypothetical protein appser13_12550 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126097434|gb|ABN74262.1| hypothetical protein APL_1174 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|189915633|gb|ACE61885.1| hypothetical protein APP7_1233 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302651139|gb|EFL81293.1| hypothetical protein APP6_1488 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306853025|gb|EFM85248.1| hypothetical protein appser1_12930 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306859714|gb|EFM91737.1| hypothetical protein appser6_13280 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306861944|gb|EFM93920.1| hypothetical protein appser9_13050 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866444|gb|EFM98307.1| hypothetical protein appser11_13050 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306868649|gb|EFN00459.1| hypothetical protein appser12_12170 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306870834|gb|EFN02573.1| hypothetical protein appser13_12550 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 207

 Score = 72.0 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 21/177 (11%), Positives = 60/177 (33%), Gaps = 3/177 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K           + +++  +  + +  +     +        +   +E +  +   +
Sbjct: 15  EEAKNWFKENGTPILVAVIIACAATLGWNFWQNHQVQAAQQTSATYQNVMESYLQDPEKN 74

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
                + I    +  Y   S +  A   V K D   AA+  L+ A    +  +++     
Sbjct: 75  QPLIEKFISENKDSSYAVFSQLESAKQAVEKADFA-AAKTVLQSALTSTSDASLQTIIRF 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           + A++     +Y++    L ++++           + G   +  G    AK ++E+ 
Sbjct: 134 RLATLDYQLKNYDDALATLGQITDQVWEQR--KLVLTGDILVAKGDKASAKGVYEKA 188


>gi|237807664|ref|YP_002892104.1| hypothetical protein Tola_0890 [Tolumonas auensis DSM 9187]
 gi|237499925|gb|ACQ92518.1| conserved hypothetical protein [Tolumonas auensis DSM 9187]
          Length = 216

 Score = 72.0 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/215 (10%), Positives = 67/215 (31%), Gaps = 6/215 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+  N         K             +++       +  ++    ++       + Q 
Sbjct: 1   MDVYNSEEQQVEAIKSWWQENGKSIIAGVVIGFVGLFGWRYYNDYTRQQSESSAAGYQQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++  +           + I +  +            +    K +    A   L+   D  
Sbjct: 61  MQNLSEQHEKAFAEVGQFIAAHKDT--YGDLAALQLAAEAVKANKPELAAEQLRRVADQA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           +    +  A ++ A +L+  +   +  K+L  ++           E+ G + L   +  K
Sbjct: 119 SDEEFKPVAGIRLARVLIAMNKPADALKVLDSVTA--GQYKAAVAEVRGDALLASSQPDK 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           A+  +    + +    G++   QM L ++  + ++
Sbjct: 177 AREAYTAAMQASK--NGVNPVLQMKLDDLSVASEK 209


>gi|255021267|ref|ZP_05293316.1| putative membrane protein [Acidithiobacillus caldus ATCC 51756]
 gi|254969278|gb|EET26791.1| putative membrane protein [Acidithiobacillus caldus ATCC 51756]
          Length = 203

 Score = 72.0 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 26/198 (13%), Positives = 66/198 (33%), Gaps = 4/198 (2%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
                  ++    L+  +++  A+ F+ +      +       +++  +   +N+L  A+
Sbjct: 6   LSDYLYRHRKSLILVFALVVLGAMGFFGYAKYQRHQMAQAAAVYSELTQSMAANQLAAAQ 65

Query: 74  SSFEK-ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQ 132
            S +  +    +  Y  ++  + A + + +     A      +   D  P  +   A   
Sbjct: 66  VSAQTLLQKYPDTPYATMARFFTARMAMMQHHEAQAQAQLEAILKKDHLPTGMAGLARFT 125

Query: 133 AASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
            A + +D    ++       L  P         E+ G +        KA+  + +  +  
Sbjct: 126 LAELQLDQGQAKKALDT---LGAPGTVYAPLYWELRGDAHEYLRAWPKARQDYLKAEQAL 182

Query: 193 NSPFGISTRSQMILANII 210
            +        Q+ LANI 
Sbjct: 183 PATDPYRAYLQLKLANIG 200


>gi|92114973|ref|YP_574901.1| hypothetical protein Csal_2856 [Chromohalobacter salexigens DSM
           3043]
 gi|91798063|gb|ABE60202.1| conserved hypothetical protein [Chromohalobacter salexigens DSM
           3043]
          Length = 218

 Score = 72.0 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 20/207 (9%), Positives = 64/207 (30%), Gaps = 7/207 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSN---- 67
              K     Y       +++  +    +  +      +     + + Q   L   +    
Sbjct: 12  ETLKRWWKEYGKSIIAGVVLAGAGVFAWNAWQDYQTSQAEAASQRYQQLTLLMQQDTLSD 71

Query: 68  -KLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
            + + A +  + ++++            I + L  + +   +A   L+    +     + 
Sbjct: 72  AQREQATNMIDALVNEHGGTLYADFAELIRARLAIQANELESARDTLQAFAANSDDGYLT 131

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
             A L  A + +     +     L+  ++    +   A +I G + +   +  +A+  ++
Sbjct: 132 GLARLNLARVQIAMDDAQGALSTLE--NDVPATLKAQAADIRGDAYVALEQPDQARQAYQ 189

Query: 187 ELAKDNNSPFGISTRSQMILANIIASD 213
           +               ++ L N+   D
Sbjct: 190 DALARAEDQDQPLFGVRLKLDNLGVED 216


>gi|304414050|ref|ZP_07395418.1| hypothetical protein REG_1110 [Candidatus Regiella insecticola
           LSR1]
 gi|304283264|gb|EFL91660.1| hypothetical protein REG_1110 [Candidatus Regiella insecticola
           LSR1]
          Length = 212

 Score = 72.0 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 30/216 (13%), Positives = 75/216 (34%), Gaps = 11/216 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +        I  + +L+I+++ I ++ +  +          ++ Q 
Sbjct: 1   MEIYTTENEQADAVRRFFSENAKILVVSVLLIITVLIGWHYWQNNQNTAMKNAASSYQQV 60

Query: 61  LELFNSNKL-------DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL 113
            E+   NK        D+     E+ + +++  Y     + +A+  V +     A +  +
Sbjct: 61  SEILTDNKKAAVTKSDDNTNDVAEQFVRENDNNYAVFIALELANRFVVQKIFDKAEQQLM 120

Query: 114 KVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
                      +     L+ A + +     ++  K L  +          A ++ G   L
Sbjct: 121 LALTKTK-DTNLLSLTNLRLAKLQLQLKKPDQALKTLNSV--EGEAWVAMAEDVRGDIFL 177

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
             G +  A+  + +  +  N+   + T  ++ L N+
Sbjct: 178 NKGDIPAARAAYTKATE-VNAAQTLQTLLRLKLDNL 212


>gi|107103321|ref|ZP_01367239.1| hypothetical protein PaerPA_01004390 [Pseudomonas aeruginosa PACS2]
          Length = 214

 Score = 72.0 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 58/201 (28%), Gaps = 7/201 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              ++ L++   +  +      +       + Q    AL        
Sbjct: 13  IKDWWQRNGKPLVTGGILALAVVFGWQAWQKYQTNQAQGASIVYQQLIETALNPTGQPDP 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+    +         + +       + A   LK   D  A   +   A
Sbjct: 73  AKVAELAGKLKSEFGGTHYAQYGSLFVAKVAVDSGKLDDAVAELKAVMDKPADATLGELA 132

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L      EE  K+L+   +          E+ G   ++  +  +A+  +E+  
Sbjct: 133 RQRLARVLAAQGKVEEGLKLLEG--DADKAYVSTREELKGDLLVQLKRTDEARAAYEKAK 190

Query: 190 KDNNSPFGISTRSQMILANII 210
           +      G     Q+ L ++ 
Sbjct: 191 QSLPE-DGAGDALQIKLDDLS 210


>gi|167562551|ref|ZP_02355467.1| hypothetical protein BoklE_08314 [Burkholderia oklahomensis EO147]
          Length = 209

 Score = 71.6 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 60/207 (28%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   + + +L+ A  +  ++     +       + Q  +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWIAIAVLAAAAAWNGWNYWQRHQAAQAAVLYEQVQQAVQ 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           SN           +  +             A+  +        A+  L+ A D       
Sbjct: 65  SNDKAKVARVASDMEDKFGGTAYAQMTALEAAKALYGAGDAAGAKAQLQWAADHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     PS+       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPSDAFKGIVADRRGDLLASQGKSDDARAAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDSLSKDDASARQLVQFKLDALGG 209


>gi|254492586|ref|ZP_05105757.1| hypothetical protein MDMS009_2929 [Methylophaga thiooxidans DMS010]
 gi|224462107|gb|EEF78385.1| hypothetical protein MDMS009_2929 [Methylophaga thiooxydans DMS010]
          Length = 212

 Score = 71.6 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 25/212 (11%), Positives = 65/212 (30%), Gaps = 4/212 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYK-WIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ 59
           M+          + K         +   +++  +++    Y  +     +       + Q
Sbjct: 1   MDIYASDEEKAEEIKQWWRDNGRSVIAGIVIGAVAVFGGRYWLNHQQV-QSENASIIYQQ 59

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           +    + N  D A+++ ++++         +      +   AK    +AAE +L    + 
Sbjct: 60  STAYLSQNDADAAQAASQELMQNYASTPYAVFAAMQMAESAAKSGELSAAEDYLYWVIEH 119

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
               + +  ATL+ A +            ++      S        E+ G   L  G   
Sbjct: 120 AELNSHKELATLRLARLKFSQGDNSAALDMVAS--SESTAFRSLFAELEGDIKLAMGDRS 177

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
            A   ++       +        QM + ++ +
Sbjct: 178 AAYAAYQTAVLSLAAGEPRQRLLQMKMDDVAS 209


>gi|49078144|gb|AAT49755.1| PA3801 [synthetic construct]
          Length = 215

 Score = 71.6 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 57/201 (28%), Gaps = 7/201 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              ++ L++   +  +      +       + Q    AL        
Sbjct: 13  IKDWWQRNGKPLVTGGILALAVVFGWQAWQKYQTNQAQGASIVYQQLIETALNPAGQPDP 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+    +         + +       + A   LK   D  A   +   A
Sbjct: 73  AKVAELAGKLKSEFGGTHYAQYGSLFVAKVAVDSGKLDDAVAELKAVMDKPADATLGELA 132

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L      EE  K+L    +          E+ G   ++  +  +A+  +E+  
Sbjct: 133 RQRLARVLAAQGKVEEGLKLLDG--DADKAYVSTREELRGDLLVQLKRTDEARAAYEKAK 190

Query: 190 KDNNSPFGISTRSQMILANII 210
           +      G     Q+ L ++ 
Sbjct: 191 QSLPE-DGAGDALQIKLDDLS 210


>gi|307257230|ref|ZP_07539001.1| hypothetical protein appser10_12290 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306864272|gb|EFM96184.1| hypothetical protein appser10_12290 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 207

 Score = 71.6 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 21/177 (11%), Positives = 60/177 (33%), Gaps = 3/177 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K           + +++  +  + +  +     +        +   +E +  +   +
Sbjct: 15  EEAKNWFKENGTPILVAVIIACAATLGWNFWQNHQVQAAQQTSAIYQNVMESYLQDPEKN 74

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
                + I    +  Y   S +  A   V K D   AA+  L+ A    +  +++     
Sbjct: 75  QPLIEKFISENKDSSYAVFSQLESAKQAVEKADFA-AAKTVLQSALTSTSDASLQTIIRF 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           + A++     +Y++    L ++++           + G   +  G    AK ++E+ 
Sbjct: 134 RLATLDYQLKNYDDALATLGQITDQVWEQR--KLVLTGDILVAKGDKASAKGVYEKA 188


>gi|212212369|ref|YP_002303305.1| hypothetical protein CbuG_0764 [Coxiella burnetii CbuG_Q212]
 gi|212010779|gb|ACJ18160.1| hypothetical protein CbuG_0764 [Coxiella burnetii CbuG_Q212]
          Length = 206

 Score = 71.6 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 26/183 (14%), Positives = 61/183 (33%), Gaps = 2/183 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y     L I++ L +   +  +     +K       + Q   L + N  D 
Sbjct: 12  EMIKKWWRDYGRAIALAIVIGLLIGFGWRYWHRHQLEKTERASALYMQLQILASQNAWDK 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            +   ++++    K        ++ +    + +    A   L+    +     ++    L
Sbjct: 72  TKPLTDRLIKDYGKTPYAAMASFLNAKRAVEQNHLPLALDQLQWVMKNAIVSDLKQLERL 131

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           +A+ IL+  +  +    +LQ + +         +EI G      G  + AK  +E   + 
Sbjct: 132 RASRILLAENRPKAALNLLQTVDDQ--AYQPLVDEIKGDIYAAMGNRESAKQFYETAQQS 189

Query: 192 NNS 194
             +
Sbjct: 190 MKA 192


>gi|225024246|ref|ZP_03713438.1| hypothetical protein EIKCOROL_01118 [Eikenella corrodens ATCC
           23834]
 gi|224943271|gb|EEG24480.1| hypothetical protein EIKCOROL_01118 [Eikenella corrodens ATCC
           23834]
          Length = 209

 Score = 71.6 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 24/199 (12%), Positives = 53/199 (26%), Gaps = 2/199 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     +      L+++       + ++        N     F Q  E   +NK  +
Sbjct: 13  ENFKYFWRSWGRWLFALLVVAAIGYFGWVMYSSHQRSVNNEAVAVFDQWAENQQANKPAE 72

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A     ++ SQ     +      + +         + A   L           +R  A  
Sbjct: 73  AAKLLTQLQSQYPTSISAAQATLMQAGAAFDQGKYDEAIGHLNWVLKYHQEPLIRAMAIQ 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A++ +    Y++    L               E  G      GK  +A   +++    
Sbjct: 133 RLATVQLQQQKYDDAIATLGM--NTDEAYAGILLETKGDVYAAQGKRSEAAAAYKQAMDK 190

Query: 192 NNSPFGISTRSQMILANII 210
                      Q+ +  + 
Sbjct: 191 LPQDDQGREFIQLKIDQMN 209


>gi|254228664|ref|ZP_04922088.1| TPR repeat containing protein [Vibrio sp. Ex25]
 gi|262395116|ref|YP_003286970.1| hypothetical protein VEA_004347 [Vibrio sp. Ex25]
 gi|151938843|gb|EDN57677.1| TPR repeat containing protein [Vibrio sp. Ex25]
 gi|262338710|gb|ACY52505.1| putative membrane protein [Vibrio sp. Ex25]
          Length = 204

 Score = 71.6 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 30/202 (14%), Positives = 66/202 (32%), Gaps = 3/202 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K           +  ++ L     +  +  S  +      +++  A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQDSVIQASEAASQSYTTA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +        D        I S + K Y+ L+ + +A   V   D   A E  LK A  + 
Sbjct: 61  MNALQDKGTDAQADVKAFIESNEVKEYSVLAALQLAKAQVEAQDLSAALE-QLKWAQSNT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    + + A I  +  +++  +  L  ++           E+ G  A++ G    
Sbjct: 120 QDAALLPLISYRIARIETEMGNFDAATAELSNVT--DAAWTGRIAELRGDIAIRQGDKDA 177

Query: 181 AKTIFEELAKDNNSPFGISTRS 202
           A   + E  +  ++   +  + 
Sbjct: 178 AYAAYTEAQQAADASPTLQMKL 199


>gi|121998566|ref|YP_001003353.1| hypothetical protein Hhal_1787 [Halorhodospira halophila SL1]
 gi|121589971|gb|ABM62551.1| conserved hypothetical protein [Halorhodospira halophila SL1]
          Length = 208

 Score = 71.6 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 29/213 (13%), Positives = 70/213 (32%), Gaps = 5/213 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME ++D      + K           L +   L +   ++ +    E+        +A+ 
Sbjct: 1   MERSDDEQL--QQLKDWWQRNGGSILLGLTGALLILAGWWGYGTWQERGAQQAAAAYAEF 58

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L+   S + + A  + +++L    +           + + A+      A   L    D+ 
Sbjct: 59  LQATQSGEPEAAEQAGQRVLDDHARSGYAGMTALRMARIQAEAGEYRRAAETLGWLIDNA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+   A L+ A +L +    EE   +L+             +E+ G    + G+  +
Sbjct: 119 DHSAMVELARLRQARVLGEE-DPEEALAVLEGSVSAG--FTASFDELRGDLLRELGRYDE 175

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           A   +++               ++ L  + +  
Sbjct: 176 AAEAYQQALDQEGLGAQSRELVRLKLQAVESEA 208


>gi|167569734|ref|ZP_02362608.1| hypothetical protein BoklC_07828 [Burkholderia oklahomensis C6786]
          Length = 209

 Score = 71.6 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 60/207 (28%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   + + +L+ A  +  ++     +       + Q  +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWIAIAVLAAAAAWNGWNYWQRHQAAQAAVLYEQVQQAVQ 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           SN           +  +             A+  +        A+  L+ A D       
Sbjct: 65  SNDKAKVARVASDMEDKFGGTAYAQMTALEAAKALYGAGDAAGAKAQLQWAADHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     PS+       +  G      GK   A+  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPSDAFKGIVADRRGDLLAAQGKSDDARAAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +      +          Q  L  +  
Sbjct: 183 KLALDSLSKDDASARQLVQFKLDALGG 209


>gi|325919428|ref|ZP_08181454.1| hypothetical protein XGA_0393 [Xanthomonas gardneri ATCC 19865]
 gi|325550094|gb|EGD20922.1| hypothetical protein XGA_0393 [Xanthomonas gardneri ATCC 19865]
          Length = 212

 Score = 71.6 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 26/211 (12%), Positives = 69/211 (32%), Gaps = 10/211 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ++   D +    + +             +++ L+L + +  +      +       +   
Sbjct: 3   IDDLLDEHEQGERVRSWLRKNGAGLVGGVVVGLALILGWQWWQKHTNTQSVEANTRYEAV 62

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++      LD A      +      +Y  L+ + +A   V  G    A     K   D  
Sbjct: 63  VKSIQGKGLDKAAKEIVALDDGKGGIYAELAALRLAKAQVDAGKHAEAI----KTLRDVP 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   ++     + A +L ++   +E  K+L    + ++       EI   + +  GK  +
Sbjct: 119 AEGELKQIVQQRLARVLTESGKPDEAIKLLADAQDHTS------LEIRADALVVQGKPDE 172

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+ ++ +     +         +  L ++  
Sbjct: 173 ARALYGKALTTVDVASPQRRLLETKLMDVGG 203


>gi|15598996|ref|NP_252490.1| hypothetical protein PA3801 [Pseudomonas aeruginosa PAO1]
 gi|218889915|ref|YP_002438779.1| hypothetical protein PLES_11731 [Pseudomonas aeruginosa LESB58]
 gi|254236705|ref|ZP_04930028.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254242492|ref|ZP_04935814.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|9949974|gb|AAG07188.1|AE004798_11 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126168636|gb|EAZ54147.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126195870|gb|EAZ59933.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218770138|emb|CAW25900.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
          Length = 214

 Score = 71.2 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 57/201 (28%), Gaps = 7/201 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              ++ L++   +  +      +       + Q    AL        
Sbjct: 13  IKDWWQRNGKPLVTGGILALAVVFGWQAWQKYQTNQAQGASIVYQQLIETALNPAGQPDP 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+    +         + +       + A   LK   D  A   +   A
Sbjct: 73  AKVAELAGKLKSEFGGTHYAQYGSLFVAKVAVDSGKLDDAVAELKAVMDKPADATLGELA 132

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L      EE  K+L    +          E+ G   ++  +  +A+  +E+  
Sbjct: 133 RQRLARVLAAQGKVEEGLKLLDG--DADKAYVSTREELRGDLLVQLKRTDEARAAYEKAK 190

Query: 190 KDNNSPFGISTRSQMILANII 210
           +      G     Q+ L ++ 
Sbjct: 191 QSLPE-DGAGDALQIKLDDLS 210


>gi|296387684|ref|ZP_06877159.1| hypothetical protein PaerPAb_05997 [Pseudomonas aeruginosa PAb1]
          Length = 214

 Score = 71.2 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 58/201 (28%), Gaps = 7/201 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              ++ L++   +  +      +       + Q    AL        
Sbjct: 13  IKDWWQRNGKPLVTGGILALAVVFGWQAWQKYQTNQAQGASIVYQQLIETALNPAGQPDP 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+    +         + +       + A   LK   D  A   +   A
Sbjct: 73  AKVAELAGKLKSEFGGTHYAQYGSLFVAKVAVDSGKLDDAVAELKAVMDKPADATLGELA 132

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L      EE  K+L+   +          E+ G   ++  +  +A+  +E+  
Sbjct: 133 RQRLARVLAAQGKVEEGLKLLEG--DADKAYVSTREELKGDLLVQLKRTDEARAAYEKAK 190

Query: 190 KDNNSPFGISTRSQMILANII 210
           +      G     Q+ L ++ 
Sbjct: 191 QSLPE-DGAGDALQIKLDDLS 210


>gi|296113388|ref|YP_003627326.1| uncharacterized protein family (UPF0070) family protein [Moraxella
           catarrhalis RH4]
 gi|295921082|gb|ADG61433.1| uncharacterized protein family (UPF0070) family protein [Moraxella
           catarrhalis RH4]
          Length = 277

 Score = 71.2 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/226 (10%), Positives = 61/226 (26%), Gaps = 22/226 (9%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----- 59
           ND N    K       +       +L++L++   +  +  ++ K   +  + +       
Sbjct: 7   NDNNFTDQKSLNALKLHGEKIIYAVLLVLAVFFGWQYYQKNYAKIDTVAADAYTSISVRD 66

Query: 60  ---------------ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
                          A +     +          + +  N +Y   + M  A       D
Sbjct: 67  ERLVQAYLNPQLDEVAKQALAEEEKQLFGDIDALVAAHGNTVYAWQALMIKARHQTNNND 126

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFA 164
              A     +  + +L    +   A ++ A  ++          I  +            
Sbjct: 127 LDGAVATLSQATSINLDDDGLTAIAKIRHARAMLANGDTNGALSIANE--AMPTAFEASR 184

Query: 165 NEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
            E+LG       ++  AK+ +    +             + L ++ 
Sbjct: 185 QELLGDIYHAKNEIDNAKSAYTNAWEVLRERQENRAVLALKLQSLG 230


>gi|254511213|ref|ZP_05123280.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221534924|gb|EEE37912.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 223

 Score = 71.2 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 64/177 (36%), Gaps = 4/177 (2%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
           +          +   +G+    AL    S      R +  + +   +   + + NM +++
Sbjct: 44  FNEYRKARDTSQAEALGDAILSAL----SENGATERVASLQAVEPQSVGGDAVLNMLLSA 99

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
             +  G  ++A      +A     P   R  A+ +A  +  DT    +  +  + L+ P 
Sbjct: 100 SQIEAGSEQDAVNSLNAIATQGDLPEIYRAIASFKALLLQTDTMPVADRRQQFEALAIPG 159

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
            P+   A E L +  +  G  Q A    + L +D  +   +  R+  ++  +    Q
Sbjct: 160 APLRLLAEEQLALIDVAEGNTQAALDRLQALRQDAEASVDLQQRAAQLIVALGGEPQ 216


>gi|326559871|gb|EGE10271.1| hypothetical protein E9G_07545 [Moraxella catarrhalis 7169]
 gi|326560780|gb|EGE11147.1| hypothetical protein E9K_09114 [Moraxella catarrhalis 103P14B1]
 gi|326569643|gb|EGE19695.1| hypothetical protein E9Q_01818 [Moraxella catarrhalis BC1]
 gi|326570862|gb|EGE20886.1| hypothetical protein E9S_03977 [Moraxella catarrhalis BC7]
 gi|326574412|gb|EGE24354.1| hypothetical protein E9Y_05582 [Moraxella catarrhalis 101P30B1]
 gi|326576407|gb|EGE26316.1| hypothetical protein EA1_05607 [Moraxella catarrhalis O35E]
          Length = 277

 Score = 71.2 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/226 (10%), Positives = 61/226 (26%), Gaps = 22/226 (9%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----- 59
           ND N    K       +       +L++L++   +  +  ++ K   +  + +       
Sbjct: 7   NDNNFTDQKSLNALKLHGEKIIYAVLLVLAVFFGWQYYQKNYAKIDTVAADTYTSISVRD 66

Query: 60  ---------------ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
                          A +     +          + +  N +Y   + M  A       D
Sbjct: 67  ERLVQAYLNPQLDEVAKQALAEEEKQLFGDIDALVAAHGNTVYAWQALMIKARHQTNNND 126

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFA 164
              A     +  + +L    +   A ++ A  ++          I  +            
Sbjct: 127 LDGAVATLSQATSINLDDDGLTAIAKIRHARAMLANGDTNGALSIANE--AMPTAFEASR 184

Query: 165 NEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
            E+LG       ++  AK+ +    +             + L ++ 
Sbjct: 185 QELLGDIYHAKNEIDNAKSAYTNAWEVLRERQENRAVLALKLQSLG 230


>gi|229523417|ref|ZP_04412824.1| membrane protein [Vibrio cholerae TM 11079-80]
 gi|229339780|gb|EEO04795.1| membrane protein [Vibrio cholerae TM 11079-80]
          Length = 204

 Score = 71.2 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/209 (14%), Positives = 70/209 (33%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S   ++    +++++A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVAEQEAASQSYSKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +  ++   +    I +     Y  L+ M +A   V  G    A    L+ A    
Sbjct: 61  MDALQAKGIESEGTIQTFIDANKETEYAVLAAMQLAKAQVEAGQLDEAL-AQLEWAKGAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A++   T + A +  +   +++    L  + E S        E+ G   ++ G    
Sbjct: 120 KDAALKPLLTFRVARLQAEQGQFDDALTQLTSIQEKSWAGRV--AELRGDILMRKGDSAA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  +  +    +    QM L ++
Sbjct: 178 AYAAYTEAQQAEDVSQTL----QMKLDDL 202


>gi|153800622|ref|ZP_01955208.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|124123911|gb|EAY42654.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
          Length = 204

 Score = 71.2 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/209 (14%), Positives = 70/209 (33%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S    +    +++++A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVSAQEAASQSYSKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +  ++   +    I +     Y  L+ M +A   V  G    A    L+ A    
Sbjct: 61  MDALQAKGIESEGTIQTFIDANKETEYAVLAAMQLAKAQVEAGQLDEAL-AQLEWAKGAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A++   T + A +  +   +++    L  + E S        E+ G   ++ G    
Sbjct: 120 KDAALKPLLTFRVARLQAEQGQFDDALTQLTSIQEKSWAGRV--AELRGDILMRKGDSAA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  +  ++   +    QM L ++
Sbjct: 178 AYAAYTEAQQAEDASQTL----QMKLDDL 202


>gi|315634911|ref|ZP_07890193.1| conserved hypothetical protein [Aggregatibacter segnis ATCC 33393]
 gi|315476463|gb|EFU67213.1| conserved hypothetical protein [Aggregatibacter segnis ATCC 33393]
          Length = 204

 Score = 71.2 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/193 (15%), Positives = 68/193 (35%), Gaps = 6/193 (3%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            +  YK+I    ++    +  W   +     +K +     + Q L  +  +         
Sbjct: 18  WQENYKFIIVCFVIAFGGVFGWN-YWQSHQLQKIHNASAEYEQVLFNYAKDPKAQEEQFS 76

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
           + I + +   Y  L+ +  A I V   D   A +   +          +   + L+ A++
Sbjct: 77  QFIKNNEKTGYAVLALLDKAKIAVENQDFAQAEDALKQAVAQ-STDDVLSSVSALRLAAV 135

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
                 ++   + L+ + E     +   N ++G   L  G    AK+ +++  +  N+  
Sbjct: 136 QFQLGQFDPALESLKLVKEQ--AWNGAKNMLVGDIQLAKGDKDAAKSAYQQAQQ--NATP 191

Query: 197 GISTRSQMILANI 209
                 Q+ L N+
Sbjct: 192 LEQQLIQVRLNNL 204


>gi|146283359|ref|YP_001173512.1| hypothetical protein PST_3029 [Pseudomonas stutzeri A1501]
 gi|145571564|gb|ABP80670.1| conserved hypothetical protein [Pseudomonas stutzeri A1501]
          Length = 213

 Score = 70.8 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/199 (12%), Positives = 55/199 (27%), Gaps = 6/199 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ---ALELFNSNKLD 70
            K           L  ++ L L   +  +      +       + Q   A          
Sbjct: 13  IKDWWQRNGKPLVLGAVIALVLVFGWQFWQKHQINQAQSASVVYQQLLGAALESGEADAA 72

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT 130
           +       +       +         + +  +    + A   L+   D  A   +   A 
Sbjct: 73  EVSRLGNLLKKDFAGTHYAQYGSLFVAKVAVESGRLDEAASELRAIVDKPADKTLDELAR 132

Query: 131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
            + A +L      +E  K+L    +          E+ G   ++ G+  +A   + +  +
Sbjct: 133 QRLARVLAAQDKADEAIKLLDG--KVDAAFVASREELRGDLLVQLGRNDEAHAAYSKAKE 190

Query: 191 DNNSPFGISTRSQMILANI 209
             +    I    QM L ++
Sbjct: 191 SLSQDAAIGG-LQMKLDDL 208


>gi|260427043|ref|ZP_05781022.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260421535|gb|EEX14786.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 218

 Score = 70.8 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 40/206 (19%), Positives = 76/206 (36%), Gaps = 4/206 (1%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + +       + W+A LL+L+++  A W        +     +G+    AL+   +   
Sbjct: 16  RRDRLFAFMKRWGWVAVLLVLVLVGGAAWREYTSVRDQAAAQALGDEILAALDADEAGAR 75

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             A S               L +M  AS     GD   A +    VA++   P   R  A
Sbjct: 76  VSALSEISA----AGPGAQALIDMLTASEAARAGDADAAEQALEAVASNGDVPEIYREIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           + +A S      S E+    L+ L+ P  P+   A E L +  ++ G    A    + + 
Sbjct: 132 SYKAFSRSDSGLSAEDRRVGLEALAVPGKPLRLLAEEQLALLEIEQGDTDAATARLQRII 191

Query: 190 KDNNSPFGISTRSQMILANIIASDQR 215
           +D+ +  G+  R+  ++  +      
Sbjct: 192 EDSEATAGLRQRASQLIVAMGGKPDA 217


>gi|118594980|ref|ZP_01552327.1| hypothetical protein MB2181_04890 [Methylophilales bacterium
           HTCC2181]
 gi|118440758|gb|EAV47385.1| hypothetical protein MB2181_04890 [Methylophilales bacterium
           HTCC2181]
          Length = 208

 Score = 70.8 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 72/210 (34%), Gaps = 3/210 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +    +   K     YK IA ++I + L L I          K   +  + + + 
Sbjct: 1   MALDMEEQDQEENLKNLWSKYKNIAFIVIGIFLCLYIAATFISNKKNKANELASQLYQEV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L     N       +        N  Y   +++++  +    GD   +    L  A ++ 
Sbjct: 61  LMEKIDNLDQIKVKTDLVKKDHTNTPYAGRASLHLGQLYAKTGDYDKSIP-ELSWAGENA 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
             L+++  A    A + +      +     + ++ P        +++LG  AL  G  + 
Sbjct: 120 TELSIQSLAHYALAYMYIAKKDTSKAKLAAEAIATPG--YIGLKSDLLGDIALMDGDHEA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A++ F +      +   ++   Q  L  I 
Sbjct: 178 ARSFFNQALDFYKNKSELAQVIQTKLDAIG 207


>gi|226946065|ref|YP_002801138.1| YfgM-like protein [Azotobacter vinelandii DJ]
 gi|226720992|gb|ACO80163.1| YfgM-like protein [Azotobacter vinelandii DJ]
          Length = 214

 Score = 70.8 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/201 (12%), Positives = 63/201 (31%), Gaps = 7/201 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M S+ +        K              ++ L+L + +  +      + +     + Q 
Sbjct: 1   MTSHTENEELAQ-IKDWWKRSGRPLLSGGVLALALVLAWQGWQKYQTGRAHGASALYQQL 59

Query: 61  LEL----FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           L+                 + ++ S     +       + + +  +    + A   L+  
Sbjct: 60  LDASLRPSGKPDTARIAELYGQLQSDFGGTHYAQYGSLLVTKVAVEEGRLDEAAAALRAI 119

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
            D  A   +   A  + A +L      EE   +L   ++P         E+ G   ++ G
Sbjct: 120 LDKPADATLGEVARQRLARVLAAQDKAEEGLALLAGEADP--AFQAAREEVRGDLLVRLG 177

Query: 177 KVQKAKTIFEELAKDNNSPFG 197
           ++ +A+  +E+      +  G
Sbjct: 178 RLDEARAAYEKARSAQPADAG 198


>gi|116051826|ref|YP_789331.1| hypothetical protein PA14_14900 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115587047|gb|ABJ13062.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 214

 Score = 70.8 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 57/201 (28%), Gaps = 7/201 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              ++ L++   +  +      +       + Q    AL        
Sbjct: 13  IKDWWQRNGKPLVTGGILALAVVFGWQAWQKYQTNQAQGASIVYQQLIETALNPAGQPDP 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+    +         + +       + A   LK   D  A   +   A
Sbjct: 73  AKVAELAGKLKSEFGGTHYAQYGSLFVAKVAVDSGKLDDAVAELKAVMDKPADATLGELA 132

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L      EE  K+L    +          E+ G   ++  +  +A+  +E+  
Sbjct: 133 RQRLARVLAAQGKVEEGLKLLDG--DADKAYVSTREELKGDLLVQLKRTDEARAAYEKAK 190

Query: 190 KDNNSPFGISTRSQMILANII 210
           +      G     Q+ L ++ 
Sbjct: 191 QSLPE-DGAGDALQIKLDDLS 210


>gi|322515409|ref|ZP_08068401.1| hypothetical protein HMPREF0027_2153 [Actinobacillus ureae ATCC
           25976]
 gi|322118564|gb|EFX90796.1| hypothetical protein HMPREF0027_2153 [Actinobacillus ureae ATCC
           25976]
          Length = 206

 Score = 70.8 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/198 (11%), Positives = 61/198 (30%), Gaps = 5/198 (2%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K           + I++  +    +  +     +        +   +E +  +   +
Sbjct: 14  EEVKGWFKENGTPILVAIIIACAATFGWNFWKNHQIETAQQTSATYQNIMESYLQDPSKN 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A    + I    +  Y   + +  A   V K D     +  L+ A    +   ++     
Sbjct: 74  APLVEKFIADHKDSSYAVFAQLEEAKQAVEKADFA-RVKSVLENALAVASDSILQTVIRF 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A++      Y++   +L ++ +      +      G      G    AK+ +E+    
Sbjct: 133 RLAAVDYQLKHYDQALTMLAQIQDQVWEQRKLVLS--GDILAAKGDKDAAKSAYEKAKDI 190

Query: 192 NNSPFGISTRSQMILANI 209
             +P        + L N+
Sbjct: 191 --APAQDKALIDVRLNNL 206


>gi|332284652|ref|YP_004416563.1| hypothetical protein PT7_1399 [Pusillimonas sp. T7-7]
 gi|330428605|gb|AEC19939.1| hypothetical protein PT7_1399 [Pusillimonas sp. T7-7]
          Length = 211

 Score = 70.8 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/215 (11%), Positives = 77/215 (35%), Gaps = 7/215 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ- 59
           M  + +        +     Y  +  +L  ++++  + +  +        +     +   
Sbjct: 1   MAYDLEEQEKLDALRAWWERYGTLLVVLSFVVVAGLVGWRGWQWYQGHTASQAMGYYEAL 60

Query: 60  --ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
             A      + L   +++ + +    +K       + IA+ ++ + +  + A   L+   
Sbjct: 61  EGAARQQGDDSLARVKAASKTLRDDFSKSGYTPRGVLIAAQVLQERNDLDGAREQLEWLV 120

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
           ++    ++   A L+ A +L++   Y++      +++           +  G   L  GK
Sbjct: 121 NNSPDPSLIPLAKLRLAGVLLEQKQYDQALA---QIANAPPAFAGLYADRQGDILLAQGK 177

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
             +AK  +E   K+  S   ++   Q+ +  +  +
Sbjct: 178 TAEAKAAWETALKEFGSDP-VTQIVQLKIDALGGA 211


>gi|313109219|ref|ZP_07795187.1| hypothetical protein PA39016_001710028 [Pseudomonas aeruginosa
           39016]
 gi|310881689|gb|EFQ40283.1| hypothetical protein PA39016_001710028 [Pseudomonas aeruginosa
           39016]
          Length = 214

 Score = 70.8 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 57/201 (28%), Gaps = 7/201 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              ++ L++   +  +      +       + Q    AL        
Sbjct: 13  IKDWWQRNGKPLVTGGILALAVVFGWQAWQKYQTNQAQGASIVYQQLIETALNPAGQPDP 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+    +         + +       + A   LK   D  A   +   A
Sbjct: 73  AKVAELAGKLKSEFGGTHYAQYGSLFVAKVAVDSGKLDDAVAELKAVMDKPADATLGELA 132

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L      EE  K+L    +          E+ G   ++  +  +A+  +E+  
Sbjct: 133 RQRLARVLAAQGKVEEGLKLLDG--DADKAYLSTREELKGDLLVQLKRTDEARAAYEKAK 190

Query: 190 KDNNSPFGISTRSQMILANII 210
           +      G     Q+ L ++ 
Sbjct: 191 QSLPE-DGAGDALQIKLDDLS 210


>gi|326559232|gb|EGE09663.1| hypothetical protein E9M_09369 [Moraxella catarrhalis 46P47B1]
          Length = 277

 Score = 70.8 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/226 (10%), Positives = 61/226 (26%), Gaps = 22/226 (9%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----- 59
           ND N    K       +       +L++L++   +  +  ++ K   +  + +       
Sbjct: 7   NDNNFTDQKSFNALKLHGEKIIYAVLLVLAVFFGWQYYQKNYAKIDTVAADAYTSISVRD 66

Query: 60  ---------------ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
                          A +     +          + +  N +Y   + M  A       D
Sbjct: 67  ERLVQAYLNPQLDEVAKQALAEEEKQLFGDIDALVAAHGNTVYAWQALMIKARHQTNNND 126

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFA 164
              A     +  + +L    +   A ++ A  ++          I  +            
Sbjct: 127 LDGAVATLSQATSINLDDDGLTAIAKIRHARAMLANGDTNGALSIANE--AMPTAFEASR 184

Query: 165 NEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
            E+LG       ++  AK+ +    +             + L ++ 
Sbjct: 185 QELLGDIYHAKNEIDNAKSAYTNAWEVLRERQENRAVLALKLQSLG 230


>gi|326563521|gb|EGE13780.1| hypothetical protein E9O_08152 [Moraxella catarrhalis 12P80B1]
          Length = 277

 Score = 70.8 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/226 (11%), Positives = 62/226 (27%), Gaps = 22/226 (9%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----- 59
           ND N    K       +       +L++L++   +  +  ++ K   +  + +       
Sbjct: 7   NDNNFTDQKSLNALKLHGEKIIYAVLLVLAVFFGWQYYQKNYAKIDTVAADAYTSISVRD 66

Query: 60  ---------------ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
                          A +     +          + + DN +Y   + M  A       D
Sbjct: 67  ERLAQAYLNPQLDEVAKQALAEEEKQLFGDIDALVAANDNTVYAWQALMIKARHQTNNND 126

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFA 164
              A     +  + +L    +   A ++ A  ++          I  +            
Sbjct: 127 LDGAVATLSQATSINLDDDGLTAIAKIRHARAMLANGDTNGALSIANE--AMPTAFEASR 184

Query: 165 NEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
            E+LG       ++  AK+ +    +             + L ++ 
Sbjct: 185 QELLGDIYHAKNEIDNAKSAYTNAWEALRERQENRAVLALKLQSLG 230


>gi|237654045|ref|YP_002890359.1| hypothetical protein Tmz1t_3388 [Thauera sp. MZ1T]
 gi|237625292|gb|ACR01982.1| conserved hypothetical protein [Thauera sp. MZ1T]
          Length = 214

 Score = 70.4 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/204 (14%), Positives = 71/204 (34%), Gaps = 6/204 (2%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     Y      L ++    ++ +  ++    +     G  +    +    N+   
Sbjct: 13  SELKAWWAQYGNFVVTLAVVAALASVGWQAWNWYQSRNAGEAGALYYAVQQAVEKNEPQK 72

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           AR +  +++S+            +++ +  +      A   L+ A D  +  A+R  A L
Sbjct: 73  AREAAGRLVSEHGGSVGAQLGALLSAAMQFESGDLANARAQLEWAADKGSDPALRELARL 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKV----QKAKTIFEE 187
           + A++L+     +     LQ    PS       +++ G      GKV       +   + 
Sbjct: 133 RLAAVLLQAGELDAALARLQS--APSAAYKARFDDLRGDVLAAQGKVAEARAAYQAAIDA 190

Query: 188 LAKDNNSPFGISTRSQMILANIIA 211
           LA   +    +    ++ L ++ A
Sbjct: 191 LAAVGDDAVTLREVVRVKLESLGA 214


>gi|152985142|ref|YP_001346697.1| hypothetical protein PSPA7_1313 [Pseudomonas aeruginosa PA7]
 gi|150960300|gb|ABR82325.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 214

 Score = 70.4 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 58/201 (28%), Gaps = 7/201 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              ++ L++   +  +      +       + Q    AL        
Sbjct: 13  IKDWWQRNGKPLVTGGILALAVVFGWQAWQKYQTNQAQGASIVYQQLIETALNPAGQPDT 72

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+    +         + +       + A   LK   D  A   +   A
Sbjct: 73  AKVAELAGKLKSEFGGTHYAQYGSLFVAKVAVDSGKLDDAVAELKAVMDKPADATLGELA 132

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L      EE  K+L+   +          E+ G   ++  +  +A+  +E+  
Sbjct: 133 RQRLARVLAAQGKVEEGLKLLEG--DADKAYVSTREELKGDLLVQLKRTDEARAAYEKAK 190

Query: 190 KDNNSPFGISTRSQMILANII 210
           +      G     Q+ L ++ 
Sbjct: 191 QSLPE-DGAGDALQIKLDDLS 210


>gi|167836397|ref|ZP_02463280.1| hypothetical protein Bpse38_07896 [Burkholderia thailandensis
           MSMB43]
          Length = 209

 Score = 70.4 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 61/207 (29%), Gaps = 3/207 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   + + +L+ A  +  ++    ++ +     + Q  +   
Sbjct: 5   DEQESIENLKAWWARWGDLTTWIAIAVLAAAAAWNGWNYWQRRQASQAAVLYEQVQQAVQ 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           SN           +  +             A+  +        A+  L+ A D       
Sbjct: 65  SNDKAKVSRVASDMEDKFGGTAYAQMTALEAAKALYGAGDAAGAKAQLQWAADHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     PS+       +  G      GK   AK  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPSDAFKGAVADRRGDLLAAQGKSDDAKAAY 182

Query: 186 EELAKD-NNSPFGISTRSQMILANIIA 211
           +                 Q  L  +  
Sbjct: 183 KLALDALPKDDASARQLVQFKLDALGG 209


>gi|21231433|ref|NP_637350.1| hypothetical protein XCC1985 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768513|ref|YP_243275.1| hypothetical protein XC_2199 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991679|ref|YP_001903689.1| hypothetical protein xccb100_2285 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21113103|gb|AAM41274.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573845|gb|AAY49255.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167733439|emb|CAP51640.1| Putative membrane protein [Xanthomonas campestris pv. campestris]
          Length = 212

 Score = 70.4 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 59/174 (33%), Gaps = 10/174 (5%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +   +          +   ++      LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQKRNTTASVEANARYEAVVKSIQGKDLDKAAKDIVALDDGKGGVYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            +  G T  A     K   D  A   ++     + A +L D+   +E  K+L    + ++
Sbjct: 101 QMDAGKTAEAI----KTLRDVPAEGELKQIVQQRLARVLTDSGKPDEAIKLLADAQDHTS 156

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
                  EI   + +K GK  +A+ ++ +     +         +  L ++  +
Sbjct: 157 ------LEIRADALVKQGKRDEARALYTKALATVDVASPQRRLLETKLMDVGGT 204


>gi|94501123|ref|ZP_01307646.1| hypothetical protein RED65_06037 [Oceanobacter sp. RED65]
 gi|94426699|gb|EAT11684.1| hypothetical protein RED65_06037 [Oceanobacter sp. RED65]
          Length = 213

 Score = 70.4 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/201 (11%), Positives = 59/201 (29%), Gaps = 5/201 (2%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF---NSNK 68
              K             ++++      +  +    +         + Q LEL        
Sbjct: 12  EAIKNWWKENGMQTIAAVVIVAGGWFGYQGWQSQKQDAGEGASAVYQQVLELSGSEQEQD 71

Query: 69  LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA 128
           L       +++ +  +            +           A   L+ A  +     + + 
Sbjct: 72  LAQRGLLLDQLKTDFSSTVYASYAALFKAKDAVNAGNLEEAVTELEFAKQNATTEELSHL 131

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           AT++ A + +   +Y+E   +L    E          E+ G +    G+V  A+  + + 
Sbjct: 132 ATIRLARVKIAQQAYDEALSLLA--VETMGAFEGQYLEVKGDALKAKGEVDAARDAYSQA 189

Query: 189 AKDNNSPFGISTRSQMILANI 209
              N      +   +M L ++
Sbjct: 190 VAANQRDGANNPIVEMKLDDL 210


>gi|300724172|ref|YP_003713489.1| hypothetical protein XNC1_3319 [Xenorhabdus nematophila ATCC 19061]
 gi|297630706|emb|CBJ91371.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC 19061]
          Length = 206

 Score = 70.4 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/210 (11%), Positives = 71/210 (33%), Gaps = 5/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K           + +++ +   I ++ +      + +     F   
Sbjct: 1   MELYTTETEQVDAIKRFFANNGKYLAVGLVLGIGALIGWHYWQTHQTNQLHETAATFEVL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +   S    ++ ++ +K   + N +Y  ++ + +    V K D   A +  L +A+   
Sbjct: 61  NKSLASGSK-ESIAAVDKFADETNNIYGVMAELELTKRAVEKNDLAQAEKNLL-IASVKA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  + L+ A + +     +   K L+++            ++ G    K G +  
Sbjct: 119 KDEDMKAVSNLRLARVQLAEDKTDAALKTLKQVKGKG--WLVLTEDLRGDILAKKGDIAG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           A+  +    +  + P  +    ++   N+ 
Sbjct: 177 ARAAYSRGLES-DGPQKMKDFIKIKFNNLS 205


>gi|153828295|ref|ZP_01980962.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|229513100|ref|ZP_04402566.1| membrane protein [Vibrio cholerae TMA 21]
 gi|229525407|ref|ZP_04414812.1| membrane protein [Vibrio cholerae bv. albensis VL426]
 gi|229530109|ref|ZP_04419499.1| membrane protein [Vibrio cholerae 12129(1)]
 gi|254285479|ref|ZP_04960443.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|297581160|ref|ZP_06943084.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|148876249|gb|EDL74384.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|150424341|gb|EDN16278.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|229333883|gb|EEN99369.1| membrane protein [Vibrio cholerae 12129(1)]
 gi|229338988|gb|EEO04005.1| membrane protein [Vibrio cholerae bv. albensis VL426]
 gi|229349993|gb|EEO14947.1| membrane protein [Vibrio cholerae TMA 21]
 gi|297534476|gb|EFH73313.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|327483545|gb|AEA77952.1| Mlr7403 protein [Vibrio cholerae LMA3894-4]
          Length = 204

 Score = 70.4 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/209 (14%), Positives = 70/209 (33%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S    +    +++++A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVAAQEAASQSYSKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +  ++   +    I +     Y  L+ M +A   V  G    A    L+ A    
Sbjct: 61  MDALQAKGIESEGTIQTFIDANKETEYAVLAAMQLAKAQVEAGQLDEAL-AQLEWAKGAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A++   T + A +  +   +++    L  + E S        E+ G   ++ G    
Sbjct: 120 KDAALKPLLTFRVARLQAEQGQFDDALTQLTSIQEKSWAGRV--AELRGDILMRKGDSAA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  +  ++   +    QM L ++
Sbjct: 178 AYAAYTEAQQAEDASQTL----QMKLDDL 202


>gi|15640780|ref|NP_230410.1| hypothetical protein VC0761 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121591435|ref|ZP_01678713.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121726003|ref|ZP_01679302.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147674532|ref|YP_001216246.1| hypothetical protein VC0395_A0290 [Vibrio cholerae O395]
 gi|153817250|ref|ZP_01969917.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153824570|ref|ZP_01977237.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|227080940|ref|YP_002809491.1| hypothetical protein VCM66_0719 [Vibrio cholerae M66-2]
 gi|229505625|ref|ZP_04395135.1| membrane protein [Vibrio cholerae BX 330286]
 gi|229510703|ref|ZP_04400182.1| membrane protein [Vibrio cholerae B33]
 gi|229517825|ref|ZP_04407269.1| membrane protein [Vibrio cholerae RC9]
 gi|229608643|ref|YP_002879291.1| membrane protein [Vibrio cholerae MJ-1236]
 gi|254225024|ref|ZP_04918638.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|254847898|ref|ZP_05237248.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255744567|ref|ZP_05418518.1| membrane protein [Vibrio cholera CIRS 101]
 gi|262161298|ref|ZP_06030409.1| membrane protein [Vibrio cholerae INDRE 91/1]
 gi|262168791|ref|ZP_06036486.1| membrane protein [Vibrio cholerae RC27]
 gi|262192498|ref|ZP_06050649.1| membrane protein [Vibrio cholerae CT 5369-93]
 gi|298499106|ref|ZP_07008913.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655207|gb|AAF93926.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121546712|gb|EAX56889.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121631485|gb|EAX63855.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|125622411|gb|EAZ50731.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|126512166|gb|EAZ74760.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|146316415|gb|ABQ20954.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|149741788|gb|EDM55817.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|227008828|gb|ACP05040.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227012585|gb|ACP08795.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229344540|gb|EEO09514.1| membrane protein [Vibrio cholerae RC9]
 gi|229350668|gb|EEO15609.1| membrane protein [Vibrio cholerae B33]
 gi|229357848|gb|EEO22765.1| membrane protein [Vibrio cholerae BX 330286]
 gi|229371298|gb|ACQ61721.1| membrane protein [Vibrio cholerae MJ-1236]
 gi|254843603|gb|EET22017.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255737598|gb|EET92992.1| membrane protein [Vibrio cholera CIRS 101]
 gi|262022909|gb|EEY41615.1| membrane protein [Vibrio cholerae RC27]
 gi|262029048|gb|EEY47701.1| membrane protein [Vibrio cholerae INDRE 91/1]
 gi|262031657|gb|EEY50244.1| membrane protein [Vibrio cholerae CT 5369-93]
 gi|297543439|gb|EFH79489.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 204

 Score = 70.4 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/209 (14%), Positives = 70/209 (33%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S    +    +++++A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRYYQDSVVAAQEAASQSYSKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +  ++   +    I +     Y  L+ M +A   V  G    A    L+ A    
Sbjct: 61  MDALQAKGIESEGTIQTFIDANKETEYAVLAAMQLAKAQVDAGQLDEAL-AQLEWAKGAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A++   T + A +  +   +++    L  + E S        E+ G   ++ G    
Sbjct: 120 KDAALKPLLTFRVARLQAEQGQFDDALTQLTSIQEKSWAGRV--AELRGDILMRKGDSAA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  +  ++   +    QM L ++
Sbjct: 178 AYAAYTEAQQAEDASQTL----QMKLDDL 202


>gi|253999421|ref|YP_003051484.1| hypothetical protein Msip34_1712 [Methylovorus sp. SIP3-4]
 gi|313201443|ref|YP_004040101.1| hypothetical protein MPQ_1711 [Methylovorus sp. MP688]
 gi|253986100|gb|ACT50957.1| conserved hypothetical protein [Methylovorus sp. SIP3-4]
 gi|312440759|gb|ADQ84865.1| conserved hypothetical protein [Methylovorus sp. MP688]
          Length = 208

 Score = 70.0 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/211 (12%), Positives = 67/211 (31%), Gaps = 3/211 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K            L++ ++     +  ++    ++       + QA
Sbjct: 1   MAYDLEEQEQLDALKSWWKTNGKYVQALLIAVVIGLAGYKGWNYYLNQQAIKASAKY-QA 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +       +++  +++   +           A+ +        +A+  L  A +  
Sbjct: 60  MTQLDIKDTQAIQAAAGELMDNFSTTPYAARAAIAAAKVSYTSKDLASAKRQLAWAAEHA 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               V   A LQ A I  +   +E   K L +  +          ++ G   L  GK  +
Sbjct: 120 KEDQVAAVAMLQLAGIQFEEKDHEAALKTLAQ--KHDAAFDGLFADLKGDILLAQGKKAE 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           AK  +EE     +        ++  L ++ +
Sbjct: 178 AKQAYEEALLKLDEQGRYRRFTEHKLESLGS 208


>gi|297538114|ref|YP_003673883.1| hypothetical protein M301_0922 [Methylotenera sp. 301]
 gi|297257461|gb|ADI29306.1| Protein of unknown function DUF2133 [Methylotenera sp. 301]
          Length = 207

 Score = 70.0 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 64/210 (30%), Gaps = 3/210 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K        +   L++ +L     +  +     K+       + + 
Sbjct: 1   MAYDLEEQEQIDELKAWWKQNGKMISTLVIGVLVAYSAYQGWHYFQNKQAVEASTQYQEL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                 +       S   +       Y   + ++ A       D K+A         +  
Sbjct: 61  SITDEKDLKSIQTKSAVLMDKFAGTPYAGRAALFAAKANYQANDAKSAKAQLDWAIKNAK 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              +V   A+LQ A+IL +   +E    +L    +          ++ G   +  GK  +
Sbjct: 121 -ETSVSALASLQLANILAEEKDFEGALNLLNAPHDAG--FDGLFADLKGDVLVSLGKSAE 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           AKT ++E     +        +Q  L  + 
Sbjct: 178 AKTAYQEALAKLDQHGKFRALTQQKLEALG 207


>gi|251791828|ref|YP_003006548.1| protein 1057 [Aggregatibacter aphrophilus NJ8700]
 gi|247533215|gb|ACS96461.1| protein 1057 [Aggregatibacter aphrophilus NJ8700]
          Length = 204

 Score = 70.0 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 65/193 (33%), Gaps = 6/193 (3%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
               YK+I    ++    +  W   +     +K +     + QAL  +  +    A    
Sbjct: 18  WNENYKFIIVCFVIAFGGVFGWN-YWQSHQIQKIHSASAEYEQALFNYAKDPKAQAEQFS 76

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
           + I + +   Y  L+ +  A I V   D   A +   +          +     L+ AS+
Sbjct: 77  QFIKNHEKTSYAVLALLDKAKIAVENNDFTLAEDALKQAMAQ-STDDILSSITALRLASV 135

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
                 ++     L+ + E         N + G   L  G  + AK  +++  +  ++  
Sbjct: 136 QFQLGQFDPALDSLKLVKEQ--AWSGAKNILAGDIQLAKGDKEAAKASYQQAQQ--HASP 191

Query: 197 GISTRSQMILANI 209
                 Q+ L N+
Sbjct: 192 LEQQLIQVRLNNL 204


>gi|166712108|ref|ZP_02243315.1| hypothetical protein Xoryp_11790 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 212

 Score = 69.6 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/211 (12%), Positives = 71/211 (33%), Gaps = 10/211 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ++   D +    + +             +L+ L+L + +  +      +       +   
Sbjct: 3   IDDLLDEHEQGERVRSWLRNNGAGLVGGVLVGLALILGWQWWQKYTNTELVEANTRYEAV 62

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +  LD+A      +      +Y  L+ + +A   V  G    A     K   D  
Sbjct: 63  VKSIQAKNLDNAAKDIVALDDGKGGIYAELAALRLAKAQVDAGKNAEAI----KTLRDVP 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   ++     + A +L ++   +E  K+L    + ++       EI   + +  GK  +
Sbjct: 119 AEGELKQIVQQRLARVLTESGKPDEAIKLLADAQDHAS------LEIRADALVAQGKPDE 172

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+ ++ +     +         +  L ++  
Sbjct: 173 ARALYTKALTTVDVASPQRRLLETKLMDVGG 203


>gi|34498991|ref|NP_903206.1| hypothetical protein CV_3536 [Chromobacterium violaceum ATCC 12472]
 gi|34104841|gb|AAQ61198.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 209

 Score = 69.6 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/200 (9%), Positives = 55/200 (27%), Gaps = 2/200 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     +  +    +L +    + +  +      +       +    +   +  +  
Sbjct: 12  DSLKAFWQQWGKLIGGAVLAVSLGYLGYKAYGMYQRGQSEKAAAAYEAVDDAVAAKDIAK 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            +S+ +++  +            + +      +    A   L+    +     ++  A L
Sbjct: 72  LKSAAQQLQGEYAGTLYASRAALVLAKAAFDKNDPALAASQLEWVLKNGKDEELQAIARL 131

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + AS+L+D   ++     L +             E+ G   +  G    A+  ++     
Sbjct: 132 RLASLLLDQKKFDGAIGELNQ--AHPAAFDAEFLELKGDVFVAKGDSNGARDAYKAALAK 189

Query: 192 NNSPFGISTRSQMILANIIA 211
                      Q  L  +  
Sbjct: 190 MQGESPNRQLVQTKLDALGG 209


>gi|326575995|gb|EGE25918.1| hypothetical protein E9W_03505 [Moraxella catarrhalis CO72]
          Length = 277

 Score = 69.6 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 23/226 (10%), Positives = 60/226 (26%), Gaps = 22/226 (9%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENF------- 57
           ND N    K       +       +L++L++   +  +  ++ K   +  + +       
Sbjct: 7   NDNNFTDQKSLNALKLHGEKIIYAVLLVLAVFFGWQYYQKNYAKIDTVAADTYTSISVRD 66

Query: 58  -------------AQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
                            +     +          + +  N +Y   + M  A       D
Sbjct: 67  ERLVQAYLNPQLDEATKQALAEEEKRLFGDIDALVAAHGNTVYAWQALMIKARHQTNNND 126

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFA 164
              A     +  + +L    +   A ++ A  ++          I  +            
Sbjct: 127 LDGAVATLSQATSINLDDDGLIAIAKIRHARAMLANGDTNGALSIANE--AMPTAFEASR 184

Query: 165 NEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
            E+LG       ++  AK+ +    +             + L ++ 
Sbjct: 185 QELLGDIYHAKNEIDNAKSAYTNAWEVLRERQENRAVLALKLQSLG 230


>gi|167893950|ref|ZP_02481352.1| hypothetical protein Bpse7_09346 [Burkholderia pseudomallei 7894]
          Length = 218

 Score = 69.6 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 58/186 (31%), Gaps = 2/186 (1%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K     +  +   + + +L+ A  +  ++    ++       + QA +   
Sbjct: 5   DEQESIESLKAWWARWGNLTTWVAIAVLAAAAAWNGWNYWQRRQATQAAVLYEQAQQAVR 64

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           SN           +  +             A+  +        A+  L+ A D       
Sbjct: 65  SNDKAKISRVASDMEDKFGGTAYAQMTALEAAKALYGAGDAAGAKAQLQWAADHAKDDEY 124

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
           +  A L+ AS+L+D  +Y+    +L     PS+       +  G      GK   AK  +
Sbjct: 125 KQIAKLRLASLLLDEKAYDAGLALLSG--TPSDAFKGAVADRRGDLLAAQGKSDDAKAAY 182

Query: 186 EELAKD 191
           +     
Sbjct: 183 KLALDA 188


>gi|88703670|ref|ZP_01101386.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88702384|gb|EAQ99487.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 220

 Score = 69.6 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/213 (15%), Positives = 62/213 (29%), Gaps = 5/213 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           MES           K           + +++ L L   +  +  + E         + Q 
Sbjct: 1   MESYRTEEEQVEALKRWWKENGRSTMVGVVLALGLGFGWQAWQKNQETAAQNASNLYQQM 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKL--YNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
           L+  ++ +           L   ++   Y   + +++A + V  G  + A +        
Sbjct: 61  LQALSAEETGTIGRQIATELKDSHRGTVYAQFAALHLARLAVNDGQPQVAEQELRWTLAM 120

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKV 178
                 V   A L+ A +L      EE   +   L+  +           G   L  G+ 
Sbjct: 121 ADEGDDVHQVAQLRLARVLAAQEKEEEALAL---LAGANTDFIASYAIARGDILLAQGRE 177

Query: 179 QKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
             A   +E  A        +    Q  L  + A
Sbjct: 178 ADALAAYESAAAALEEGAPVPQTLQDKLEYLGA 210


>gi|254294313|ref|YP_003060336.1| hypothetical protein Hbal_1955 [Hirschia baltica ATCC 49814]
 gi|254042844|gb|ACT59639.1| conserved hypothetical protein [Hirschia baltica ATCC 49814]
          Length = 240

 Score = 69.6 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 48/213 (22%), Positives = 88/213 (41%), Gaps = 3/213 (1%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            + N    K           A    + I+++      FD    K+    G  F   L+  
Sbjct: 8   VEENVKADKLNRFWNKAWPFALGGSIAIVAMVAANSYFDEQATKEIEANGRTFELGLKSL 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
               +++ RS F  +L + +  +  L+  Y+A   +       AA   L+++     P  
Sbjct: 68  EIQDVENTRSRFGALLDK-DSGFADLAAQYLAQAELEMAGDTLAAAKALEISAQGEGP-- 124

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +   A L+AA +L DT S  E+   L  L    +     A+E++G  A + G +++A++ 
Sbjct: 125 LADLAKLKAAYLLADTQSLAEVEAALGDLVGNEDSFGALAHELIGAKAFEEGDMERARSE 184

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           ++ L    N+P G+  R+   LA I A  + N 
Sbjct: 185 YQALTLRLNAPEGVLNRANDALAVIPALTETNT 217


>gi|260771394|ref|ZP_05880319.1| membrane protein [Vibrio furnissii CIP 102972]
 gi|260613520|gb|EEX38714.1| membrane protein [Vibrio furnissii CIP 102972]
 gi|315180974|gb|ADT87888.1| hypothetical protein vfu_A02773 [Vibrio furnissii NCTC 11218]
          Length = 204

 Score = 69.6 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 33/209 (15%), Positives = 71/209 (33%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K              ++ L     +  +  S    +     ++ +A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIFGAVIGLGGLFGWRFYQDSVTSGQEAASASYTKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +  +D        I S     Y  L+ M +A   V  G    A    L+ A +  
Sbjct: 61  IQTLTTKGVDGEADVQSFIDSNSKSEYAVLAAMQLAKAQVQAGQLDEAL-AQLEWAKNAT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A++   T + A +  +  +++     L  + E S        E+ G  +L+ G  + 
Sbjct: 120 GDAALKPVITYRVARLQAEQGNFDAALSELATIKEQS--WTGRVAELRGDISLRKGDKEA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  + +++   +    QM L ++
Sbjct: 178 AYAAYAEAQQADDASQTL----QMKLDDL 202


>gi|77362055|ref|YP_341629.1| TPR-like domain-containing protein [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876966|emb|CAI89183.1| puttive membrane-associated protein with TPR-like domain
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 206

 Score = 69.6 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/209 (11%), Positives = 60/209 (28%), Gaps = 10/209 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+  +         K           L +++ L     +  ++ +         + +   
Sbjct: 1   MDIYSTEEQQAEAIKRFFRENGLSLALGVIVGLGGLYGWKAYNQNQITTAEQASDAYTTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +            S+   I    +  Y  L+    A   V   D   A+E    + ++  
Sbjct: 61  VS-----GESVLSSADTFISENKDTNYATLAAFVAAKDAVEANDLDAASEKLSWIVSNVK 115

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  A  + A + +    Y+E    L       +       E+ G    K G  ++
Sbjct: 116 NDE-LKAIAITRLARVQIAQQQYDEALTSLNA--SLPDAFSANVAELKGDIYTKQGDKKQ 172

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A+  ++                Q+ L ++
Sbjct: 173 ARAAYQAAVDAGGLTSN--PLLQIKLDDL 199


>gi|56476108|ref|YP_157697.1| putative transmembrane protein [Aromatoleum aromaticum EbN1]
 gi|56312151|emb|CAI06796.1| putative transmembrane protein [Aromatoleum aromaticum EbN1]
          Length = 215

 Score = 69.3 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 68/205 (33%), Gaps = 7/205 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     Y  +   L +     ++ +  F     K+ +  G  +    +         
Sbjct: 13  SELKAWWAQYGKLVTTLAVAAALASVGWQGFRWYQNKQASEAGALYFVVQQAAERGDAQK 72

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           AR +  +I+ + +          +++ +         A   L+   +      +R  A L
Sbjct: 73  AREAAGQIIEKFSGTVYAEMAALLSAGVQFSAGEGKNARAQLEWLVEHGDDAVLRDIARL 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + AS+L+D  ++ +    LQ   EP   +     ++ G      GK+ +A++ ++     
Sbjct: 133 RLASVLLDEGAHADALARLQA--EPDAALKGRFADLRGDVLAANGKLAEARSAYQGALDA 190

Query: 192 -----NNSPFGISTRSQMILANIIA 211
                      +    ++ L  +  
Sbjct: 191 IAQGGTEGGETLREVVRVKLQALEG 215


>gi|312796095|ref|YP_004029017.1| hypothetical protein RBRH_03730 [Burkholderia rhizoxinica HKI 454]
 gi|312167870|emb|CBW74873.1| Hypothetical protein RBRH_03730 [Burkholderia rhizoxinica HKI 454]
          Length = 209

 Score = 69.3 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 23/201 (11%), Positives = 58/201 (28%), Gaps = 3/201 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              +     +  +   ++L  L     +  ++    ++       +    +   S     
Sbjct: 11  DNLQAWWAKWGNVLTGVVLAALLAGAAYNGWNWWQRRQAAQAAVFYDTVQQAVASGDKAQ 70

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
                  + ++         +   A+  +        A+  L+   D     A +  A L
Sbjct: 71  IARVAADMEARFGGTAYAPLSALAAAKALYAAADVAGAKGQLQWVIDQARGDAFKAVARL 130

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A++L+D  +Y+   K+L     P         +  G      GK  +A+  ++     
Sbjct: 131 RLAALLIDEKAYDAGLKLLSD--PPPQAFGGLYADRRGDLLAAQGKRDEARAAYQTALAA 188

Query: 192 NNSP-FGISTRSQMILANIIA 211
                  +    Q  L  +  
Sbjct: 189 LEHGESSVRQLIQFKLDALGG 209


>gi|126725457|ref|ZP_01741299.1| hypothetical protein RB2150_04613 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704661|gb|EBA03752.1| hypothetical protein RB2150_04613 [Rhodobacterales bacterium
           HTCC2150]
          Length = 215

 Score = 69.3 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 70/211 (33%), Gaps = 6/211 (2%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    + +       Y WIA + +++++  A +      S +     +G+    AL + 
Sbjct: 11  VNEEVRRDQLYTYLRKYGWIAAVAVVVLVGGAAYNEYSKASAQSAAQGLGDATMAALSIE 70

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +      A      +     +  +      +     A  D   A      + ++  A   
Sbjct: 71  DRADQRAA------LGEIGAEGPSAEIITLLQGAAAANNDKPAAIASLTAIIDNADAEEI 124

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            +  A L+   +    +   +   +L  L+ P       A E   +  ++ G V+ A  I
Sbjct: 125 YKDLARLKLVMLQGADAPAADRIDMLDALAVPGKAFRLIALEQKAVVLVETGDVEGALVI 184

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQR 215
            +EL  + +    +  R   ++  + A  + 
Sbjct: 185 LQELLSEQSLTTDLRQRVTQLIVALGAEPKA 215


>gi|332141962|ref|YP_004427700.1| putative membrane-associated protein with TPR-like domain
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|327551984|gb|AEA98702.1| putative membrane-associated protein with TPR-like domain
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 206

 Score = 69.3 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 35/213 (16%), Positives = 69/213 (32%), Gaps = 9/213 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K     +     +   + L     +  +  +  + K      +  A
Sbjct: 1   MEQFATEEQQVEAIKRFWKEHGTAIIVGAALGLGGLWGWRYYSETQIESKEAASVAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +E F S   D   ++F  I    +  Y  ++ +  A   V  GD   AA     V     
Sbjct: 61  VETFGSEGSDAKVNAF--IEENKDSGYASIAGLLAAKQAVDAGDLDAAASHLNSVVTFAE 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                   A+L+ + + ++ +  +     L  ++   +      +E+ G    K GK   
Sbjct: 119 NDELKV-LASLRLSRVQIEMNQLDAALSTLSNVTN--DAFSAEVSELKGDVYQKQGKFDD 175

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           A+  +    + N +   +    QM L N+  S 
Sbjct: 176 ARLAYSNALEKNANNPLL----QMKLDNLSVSA 204


>gi|146308513|ref|YP_001188978.1| hypothetical protein Pmen_3498 [Pseudomonas mendocina ymp]
 gi|145576714|gb|ABP86246.1| conserved hypothetical protein [Pseudomonas mendocina ymp]
          Length = 212

 Score = 68.9 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 60/204 (29%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              ++ L     +  +      +       + Q    AL    +   
Sbjct: 11  LKDWWDRNGKPLLAGGVLALVAVFGWQGWQKYQVNQAQSASLIYQQLLETALNPAGTPDA 70

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S     +         + +  + D  + A   L+   D  A   +   A
Sbjct: 71  AKVAELAGKLNSDFGGSHYAQYGSLFVAKVAVEADRLDDAAAALQRVLDKPADATLGELA 130

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L      +E  K+L    E  N       E+ G   +K G+   A   +++ A
Sbjct: 131 RQRLARVLAAQDKADEALKLLDAKVE--NAFLASREELKGDLLVKLGRSDDAHAAYQK-A 187

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
           KD  +        QM L ++   D
Sbjct: 188 KDALAEDAAVGGLQMKLDDLAKGD 211


>gi|326794516|ref|YP_004312336.1| hypothetical protein Marme_1227 [Marinomonas mediterranea MMB-1]
 gi|326545280|gb|ADZ90500.1| Protein of unknown function DUF2133 [Marinomonas mediterranea
           MMB-1]
          Length = 213

 Score = 68.9 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 28/200 (14%), Positives = 71/200 (35%), Gaps = 9/200 (4%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGEN-------F 57
           ++  + + + +  K  +K     LIL +      ++ F      +   + E         
Sbjct: 2   SELKTEEEQIEAFKTWWKKNGTALILAVAVGVGGYFGFQAWKTNEATHISEASSLYQTLI 61

Query: 58  AQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
             A +L       D  +   ++  + +     +      + L       + A   L+ A 
Sbjct: 62  EAASDLDTEKNQKDVAALAAQLNEEYSDTGYAMFAELFVAELEVSKGNYDKAITALEAAV 121

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
                 + +  AT++ A +L +   ++     L+ +++  +      NE+ G   ++ GK
Sbjct: 122 SGTEDQSFQTIATIRIARLLAEKEDFDAALSKLESVTQ--SEFSVQKNELKGDIYVRQGK 179

Query: 178 VQKAKTIFEELAKDNNSPFG 197
              A+T +E+  +D  +   
Sbjct: 180 RDDARTAYEQAKQDLKAGQN 199


>gi|270156686|ref|ZP_06185343.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|289164867|ref|YP_003455005.1| hypothetical protein LLO_1533 [Legionella longbeachae NSW150]
 gi|269988711|gb|EEZ94965.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|288858040|emb|CBJ11900.1| putative conserved hypothetical protein [Legionella longbeachae
           NSW150]
          Length = 224

 Score = 68.9 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 27/184 (14%), Positives = 61/184 (33%), Gaps = 2/184 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y  +  +++ +IL     +       EK        +   +   +++ +  
Sbjct: 12  ESIKKWWKQYGNLITIVLSLILFGIAGYRYLHWHQEKLTQQASIAYEHMMVALSNHNIKA 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            RS   +++ + +            + +    +  N A   L+    +   LA++  A +
Sbjct: 72  VRSYANELIHEHSGSVYADVAHMTLAKIYVSKNNLNKATQELQSVASNSQMLALKQIAKI 131

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A I     SY    K L  +    N      NE+ G      G+ Q+A   ++    +
Sbjct: 132 RIARIYAAEKSYANALKELGSI--DDNTYLPVINELKGDIYGATGQYQEAINSYKLALDE 189

Query: 192 NNSP 195
             + 
Sbjct: 190 VKTN 193


>gi|332140451|ref|YP_004426189.1| putative membrane-associated protein with TPR-like domain
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550473|gb|AEA97191.1| putative membrane-associated protein with TPR-like domain
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 206

 Score = 68.9 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 35/213 (16%), Positives = 69/213 (32%), Gaps = 9/213 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K     +     +   + L     +  +  +  + K      +  A
Sbjct: 1   MEQFATEEQQVEAIKRFWKEHGTAIIVGAALGLGGLWGWRYYSETQIESKEAASVAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +E F S   D   ++F  I    +  Y  ++ +  A   V  GD   AA     V     
Sbjct: 61  VETFGSEGSDAKVNAF--IEENKDSGYASIAGLLAAKQAVDAGDLDAAASHLNSVVTFAE 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                   A+L+ + + ++ +  +     L  ++   +      +E+ G    K GK   
Sbjct: 119 NDELKV-LASLRLSRVQIEMNQLDAALSTLSNVTN--DAFSAEISELKGDVYQKQGKFDD 175

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           A+  +    + N +   +    QM L N+  S 
Sbjct: 176 ARLAYSNALEKNANNPLL----QMKLDNLSVSA 204


>gi|120598180|ref|YP_962754.1| hypothetical protein Sputw3181_1357 [Shewanella sp. W3-18-1]
 gi|120558273|gb|ABM24200.1| conserved hypothetical protein [Shewanella sp. W3-18-1]
          Length = 206

 Score = 68.9 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 37/194 (19%), Positives = 68/194 (35%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      K     + F QA
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGTSILIGAVVGLGGLYGWNYYSDMKVAKAEEASKAF-QA 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   ++++        E   + D K Y  L ++ +A   V   D   A +   KV     
Sbjct: 60  LTTKSADEAAMLAGVAEFSKNHDQKGYQALLDLIVAKTAVEAKDYPKAIDALNKVITTKP 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              ++   ATL+ A I  +    +     L+K+S+          E+ G   ++ G V+K
Sbjct: 120 G-ASLDTIATLRLARIQAELGQIDAGLATLEKVSDK--AFLAQREELKGDFLVRQGDVEK 176

Query: 181 AKTIFEELAKDNNS 194
           AKT ++    +   
Sbjct: 177 AKTAYQTAMDNGGV 190


>gi|119471073|ref|ZP_01613632.1| puttive membrane-associated protein with TPR-like domain
           [Alteromonadales bacterium TW-7]
 gi|119445913|gb|EAW27194.1| puttive membrane-associated protein with TPR-like domain
           [Alteromonadales bacterium TW-7]
          Length = 206

 Score = 68.9 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/195 (11%), Positives = 65/195 (33%), Gaps = 8/195 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+ ++         K           L +++ L     +  ++ +         +++ + 
Sbjct: 1   MDIHSTEEEQAEAIKRFFRENGLSLALGVIVGLGGLYGWKAYNQNQITTAEQASDSYTKL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +E       DD  SS +  +S++          ++A+    +    + A   L     ++
Sbjct: 61  VEG------DDVLSSADAFISENKDTNYAALAAFVAAKDAVEAQKLDVASEKLSWIVSNV 114

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  A  + A I +  +++++    L          +    E+ G    + G  ++
Sbjct: 115 DNAELKAIAITRLARIQIAQTNFDDALSTLNA--PLPEAFNANVAELKGDIYAQQGNKEQ 172

Query: 181 AKTIFEELAKDNNSP 195
           A+T ++         
Sbjct: 173 ARTAYQAAVDAGGLT 187


>gi|330504677|ref|YP_004381546.1| hypothetical protein MDS_3763 [Pseudomonas mendocina NK-01]
 gi|328918963|gb|AEB59794.1| hypothetical protein MDS_3763 [Pseudomonas mendocina NK-01]
          Length = 212

 Score = 68.5 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 27/204 (13%), Positives = 63/204 (30%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              ++ L     +  +    + +       + Q    AL+       
Sbjct: 11  LKDWWDRNGKPLLAGGVLALVAVFGWQGWQKYQDNQAQGASVLYQQLLETALDPAGKPDA 70

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+    +         + +  + +  + A   L+   D  A   +   A
Sbjct: 71  AKVAELAGKLDSEFGGSHYAQYGSLFVAKVAVEANRLDDAAAALQRVLDKPADATLGELA 130

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L      ++  K+L   ++  +       E+ G   ++ G+   A   +++ A
Sbjct: 131 RQRLARVLAAQDKADDALKLLD--TKVEDAYLASREELKGDLLVQLGRSDDAHAAYQK-A 187

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
           KD  +        QM L ++   D
Sbjct: 188 KDALAEDAAVGGLQMKLDDLAKGD 211


>gi|50083799|ref|YP_045309.1| hypothetical protein ACIAD0563 [Acinetobacter sp. ADP1]
 gi|49529775|emb|CAG67487.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 233

 Score = 68.1 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 63/205 (30%), Gaps = 8/205 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK--- 68
              K     Y       IL+ L     +  +      +         Q ++   + +   
Sbjct: 11  DNLKSFTKKYGSAIISGILIALIAFFGWQYWQKKTLAENQTRTAKVQQLIDQAQAAEANP 70

Query: 69  ---LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
               +   ++ + +    + +    +   +A I   KGD   A +   K+ N  +    +
Sbjct: 71  DALNNLYAAADKIVKDAPDSIQAVQTEFLLAKIAYDKGDYATAEKSLKKIENSKINDEGL 130

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                L+ A+  +    Y+E  K L  +++P       A E  G   +    +  A+  +
Sbjct: 131 VQLIKLRLANAQLAQKKYDEALKTLSLVTDP--AFKATAEEARGDVYVAKNDIASARKAY 188

Query: 186 EELAKDNNSPFGISTRSQMILANII 210
           +                Q+ L ++ 
Sbjct: 189 QSAWNVLLERKQERQILQIKLESVG 213


>gi|4033490|sp|O52728|YA57_ACTAC RecName: Full=UPF0070 protein 1057
 gi|2921819|gb|AAC04858.1| hypothetical protein 1057 [Aggregatibacter actinomycetemcomitans]
          Length = 204

 Score = 68.1 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 67/193 (34%), Gaps = 6/193 (3%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
               YK+I    ++    +  W   +     +K +     + QAL  +  +    A    
Sbjct: 18  WNENYKFIIVCFVIAFGGVFGWN-YWQSHQIQKMHKASAEYEQALFNYQKDPKAQAEQFN 76

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
           + I + +   Y  L+ +  A I V   D   A +   +          +   + L+ AS+
Sbjct: 77  QFIKNNEKTSYAVLALLDKAKIAVENKDFPLAEDALKQAMAQ-SNDDILSSVSALRLASV 135

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
                  +   + L+ + E     +   N + G   L  G  + AK  +++  ++  +  
Sbjct: 136 QFQLGQLDPALESLKSVKEQ--AWNSAKNLLAGDIQLAKGDKETAKKSYQQAQENAGALE 193

Query: 197 GISTRSQMILANI 209
                 Q+ L N+
Sbjct: 194 --QQLIQVRLNNL 204


>gi|226954469|ref|ZP_03824933.1| tetratricopeptide TPR_4 [Acinetobacter sp. ATCC 27244]
 gi|294651485|ref|ZP_06728798.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|226834818|gb|EEH67201.1| tetratricopeptide TPR_4 [Acinetobacter sp. ATCC 27244]
 gi|292822635|gb|EFF81525.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 232

 Score = 68.1 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 31/205 (15%), Positives = 68/205 (33%), Gaps = 8/205 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFA------QALELFN 65
              K     Y       IL+ L     +  +    + +               QAL    
Sbjct: 10  DSLKSFAKKYGSAIISGILIALIAFFGWEYWQKKTQAEAQNQTAKVQKLIDEAQALAGQP 69

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +     + ++ + +    N ++     + +A +   K D   A +   KV N  +    +
Sbjct: 70  NAFETISEAADKIVKEDANSVHAIQVQLLLAKLAYDKDDYAAAEKALKKVENSTIKDTGL 129

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                L+ A   +    Y+E  K L K++EP+      A+E+ G   +   + + A+  +
Sbjct: 130 VQIVKLRLADAQLAQKKYDEALKTLDKVTEPT--FKATADELRGDIYVAKQETEAARKAY 187

Query: 186 EELAKDNNSPFGISTRSQMILANII 210
           +    +           Q+ L ++ 
Sbjct: 188 QSAWDNVVERKLERQLLQIKLESVG 212


>gi|237800046|ref|ZP_04588507.1| hypothetical protein POR16_14512 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331022901|gb|EGI02958.1| hypothetical protein POR16_14512 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 213

 Score = 68.1 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 25/204 (12%), Positives = 58/204 (28%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              L+ L + + +  +      +       + Q    AL        
Sbjct: 12  MKDWWQRNGKPLLTGGLLALVVVLGWQGWQRYQAGQSQGASMLYQQLLETALTPSGQADT 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +       + A   LK   D  A   +   A
Sbjct: 72  ARVAELSGKLKSEFGGTTYAQFGSLFVAKVAVDAGKLDDAAAELKTVADKPANDTLGEVA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A ++   +  ++  K+L    +          E+ G   ++ G+  +A   +++  
Sbjct: 132 RQRLARVMAAQNKVDDALKLLDG--DADKAFLASREELKGDLLVQLGRTDEAHAAYQKAK 189

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
              +    +    QM L ++   D
Sbjct: 190 SALSEDAAVGG-LQMKLDDLAKGD 212


>gi|261868683|ref|YP_003256605.1| hypothetical protein D11S_2032 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261414015|gb|ACX83386.1| hypothetical protein D11S_2032 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 204

 Score = 67.7 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 67/193 (34%), Gaps = 6/193 (3%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
               YK+I    ++    +  W   +     +K +     + QAL  +  +    A    
Sbjct: 18  WNENYKFIIVCFVIAFGGVFGWN-YWQSHQIQKMHKASAEYEQALFNYQKDPKAQAEQFN 76

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
           + I + +   Y  L+ +  A I V   D   A +   +        +    +A  + AS+
Sbjct: 77  QFIKNNEKTSYAVLALLDKAKIAVENKDFPLAEDALKQAMAQSNDDILSSVSAL-RLASV 135

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
                  +   + L+ + E     +   N + G   L  G  + AK  +++  ++  +  
Sbjct: 136 QFQLGQLDPALESLKSVKEQ--AWNSAKNLLAGDIQLAKGDKEAAKKSYQQAQENAGALE 193

Query: 197 GISTRSQMILANI 209
                 Q+ L N+
Sbjct: 194 --QQLIQVRLNNL 204


>gi|124483440|emb|CAM32593.1| Conserved hypothetical protein [Herbaspirillum seropedicae]
          Length = 215

 Score = 67.7 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/168 (12%), Positives = 58/168 (34%), Gaps = 2/168 (1%)

Query: 46  HEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDT 105
             ++       + +  +   +      + +   I  + +       +  +A+      + 
Sbjct: 47  QGRQSAQASVLYEEHQKSLAAKDNAKVQRAAADIQDKFSGTAYAQMSALVAAKSAFDAND 106

Query: 106 KNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFAN 165
            + A+  L+   D       +  A ++ A +L+D  +Y+E  K+L    +          
Sbjct: 107 ADTAKKQLQWVIDHGRGKEYKAIAAVRLAGVLLDAKAYDEALKVLGG--DYPAQFAGAIA 164

Query: 166 EILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           +  G   L  GK  +A++ ++   + +++        Q+ L  I    
Sbjct: 165 DRKGDVLLAQGKRDEARSAYKLALEKSDAKDPGRQLIQIKLDAIGGEA 212


>gi|146293746|ref|YP_001184170.1| hypothetical protein Sputcn32_2650 [Shewanella putrefaciens CN-32]
 gi|145565436|gb|ABP76371.1| conserved hypothetical protein [Shewanella putrefaciens CN-32]
 gi|319427120|gb|ADV55194.1| Protein of unknown function DUF2133 [Shewanella putrefaciens 200]
          Length = 206

 Score = 67.7 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 37/194 (19%), Positives = 68/194 (35%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      K     + F QA
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGTSILIGAVVGLGGLYGWNYYSDMKVAKAEEASKAF-QA 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   ++++        E   + D K Y  L ++ +A   V   D   A +   KV     
Sbjct: 60  LTTKSADEAAMLAGVAEFSKNHDQKGYQALLDLIVAKTAVEAKDYPKAIDALNKVITAKP 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              ++   ATL+ A I  +    +     L+K+S+          E+ G   ++ G V+K
Sbjct: 120 G-ASLDTIATLRLARIQAELGQIDAGLATLEKVSDK--AFLAQREELKGDFLVRQGDVEK 176

Query: 181 AKTIFEELAKDNNS 194
           AKT ++    +   
Sbjct: 177 AKTAYQTAMDNGGV 190


>gi|293391765|ref|ZP_06636099.1| hypothetical protein D7S_1930 [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952299|gb|EFE02418.1| hypothetical protein D7S_1930 [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 204

 Score = 67.7 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 67/193 (34%), Gaps = 6/193 (3%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
               YK+I    ++    +  W   +     +K +     + QAL  +  +    A    
Sbjct: 18  WNENYKFIIVCFVIAFGGVFGWN-YWQSYQVQKMHNASAEYEQALFNYQKDPKAQAEQFN 76

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
           + I + +   Y  L+ +  A I V   D   A +   +          +   + L+ AS+
Sbjct: 77  QFIKNNEKTSYAVLALLDKAKIAVENKDFPLAEDALKQAMAQ-SNDDILSSVSALRLASV 135

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
                  +   + L+ + E     +   N + G   L  G  + AK  +++  ++  +  
Sbjct: 136 QFQLGQLDPALESLKSVKEQ--AWNSAKNLLAGDIQLAKGDKEAAKKSYQQAQENAGALE 193

Query: 197 GISTRSQMILANI 209
                 Q+ L N+
Sbjct: 194 --QQLIQVRLNNL 204


>gi|289677944|ref|ZP_06498834.1| hypothetical protein PsyrpsF_31953 [Pseudomonas syringae pv.
           syringae FF5]
 gi|330975907|gb|EGH75973.1| hypothetical protein PSYAP_04524 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 213

 Score = 67.7 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 58/204 (28%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              L+ L + + +  +      +       + Q    AL        
Sbjct: 12  MKDWWQRNGKPLLTGGLLALVVVLGWQFWHRYQASQSQGASMLYQQLLETALTPSGQADT 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +       + A   LK   D  A   +   A
Sbjct: 72  ARVAEISGKLKSEFGGTTYAQFGSLFVAKVAVDAGKLDDAAAELKPVADKPANDTLGEIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  ++  K+L    +          E+ G   ++ G+  +A   +++  
Sbjct: 132 RQRLARVLAAQNKTDDALKLLDG--DADKAFLASREELKGDLLVQLGRTDEAYAAYQKAK 189

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
              +    +    QM L ++   D
Sbjct: 190 SALSEDAAVGG-LQMKLDDLAKGD 212


>gi|317403340|gb|EFV83853.1| membrane protein [Achromobacter xylosoxidans C54]
          Length = 212

 Score = 67.7 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/215 (12%), Positives = 61/215 (28%), Gaps = 6/215 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K     Y  +  LL+  +      ++        K N     F   
Sbjct: 1   MAYDLEEQEKLDAIKAWWARYGTLVMLLVAAVALAWGGWWGAKAYQSHKANQAMGYFEAL 60

Query: 61  LELFNSNKLD---DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
            +       D     +++   +  Q            +A+  +      + A   L+   
Sbjct: 61  EDAARLGGADSSVRIKAAAATLREQYGSTGYATRGALVAAQALQAQKDVDGARQQLEWLA 120

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
                 +++  A L+ A +L+D   Y+     L               +  G      GK
Sbjct: 121 GQSKNPSMQAVARLRLAGLLLDQKQYDAALAQLNNAPAAF---AALFADRRGDILAAQGK 177

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
             +A+  ++       +   ++   Q+ L  +  +
Sbjct: 178 RDEARAAWQSAIDGLGTANPLTQVVQLKLDALSGA 212


>gi|94269422|ref|ZP_01291458.1| hypothetical protein MldDRAFT_1984 [delta proteobacterium MLMS-1]
 gi|93451226|gb|EAT02129.1| hypothetical protein MldDRAFT_1984 [delta proteobacterium MLMS-1]
          Length = 223

 Score = 67.7 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/189 (13%), Positives = 73/189 (38%), Gaps = 6/189 (3%)

Query: 20  CYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKI 79
            YK +   L  +I+++  + +        ++    E  AQA+ L   +      ++ E++
Sbjct: 38  WYKPLLLGLAALIVAILAYSFGTQ-FATGREEQASEQLAQAMRL---DDEAQRLAAMEEV 93

Query: 80  LSQDNKLYNP-LSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV 138
                +      S + +A      G+ + AA  + ++ +             L  A +L+
Sbjct: 94  ADSYRRTGAGIWSRIELAHHQRGSGELEAAATAYEELLDSLSRHDPRHPMVRLSLAQVLL 153

Query: 139 DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
           +  + E   +  ++L+        +          + G+   A+  ++++A+  ++P  +
Sbjct: 154 ELGAKERAVEQYRQLAAVEG-YQAWGLLGSAEILRRQGETAAAREKYQQVAELADAPPLL 212

Query: 199 STRSQMILA 207
             +++  LA
Sbjct: 213 VEQAERRLA 221


>gi|148259764|ref|YP_001233891.1| hypothetical protein Acry_0752 [Acidiphilium cryptum JF-5]
 gi|146401445|gb|ABQ29972.1| Uncharacterized protein-like protein [Acidiphilium cryptum JF-5]
          Length = 247

 Score = 67.7 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 69/210 (32%), Gaps = 8/210 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
              + +     Y          +L     +  +     ++     + +          + 
Sbjct: 38  RAERTREFLMRYAGALAGAAAFVLLAIGGWKAWQWHRHQQDLKAADRYVTLTSQIGQQEA 97

Query: 70  DDAR-------SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN-DDLA 121
              +                    Y  L+ +  A++    GD K A +++  VA  +  A
Sbjct: 98  GLTKSGDIGDAKRLVDFAGTAPAGYANLARLRAAALYAQAGDLKTAGQLWAAVAAPNSGA 157

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              V   A L  A   +      ++   L  L++P NP    A   L +  +K GK + A
Sbjct: 158 TPPVHDLALLLLAQHEMGVKPDADVRARLATLNKPGNPWQPLAQLDLALLDMKAGKTKSA 217

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIA 211
             + EE++ D  SP  +   +Q ++A +  
Sbjct: 218 HGLLEEVSADPASPPNLRNLAQGLIAKLNG 247


>gi|254786614|ref|YP_003074043.1| tetratricopeptide repeat family protein [Teredinibacter turnerae
           T7901]
 gi|237686657|gb|ACR13921.1| tetratricopeptide repeat family protein [Teredinibacter turnerae
           T7901]
          Length = 234

 Score = 67.7 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/218 (13%), Positives = 64/218 (29%), Gaps = 11/218 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  +          K           L I++ L   + +  +    + K     + + Q 
Sbjct: 1   MADHLSEEEQVEAIKRWWNENWVSVVLPIILALGGYLGWNSWQDHKQGKAEQASDLYQQL 60

Query: 61  L--------ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
                    E  +  +      S   I+              + + +  +G   +AA   
Sbjct: 61  AMAAEVAPGETLSEEQRAAIDESANVIIDAHGGTLYADMANLLLAKIQVEGGQLDAAAAR 120

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA 172
           L+   D+ A  A++  A  + A ++     +     ++ +    S        EI G   
Sbjct: 121 LQAVVDNGADEAIQQVAKARLARVMSAKGDHSAALSMVAQ--TDSQSFKALFAEIRGDVY 178

Query: 173 LKFGKVQKAKTIFEELAKDNNSPF-GISTRSQMILANI 209
              GK+ +A T ++              +  Q+ L  +
Sbjct: 179 SAQGKLAEANTEYQAALDTLLPSEFNRRSLIQLKLDAV 216


>gi|58582154|ref|YP_201170.1| hypothetical protein XOO2531 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624046|ref|YP_451418.1| hypothetical protein XOO_2389 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188576713|ref|YP_001913642.1| hypothetical protein PXO_01056 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576904|ref|YP_001913833.1| hypothetical protein PXO_06110 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58426748|gb|AAW75785.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84367986|dbj|BAE69144.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188521165|gb|ACD59110.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521356|gb|ACD59301.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 212

 Score = 67.3 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/211 (12%), Positives = 69/211 (32%), Gaps = 10/211 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ++   D +    + +             +L+ L L + +  +      +       +   
Sbjct: 3   IDDLLDEHEQGERVRSWLRNNGAGLVGGVLVGLVLILGWQWWQKYTNTELVEANTRYEAV 62

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++   +  LD A      +      +Y  L+ + +A   V  G    A     K   D  
Sbjct: 63  VKSIQAKNLDKAAKDIMALDDGKGGIYAELAALRLAKAQVDVGKNAEAI----KTLRDVP 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   ++     + A +L ++   +E  K+L    + ++       EI   + +  GK  +
Sbjct: 119 AEGELKQIVQQRLARVLTESGKPDEAIKLLADAQDHAS------LEIRADALVVQGKPDE 172

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+ ++ +     +         +  L ++  
Sbjct: 173 ARALYAKALTTVDVASPQRRLLETKLMDVGG 203


>gi|149908867|ref|ZP_01897527.1| hypothetical protein PE36_21739 [Moritella sp. PE36]
 gi|149808141|gb|EDM68082.1| hypothetical protein PE36_21739 [Moritella sp. PE36]
          Length = 223

 Score = 67.3 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/195 (13%), Positives = 66/195 (33%), Gaps = 3/195 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K     +        ++ L+  + F  ++ S    +  +   +   
Sbjct: 1   MEGYATEEQQVEALKSWWKSHGNAVIFGTVLGLAGLVGFRYYNDSQLAAQEELSAAYDTV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   + N L    ++   I +     Y  L+ + +A+  V K D   A      VA +  
Sbjct: 61  VTELSENGLAAKATTQTFIDANSGNAYATLTALQLAAEAVKKQDFAEAETQLSWVATNSN 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              ++   A ++ A +     +++     L K++  +        E+ G   ++ G +  
Sbjct: 121 Q-ASILPIAKIRLARVQAQLQNFDAALATLDKVTLDTFASK--KAEVKGDIYVQQGDLNA 177

Query: 181 AKTIFEELAKDNNSP 195
           A++ +E       + 
Sbjct: 178 ARSAYETALAGVGAN 192


>gi|83747949|ref|ZP_00944980.1| Hypothetical Protein RRSL_02129 [Ralstonia solanacearum UW551]
 gi|207723166|ref|YP_002253565.1| hypothetical protein RSMK00390 [Ralstonia solanacearum MolK2]
 gi|207743442|ref|YP_002259834.1| hypothetical protein RSIPO_01619 [Ralstonia solanacearum IPO1609]
 gi|83725367|gb|EAP72514.1| Hypothetical Protein RRSL_02129 [Ralstonia solanacearum UW551]
 gi|206588360|emb|CAQ35323.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
 gi|206594839|emb|CAQ61766.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 211

 Score = 67.3 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/213 (9%), Positives = 68/213 (31%), Gaps = 3/213 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K        +   + +++L  A  +  +     K+       + Q 
Sbjct: 1   MAYDLEEQEQLESLKHWWRDNGNVVTWIAIVVLLAAAAWLGWKNWQRKQAGEASVLYEQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  ++   +  + +   +  +  +          A+  + + +    A+  L+   D  
Sbjct: 61  QKAVDAKDAEKIKRAAADMEDKFGRTAYAQMTALSAAKALYEANDAAGAKAQLQWTIDHA 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           +    +  A L+ A +L+D  +Y++   ++    + +        +  G       K   
Sbjct: 121 SDDEYKAVAKLRLAGLLLDEKAYDQGLALVSG--DVAPAFAALYADRRGDLLAAQNKKDD 178

Query: 181 AKTIFEELAKD-NNSPFGISTRSQMILANIIAS 212
           A+  ++   +  + +        Q  L  +  +
Sbjct: 179 ARAAYKLALEKFSQADASARQIVQFKLDALGGA 211


>gi|91775969|ref|YP_545725.1| hypothetical protein Mfla_1616 [Methylobacillus flagellatus KT]
 gi|91709956|gb|ABE49884.1| conserved hypothetical transmembrane protein [Methylobacillus
           flagellatus KT]
          Length = 208

 Score = 67.3 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/197 (12%), Positives = 63/197 (31%), Gaps = 3/197 (1%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           +        +   +  + L     +  +     ++       +         +       
Sbjct: 15  RSWWKRNGNLVIGVAALALVGFGGYEGWQYYQYQQSAAASVQYQNMASTDIKDADKIRTL 74

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
           S E +    +  Y   + + +A +   + D ++A       A +      VR  A LQ A
Sbjct: 75  SAELMDKYSSTPYAGRAAVAVAKLNYQEQDLESAKAQLTWAAKNAKEDA-VRAIALLQLA 133

Query: 135 SILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
           +I  +  +Y+E  K L +  +          ++ G   +  GK + AK  +++     + 
Sbjct: 134 AIQYEEKAYDEALKTLSEKHDAG--YAGLFADLKGDVLVAQGKTEDAKAAYKDALAKLDM 191

Query: 195 PFGISTRSQMILANIIA 211
                  ++  L  + +
Sbjct: 192 QGDYYKYTEYKLEALGS 208


>gi|323169043|gb|EFZ54720.1| hypothetical protein SS53G_0584 [Shigella sonnei 53G]
          Length = 178

 Score = 67.3 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 66/181 (36%), Gaps = 5/181 (2%)

Query: 30  LMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNP 89
           ++ +   I +  ++             +  A+   +  K D    + EK  +++   Y  
Sbjct: 2   ILGVGALIGWRYWNSHQVDSARSASLAYQNAVTAVSEGKPDSI-PAAEKFAAENKNTYGA 60

Query: 90  LSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKI 149
           L+++ +A   V K + + AA    +   D      ++    L+ A + V     +   K 
Sbjct: 61  LASLELAQQFVDKNELEKAAAQLQQGLADTS-DENLKAVINLRLARVQVQLKQADAALKT 119

Query: 150 LQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
           L  +            ++ G + L  G  Q A++ +E   K  +    +S   QM + N+
Sbjct: 120 LDTIKGEG--WAAIVADLRGKALLSKGDKQGARSAWEAGVKS-DVTPALSEMMQMKINNL 176

Query: 210 I 210
            
Sbjct: 177 S 177


>gi|255321135|ref|ZP_05362301.1| conserved hypothetical protein [Acinetobacter radioresistens SK82]
 gi|262380176|ref|ZP_06073331.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|255301689|gb|EET80940.1| conserved hypothetical protein [Acinetobacter radioresistens SK82]
 gi|262298370|gb|EEY86284.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 234

 Score = 67.3 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/206 (12%), Positives = 64/206 (31%), Gaps = 9/206 (4%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y       IL+ L     +  +      +  +      Q ++   +    D
Sbjct: 11  DNLKSFTKKYGSAIISGILIALIAFFGWEYWQKKTLAENQMRTAKVQQLMDEARNVNSQD 70

Query: 72  -------ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
                  ++S+ + +    + ++   +   +A     +GD   A +   +V    L    
Sbjct: 71  INALNALSQSADKIVKEAPDSVHALQAQFVMAKQAYDRGDYAAAEKALKRVEATKLKDEG 130

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           + +   L+ A   +  + Y+   K L  +++P       A E  G   +    +  A+  
Sbjct: 131 LVHVLKLRLAYAQLAQNKYDAALKTLADVTDP--AFKATAEEARGDVYVAKNDIASARKA 188

Query: 185 FEELAKDNNSPFGISTRSQMILANII 210
           ++                Q+ L ++ 
Sbjct: 189 YQSAWDALAERKKERQILQIKLESVG 214


>gi|152995387|ref|YP_001340222.1| hypothetical protein Mmwyl1_1358 [Marinomonas sp. MWYL1]
 gi|150836311|gb|ABR70287.1| conserved hypothetical protein [Marinomonas sp. MWYL1]
          Length = 213

 Score = 67.3 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/198 (10%), Positives = 66/198 (33%), Gaps = 11/198 (5%)

Query: 5   NDANSYKGKCKMGKCCYKW---IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           ++  + + + +  K  +K    +  + I + +     +  +  S     +     +   +
Sbjct: 2   SELKTEEEQIEAFKSWWKKNGVMLVVAIAVAVGGYFGWQAWKTSQTNYTSEASALYQNLV 61

Query: 62  ELF-----NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           +        +N+      + +      +  Y     +++A +    G    A +      
Sbjct: 62  QASADLSDENNQKTVTFIAKQLADDYGDTGYAMFGQLFLARVDAENGKYDEAIKALDDAI 121

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
                 ++    A L+ A +++    Y      ++K+SE          E++G   +  G
Sbjct: 122 AKTK-DVSFVAIANLRVARLMLQKEDYAGAMARVEKVSEEE--FAAQQQELIGDILISQG 178

Query: 177 KVQKAKTIFEELAKDNNS 194
           K   A+  +++ ++    
Sbjct: 179 KRDDARVAYQKASEALGV 196


>gi|330936982|gb|EGH41080.1| hypothetical protein PSYPI_01050 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 213

 Score = 67.3 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 58/204 (28%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              L+ L + + +  +      +       + Q    AL        
Sbjct: 12  MKDWWQRNGKPLLTGGLLALVVVLGWQFWHRYQASQSQGASMLYQQLLETALTPSGQADT 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +       + A   LK   D  A   +   A
Sbjct: 72  ARVAEISGKLKSEFGGTTYAQFGSLFVAKVAVDAGKLDDAAAELKPVADKPANDTLGEIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  ++  K+L    +          E+ G   ++ G+  +A   +++  
Sbjct: 132 RQRLARVLAAQNKTDDALKLLDG--DADKAFLASREELKGDLLVQLGRTDEAYVAYQKAK 189

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
              +    +    QM L ++   D
Sbjct: 190 SALSEDAAVGG-LQMKLDDLAKGD 212


>gi|146328662|ref|YP_001209429.1| hypothetical protein DNO_0518 [Dichelobacter nodosus VCS1703A]
 gi|146232132|gb|ABQ13110.1| conserved hypothetical protein [Dichelobacter nodosus VCS1703A]
          Length = 224

 Score = 66.9 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/207 (12%), Positives = 64/207 (30%), Gaps = 7/207 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     +  +    I++ L++      +      ++       +Q  E  +  +L  
Sbjct: 22  ELVKEWLRRHGVVIVTGIVIGLAMVGGMDWWKVHQRSQRQEQSFLLSQLTEAVDKKQLTV 81

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A   +  +    +     L+N+ +A + V       A  +  +      +   +   A  
Sbjct: 82  AEKHYAAMSQNRSV-QRDLANVLLARLYVENKQFDKAYPLLQQ--AQSSSDDLLAQNAQW 138

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
               + +    Y+     L  L    +   +   +I G   L   +++ A   +EE  K 
Sbjct: 139 ALVQVQLQQKDYDAALSTLDLLKN--SAYAKIVPQIQGDIYLLRDQLEPALKAYEESMKL 196

Query: 192 NNSPFGISTR--SQMILANIIASDQRN 216
              P         +  +A    + ++N
Sbjct: 197 QPLPLTQRRINALKAKMALTAPTTEKN 223


>gi|66044498|ref|YP_234339.1| hypothetical protein Psyr_1250 [Pseudomonas syringae pv. syringae
           B728a]
 gi|71737138|ref|YP_273580.1| hypothetical protein PSPPH_1322 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257487196|ref|ZP_05641237.1| hypothetical protein PsyrptA_28231 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289626151|ref|ZP_06459105.1| hypothetical protein PsyrpaN_13628 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649057|ref|ZP_06480400.1| hypothetical protein Psyrpa2_15127 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298486025|ref|ZP_07004099.1| putative membrane protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|302185743|ref|ZP_07262416.1| hypothetical protein Psyrps6_05338 [Pseudomonas syringae pv.
           syringae 642]
 gi|63255205|gb|AAY36301.1| conserved hypothetical protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|71557691|gb|AAZ36902.1| conserved hypothetical protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298159502|gb|EFI00549.1| putative membrane protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320322919|gb|EFW79009.1| hypothetical protein PsgB076_19710 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329958|gb|EFW85946.1| hypothetical protein PsgRace4_11956 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330869575|gb|EGH04284.1| hypothetical protein PSYAE_20478 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330874710|gb|EGH08859.1| hypothetical protein Pgy4_06724 [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330950785|gb|EGH51045.1| hypothetical protein PSYCIT7_05133 [Pseudomonas syringae Cit 7]
 gi|330969068|gb|EGH69134.1| hypothetical protein PSYAR_01052 [Pseudomonas syringae pv. aceris
           str. M302273PT]
 gi|330985016|gb|EGH83119.1| hypothetical protein PLA107_08326 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009188|gb|EGH89244.1| hypothetical protein PSYTB_05737 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 213

 Score = 66.9 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 58/204 (28%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              L+ L + + +  +      +       + Q    AL        
Sbjct: 12  MKDWWQRNGKPLLTGGLLALVVVLGWQFWHRYQASQSQGASMLYQQLLETALTPSGQADT 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +       + A   LK   D  A   +   A
Sbjct: 72  ARVAEISGKLKSEFGGTTYAQFGSLFVAKVAVDAGKLDDAAAELKTVADKPANDTLGEIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  ++  K+L    +          E+ G   ++ G+  +A   +++  
Sbjct: 132 RQRLARVLAAQNKTDDALKLLDG--DADKAFLASREELKGDLLVQLGRTDEAYAAYQKAK 189

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
              +    +    QM L ++   D
Sbjct: 190 SALSEDAAVGG-LQMKLDDLAKGD 212


>gi|157961135|ref|YP_001501169.1| tetratricopeptide repeat-containing protein [Shewanella pealeana
           ATCC 700345]
 gi|157846135|gb|ABV86634.1| tetratricopeptide TPR_4 [Shewanella pealeana ATCC 700345]
          Length = 206

 Score = 66.9 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/212 (16%), Positives = 74/212 (34%), Gaps = 6/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +  +      K     Y     +  ++ L     +  +      +     E+F QA
Sbjct: 1   MEIYSTEDQQVDAIKQFWKDYGTSIVVGAVVGLGGLFGWNYYSDYQVAQAEAASESF-QA 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   N+       ++         K Y  L  + +A   V  GD          V     
Sbjct: 60  LSSQNTADTAMLTAAENFAKQHGQKGYQSLLELLVAKSAVESGDLAKGEVTLKNVIA-TN 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              ++   AT++ A +  +   Y      L+++++P++      +E+ G   ++ G+ +K
Sbjct: 119 VDNSIVLIATMRLARVQAELGQYATAITTLEQITDPAS--KAQRDELKGDFLVRQGETEK 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           AK  ++    +  +        QM L N+  +
Sbjct: 177 AKVAYQTAVDNGGTMTS--PTLQMKLDNLNKA 206


>gi|330895890|gb|EGH28175.1| hypothetical protein PSYJA_03859 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 213

 Score = 66.9 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 58/204 (28%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              L+ L + + +  +      +       + Q    AL        
Sbjct: 12  MKGWWQRNGKPLLTGGLLALVVVLGWQFWHRYQASQSQGASMLYQQLLETALTPSGQADT 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +       + A   LK   D  A   +   A
Sbjct: 72  ARVAEISGKLKSEFGGTTYAQFGSLFVAKVAVDAGKLDDAAAELKPVADKPANDTLGEIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  ++  K+L    +          E+ G   ++ G+  +A   +++  
Sbjct: 132 RQRLARVLAAQNKTDDALKLLDG--DADKAFLASREELKGDLLVQLGRTDEAYAAYQKAK 189

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
              +    +    QM L ++   D
Sbjct: 190 SALSEDAAVGG-LQMKLDDLAKGD 212


>gi|315123114|ref|YP_004065120.1| TPR-like domain-containing protein [Pseudoalteromonas sp. SM9913]
 gi|315016874|gb|ADT70211.1| TPR-like domain-containing protein [Pseudoalteromonas sp. SM9913]
          Length = 206

 Score = 66.9 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/209 (12%), Positives = 62/209 (29%), Gaps = 10/209 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K           L +++ L     +  ++ +         + + + 
Sbjct: 1   MEIYSTEEQQAEAIKRFFRENGLSLALGVIVGLGGLYGWKAYNQNQITTAEQASDAYTKL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +E       D   S+   I    +  Y  L+    A   V       A E    + ++  
Sbjct: 61  VES-----DDVLASADAFISENKDTQYATLAAFVAAKEAVDAQKLDVANEKLSWIVSNVD 115

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  AT + A + +    Y++    L          +    E+ G    + G  ++
Sbjct: 116 -NAQLKAIATTRLARVQIAQQQYDDALTTLNS--PLPEAFNANIAELKGDIYTQQGNKEQ 172

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A+  ++                Q+ L ++
Sbjct: 173 ARVAYQAAVDAGGLTSN--PLLQIKLDDL 199


>gi|89095336|ref|ZP_01168254.1| hypothetical protein MED92_00600 [Oceanospirillum sp. MED92]
 gi|89080411|gb|EAR59665.1| hypothetical protein MED92_00600 [Oceanospirillum sp. MED92]
          Length = 218

 Score = 66.9 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/209 (12%), Positives = 61/209 (29%), Gaps = 12/209 (5%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL-------- 63
              K           L + + L+  + +  +      +       +   L+         
Sbjct: 12  QALKSWWDENGKSLFLGVAVALAAVLGWKGWQSQQAAQAENASVLYQNLLDAVVGALGPQ 71

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
            +  KL  A     ++  +            I + +       + A   L     +    
Sbjct: 72  LDDAKLATANHLNGQLKDEYEGSAYANYAAMIMARVAVDQKDLDKAVAELDYVLANQPTE 131

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           ++   ATL+ A I+    + ++   ++     P         E+ G   L  G    A+ 
Sbjct: 132 SMFILATLRKARIVASQGNVDQALNLVNG--APVGGYKATIEELKGDLYLAQGNTDAARK 189

Query: 184 IFEELAKDNNSPFGISTRSQMILANIIAS 212
            +++ ++   +  G      M L N+ A 
Sbjct: 190 AYQQASESAAA--GSRPLLDMKLNNLAAE 216


>gi|293610298|ref|ZP_06692599.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827530|gb|EFF85894.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 232

 Score = 66.9 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/205 (13%), Positives = 58/205 (28%), Gaps = 8/205 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK--- 68
              K     Y       IL+ L     +  +   +            Q ++  N++    
Sbjct: 10  DSLKSFAKKYGSAMISGILIALIAFFGWEYWQKRNLASSQTETAKVQQLMDEANASADNP 69

Query: 69  ---LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
                   S+ + +    + +    +   +A +   K D   A +   KV N  +    +
Sbjct: 70  NALTSVTASADKIVKDDIDSVQAIQTQFVLAKLAYEKQDYAAAEKALKKVENSKVKDEGL 129

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                L+ A   +  + Y+E  K L               E+ G   +    V  AK  +
Sbjct: 130 IQVVKLRLADAQLAQNKYDEALKTLSG--NVDPAFKATVEELRGDIFVAKKDVDSAKKAY 187

Query: 186 EELAKDNNSPFGISTRSQMILANII 210
           +                Q+ L ++ 
Sbjct: 188 QAAWDSLLERKQERQILQIKLESVG 212


>gi|332288523|ref|YP_004419375.1| hypothetical protein UMN179_00442 [Gallibacterium anatis UMN179]
 gi|330431419|gb|AEC16478.1| hypothetical protein UMN179_00442 [Gallibacterium anatis UMN179]
          Length = 206

 Score = 66.9 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/191 (12%), Positives = 56/191 (29%), Gaps = 2/191 (1%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
            +D      + K        +    +++ +     +  + G  + K +     F+Q +  
Sbjct: 5   TSDEQLQIEEIKQWWKENGKVIIAAVILAIVGVFGWRYWQGYQQGKIHQSSAEFSQIMAA 64

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
                   A +   + +  +         +   +      +    A   L+ A ++    
Sbjct: 65  TEQADAGKANAQLTQFVETNPSSAYSAFLLLEQAKKQIDANQWQHAADTLQKALNNAKDA 124

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+     L+ AS+      +E     L K+++           + G      G   +AK 
Sbjct: 125 ALISLIALRLASVQTQLKQFEPALATLGKVTDQ--AWQGRKAMLSGEIYNAMGNKAEAKK 182

Query: 184 IFEELAKDNNS 194
            FE      N 
Sbjct: 183 SFEAALTTANP 193


>gi|330807649|ref|YP_004352111.1| hypothetical protein PSEBR_a938 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375757|gb|AEA67107.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 213

 Score = 66.9 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 57/204 (27%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL----FNSNKL 69
            K              L+ L +   +  +      +       + Q LE           
Sbjct: 12  LKDWWTRNGKPLVTGGLLALVIVFGWQAYQKYQSNQSQGASVLYQQLLETTLTPDGKPDA 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+  +              + +       + A   LK   D  A   +   A
Sbjct: 72  ARVADLAGKLDKEFGGTAYAQYGRLFVAKVAVDSGKLDDAATELKGIVDKPANPTLGEVA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  E+  K+L    +          E+ G   ++ G+  +A   +++ A
Sbjct: 132 RQRLAQVLAAQNKAEDALKLLDG--DADKAFLATREELKGDLLVQLGRADEAHAAYQK-A 188

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
           K   S        Q+ L ++   D
Sbjct: 189 KAALSDEAAVGGLQIKLDDLAKGD 212


>gi|110834719|ref|YP_693578.1| hypothetical protein ABO_1858 [Alcanivorax borkumensis SK2]
 gi|110647830|emb|CAL17306.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 207

 Score = 66.9 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/208 (15%), Positives = 73/208 (35%), Gaps = 5/208 (2%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           D        K           + +++ ++  I +  +     ++     +++   +E   
Sbjct: 3   DEEEQAELLKEWWQKNGTATIITVVLAVAALIGWREWQDHQGEQSAEASKHYQVMVEALT 62

Query: 66  SNKLDDA--RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
           + ++D+A      E +                 + L  +     +A   L+   DD A  
Sbjct: 63  AQEVDEATVNQKAEALKENFPGSAYANYANLAQARLAVQAGDYESAASLLQSVVDDGATD 122

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           A+ Y A L+   +L+   +Y++ +  L   +   +  +  A E+ G  A   G  Q A  
Sbjct: 123 ALIYTARLRLVRVLLQQEAYDKAAAELD--NSFPSAFNGMALELRGDLAKARGDHQAATD 180

Query: 184 IFEELAKDNNSPFGISTRSQMILANIIA 211
            + +  +      G   R QM L ++ +
Sbjct: 181 AYTQALETLQ-DNGEKDRVQMKLDDLKS 207


>gi|262374930|ref|ZP_06068164.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262309943|gb|EEY91072.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 232

 Score = 66.6 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 30/203 (14%), Positives = 65/203 (32%), Gaps = 6/203 (2%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y       IL+ L     +  +   +  +  +      Q ++   ++K D 
Sbjct: 11  ESLKSFTKKYGSSMITGILIALIAFFGWEYWQKKNLAESQMHTAKVQQLMDDAQASKGDG 70

Query: 72  ARSSFEK----ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRY 127
                E     +    +      + + +A +   K D   A +   KV N  +    +  
Sbjct: 71  FAKLSEAADKIVKEAPDSAQAIQTQLVMAKLAYDKEDYAAAEKALQKVENSKVDDKGLVQ 130

Query: 128 AATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
              L+ A   +    Y+   K L+ ++EP       A+E  G   +    ++ AK +++ 
Sbjct: 131 VVKLRLAYAQLAQKKYDAALKTLEAVTEP--AFKATADEARGDIYVAKNDIENAKKVYQS 188

Query: 188 LAKDNNSPFGISTRSQMILANII 210
                          Q+ L ++ 
Sbjct: 189 AWDALIERKEERQILQIKLESVG 211


>gi|229592439|ref|YP_002874558.1| hypothetical protein PFLU5055 [Pseudomonas fluorescens SBW25]
 gi|229364305|emb|CAY52043.1| putative membrane protein [Pseudomonas fluorescens SBW25]
          Length = 213

 Score = 66.6 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/215 (13%), Positives = 63/215 (29%), Gaps = 8/215 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
           S+ D           +   K +    +L ++ +  W   +      +       + Q LE
Sbjct: 2   SSTDDEQLAEFKDWWQRNGKPLVTGGLLALVVVFGW-QAWTKYQANQSQGASILYQQLLE 60

Query: 63  LF----NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
                              K+ ++              + +       + A   LK   D
Sbjct: 61  TTLTPDGKPDPAQVADLAGKLKNEFGGSTYAQYGSLFVAKVAVDTGKLDDAAAELKAIAD 120

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKV 178
                 +   A  + A +L   +  +E  K+L    +          E+ G   ++ G+ 
Sbjct: 121 KPTNPTLGEIARQRLAQVLAAQNKADEALKLLDG--DADKAFVATREELKGDLLVQLGRT 178

Query: 179 QKAKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
            +A   +++ AK   S        Q+ L ++   D
Sbjct: 179 DEANAAYQK-AKAALSDEAAVGGLQIKLDDLAKGD 212


>gi|325124480|gb|ADY84003.1| hypothetical protein BDGL_003417 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 232

 Score = 66.6 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/205 (13%), Positives = 58/205 (28%), Gaps = 8/205 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK--- 68
              K     Y       IL+ L     +  +   +            Q ++  N++    
Sbjct: 10  DSLKSFAKKYGSAMISGILIALIAFFGWEYWQKRNLASSQTETAKVQQLMDEANASADNP 69

Query: 69  ---LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
                   S+ + +    N +    +   +A +   K D   A +   KV N  +    +
Sbjct: 70  NALTSVTASADKIVKDDINSVQAIQTQFVLAKLAYEKQDYAAAEKALKKVENSKVKDEGL 129

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                L+ A   +  + Y+E  K L               E+ G   +    +  AK  +
Sbjct: 130 IQVVKLRLADAQLAQNKYDEALKTLSG--NVDPAFKATVEELRGDIFVAKKDIDSAKKAY 187

Query: 186 EELAKDNNSPFGISTRSQMILANII 210
           +                Q+ L ++ 
Sbjct: 188 QAAWDSLLERKQERQILQIKLESVG 212


>gi|254514001|ref|ZP_05126062.1| Tetratricopeptide repeat family protein [gamma proteobacterium
           NOR5-3]
 gi|219676244|gb|EED32609.1| Tetratricopeptide repeat family protein [gamma proteobacterium
           NOR5-3]
          Length = 222

 Score = 66.6 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 28/216 (12%), Positives = 57/216 (26%), Gaps = 9/216 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYK-WIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ 59
           MES           K             + L +     W                  + Q
Sbjct: 1   MESYRSEEEQVEALKRWWKENGRSTLIGIALALGLGFGWQAWQKTQQL-AAENASNLYQQ 59

Query: 60  ALELFNSNKLDD----ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
            L++ ++          + + +        +Y   + M++A + V  G  + A +     
Sbjct: 60  MLQVLSTQDEQAGTVGRQLATQLKEQHRGTVYAQFAAMHLARLAVNDGQLQAAEQELRWT 119

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
            +       ++  A L+ A +L      +E   +   L   +           G   L  
Sbjct: 120 LSMASGNDDIQQVAQLRLARVLASLEKPDEALDL---LQGANPDYQASYAIARGDIFLSQ 176

Query: 176 GKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           G   +A   +E           +    Q  L  + A
Sbjct: 177 GLEAEAFAAYESALATMEEGAPVPQTLQDKLEFLGA 212


>gi|330894496|gb|EGH27157.1| hypothetical protein PSYMO_38995 [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 213

 Score = 66.2 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 58/204 (28%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              L+ L + + +  +      +       + Q    AL        
Sbjct: 12  MKDWWQRNGKPLLTGGLLALVVVLGWQFWHRYQAGQSQGASMLYQQLLETALTPSGQADT 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +       + A   LK   D  A   +   A
Sbjct: 72  ARVAEISGKLKSEFGGTTYAQFGSLFVAKVAVDAGKLDDAAAELKTVADKPANDTLGEIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  ++  K+L    +          E+ G   ++ G+  +A   +++  
Sbjct: 132 RQRLARVLAAQNKTDDALKLLDG--DADKAFLASREELKGDLLVQLGRTDEAYAAYQKAK 189

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
              +    +    QM L ++   D
Sbjct: 190 SALSEDAAVGG-LQMKLDDLAKGD 212


>gi|119897220|ref|YP_932433.1| hypothetical protein azo0929 [Azoarcus sp. BH72]
 gi|119669633|emb|CAL93546.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 214

 Score = 66.2 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 27/204 (13%), Positives = 69/204 (33%), Gaps = 6/204 (2%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K     Y  +   L +     ++ +  +     ++    G  +    +         
Sbjct: 13  SELKAWWARYGKLVTALAVAAAVASVAWQGWRWYQNRQAAEAGGLYFAVQQAVTQQDAQK 72

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           AR    +++ Q            +++ L       + A   L+ A       ++R  A L
Sbjct: 73  ARELTGRLIDQFGGTVYAQLGALVSAGLQFSKGDLDNARAPLEWAAGQGKDESLRDLARL 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A++L+   ++++    LQ+  EP         ++ G +    GK   A+T ++     
Sbjct: 133 RLAAVLLQQGAHDQALAQLQR--EPGKAYRARFADLRGDALAAQGKAADARTAYQAAITA 190

Query: 192 NNSPFG----ISTRSQMILANIIA 211
             +       +    ++ L ++ A
Sbjct: 191 LEAEGDEAAMLREVVRVKLESLEA 214


>gi|262371082|ref|ZP_06064404.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262313968|gb|EEY95013.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 232

 Score = 66.2 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/203 (12%), Positives = 62/203 (30%), Gaps = 6/203 (2%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y       IL+ L     +  +      +  +      Q ++   + + D 
Sbjct: 11  DSLKSFTKKYGSAIISGILIALIAFFGWQYWQKKTLAENQMNTAKVQQLMDEARATQGDA 70

Query: 72  ----ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRY 127
               + ++ + +    +      + + +A +   K D  +A +   KV N  +    +  
Sbjct: 71  FTALSATADKIVKEAPDSAQAIQTQLLMAKLAYDKADYASAEKALKKVENSKVDDDGLVQ 130

Query: 128 AATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
              L+ A   +    +++  K               A+E LG   +    ++ AK  ++ 
Sbjct: 131 IVKLRLAYAQLAQKKFDDAIK--NLALVKDPAFKATADEALGDVYVAKNDIENAKKAYQS 188

Query: 188 LAKDNNSPFGISTRSQMILANII 210
                          Q+ L ++ 
Sbjct: 189 AWDQLVERKQERQILQIKLESVG 211


>gi|24374821|ref|NP_718864.1| hypothetical protein SO_3310 [Shewanella oneidensis MR-1]
 gi|24349507|gb|AAN56308.1|AE015769_4 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 206

 Score = 66.2 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 36/194 (18%), Positives = 68/194 (35%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +     +K     + F QA
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGISIGIGAVVGLGGLYGWNTYSDMKIEKAEEASQAF-QA 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   +S+++       E   + D K Y  L ++ +A   V   D   A E   KV     
Sbjct: 60  LTTKSSDEVAMLAGVAEFSKNYDQKGYQALLDLIVAKTAVEAKDFPKAEEALKKVIAAKP 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   ATL+ A I  +    +     L+++++          E+ G   ++ G+  K
Sbjct: 120 G-AGLDTIATLRLARIQAEQGQVDTALATLEQVTDK--AFLAQREELKGDFFVRQGQADK 176

Query: 181 AKTIFEELAKDNNS 194
           AKT ++    +   
Sbjct: 177 AKTAYQAAMDNGGV 190


>gi|187478832|ref|YP_786856.1| membrane protein [Bordetella avium 197N]
 gi|115423418|emb|CAJ49952.1| putative membrane protein [Bordetella avium 197N]
          Length = 212

 Score = 66.2 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/179 (12%), Positives = 56/179 (31%), Gaps = 3/179 (1%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
                +  +      +     E    A  L   +     +++   +             +
Sbjct: 37  GGWSGWKGYQAYRANQAMGYFEALEDAARLGGPDSAARIKAAAATLREDYPHTGYAGRGI 96

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
            IA+  + +    + A   L+         A++  A L+ A +L+D   Y+       +L
Sbjct: 97  LIAAQALLEQKDIDGARQQLEWLAAQSKQPALQPVARLRLAGLLLDQKHYDAALA---QL 153

Query: 154 SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
             P  P      +  G      GK  +A+  +++      +   ++   Q+ L  +  +
Sbjct: 154 DNPPAPFAALFADRRGDILAAQGKRDEARAAWQQAIDGLGTGNPLTQVVQLKLDALTGA 212


>gi|184156833|ref|YP_001845172.1| hypothetical protein ACICU_00513 [Acinetobacter baumannii ACICU]
 gi|213155965|ref|YP_002318010.1| hypothetical protein AB57_0606 [Acinetobacter baumannii AB0057]
 gi|215484682|ref|YP_002326917.1| UPF0070 protein [Acinetobacter baumannii AB307-0294]
 gi|239500763|ref|ZP_04660073.1| hypothetical protein AbauAB_00480 [Acinetobacter baumannii AB900]
 gi|301346484|ref|ZP_07227225.1| hypothetical protein AbauAB0_09569 [Acinetobacter baumannii AB056]
 gi|301509974|ref|ZP_07235211.1| hypothetical protein AbauAB05_00312 [Acinetobacter baumannii AB058]
 gi|301594211|ref|ZP_07239219.1| hypothetical protein AbauAB059_00330 [Acinetobacter baumannii
           AB059]
 gi|183208427|gb|ACC55825.1| uncharacterized protein conserved in bacteria [Acinetobacter
           baumannii ACICU]
 gi|193076312|gb|ABO10957.2| hypothetical protein A1S_0504 [Acinetobacter baumannii ATCC 17978]
 gi|213055125|gb|ACJ40027.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213987482|gb|ACJ57781.1| UPF0070 protein [Acinetobacter baumannii AB307-0294]
 gi|322506725|gb|ADX02179.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
 gi|323516599|gb|ADX90980.1| hypothetical protein ABTW07_0543 [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 232

 Score = 66.2 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 58/205 (28%), Gaps = 8/205 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK--- 68
              K     Y       IL+ L     +  +   +            Q ++  N+     
Sbjct: 10  DSLKSFAKKYGSAMISGILIALIAFFGWEYWQKRNLATSQTETAKVQQLMDEANATADNP 69

Query: 69  ---LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
                   S+ + +    + +    +   +A +   K D   A +   KV N  +    +
Sbjct: 70  NALASITASADKIVKDDIDSVQAIQTQFVLAKLAYEKQDYAAAEKALKKVENSKVKDEGL 129

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                L+ A   +  + Y+E  K L    +          E+ G   +    +  AK  +
Sbjct: 130 IQVVKLRLADAQLAQNKYDEALKTLSG--DVDPAFKATVEELRGDIFVAKKDIDSAKKAY 187

Query: 186 EELAKDNNSPFGISTRSQMILANII 210
           +                Q+ L ++ 
Sbjct: 188 QAAWDSLLERKQERQILQIKLESVG 212


>gi|148556029|ref|YP_001263611.1| hypothetical protein Swit_3124 [Sphingomonas wittichii RW1]
 gi|148501219|gb|ABQ69473.1| Uncharacterized protein [Sphingomonas wittichii RW1]
          Length = 235

 Score = 66.2 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 37/206 (17%), Positives = 91/206 (44%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D    + + +     Y  IA + +L++L     F  +  + EKK    GE  +  +   
Sbjct: 15  VDDELRRDQLQKMVRHYGRIALVALLLLLVAFAGFLYWRQASEKKAEAQGEQMSALIADV 74

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
            +++  +A    + ++++    Y   + +  A++   +GDTK+A  I+  +A D+ A   
Sbjct: 75  QASRKAEAAKKIDTLVAEGGDGYRIAALLTKATLAADRGDTKSAIGIYAGIAADEKAAQP 134

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  + ++   +  D  + +++   L+ L+   N     A E+  ++ ++  +  +A  +
Sbjct: 135 YRDVSLIRQTLLEYDGLTPQQVIDRLKPLAVEGNAFFGTAGEMTAVAMIQANRGAEAGRL 194

Query: 185 FEELAKDNNSPFGISTRSQMILANII 210
              +A+D   P  + TR+  +  ++ 
Sbjct: 195 LAAVARDKTVPDTLRTRAARLATSLG 220


>gi|113460552|ref|YP_718616.1| hypothetical protein HS_0406 [Haemophilus somnus 129PT]
 gi|112822595|gb|ABI24684.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 203

 Score = 65.8 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/178 (15%), Positives = 60/178 (33%), Gaps = 5/178 (2%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K  YK I  +++L    +  W   +      KK  +   + Q +    +  + +A+   
Sbjct: 18  WKENYKSIIVIVVLAFSGVFGWR-YWQDYQTTKKQTLSAQYDQLISSAENQSIYNAQLD- 75

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
             +       Y   + +  A + V++ +   A E   +   +    + +   A  + A++
Sbjct: 76  RFVQENGETTYAVFALLDKAKLEVSQQNFVQAEETLKQAIVNTSDDILMSITAI-RLATV 134

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
                 ++E    L ++             + G   L  G  + AK  FE+      S
Sbjct: 135 QYQLQKFDEALASLNQVK--GQSWDVSKLLLSGDIQLAKGNKEIAKDNFEQALTKATS 190


>gi|297568699|ref|YP_003690043.1| hypothetical protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296924614|gb|ADH85424.1| Tetratricopeptide TPR_4 [Desulfurivibrio alkaliphilus AHT2]
          Length = 222

 Score = 65.8 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 26/189 (13%), Positives = 72/189 (38%), Gaps = 6/189 (3%)

Query: 19  CCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEK 78
             Y+ I   + ++++++  W          +     +  + A+++           + E+
Sbjct: 38  VWYRHILAAIGIVVVAILTWSLSQQ-YVTSRAEQSSQQLSVAMQI---ADPAARAQALEE 93

Query: 79  ILSQDNKLYNP-LSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
           + S   +      S + +A +    GD + AA+ + ++        A R    L  A +L
Sbjct: 94  VASSYRRTGAGIWSRIELAHLARDAGDLEGAAQAYQELLGTISRRDARRPMVQLSLAQVL 153

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
            +    E+  +  ++L+E       +     G    + G  + A+  + ++ +  N+P  
Sbjct: 154 SELGQDEQALRYYRELAETPG-FEAWGLLGTGDVMARRGDTEAAREKYRQVTEKTNAPLL 212

Query: 198 ISTRSQMIL 206
           +  +++  L
Sbjct: 213 VLEQAESRL 221


>gi|40062767|gb|AAR37661.1| conserved hypothetical protein [uncultured marine bacterium 439]
          Length = 205

 Score = 65.8 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 35/208 (16%), Positives = 73/208 (35%), Gaps = 14/208 (6%)

Query: 7   ANSYKGKCKMGKCCY----KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
            N+ + + +  K  +    K I    ++ +  +  W    D   ++  N      + A +
Sbjct: 8   DNTEEEQVEQIKKWWNSNGKQIIAGAVIGLAGVWGWNTYSDYQDKQSLNARSFYLSYASD 67

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             N    D   + F       +  Y+  + + +A  L   G    A  +   + N+    
Sbjct: 68  SNNLGAYDKLTTDFS------SSSYSNQAILLMAKYLFDAGSYSQALSVIKPLVNNPS-- 119

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   A L+ ASI +    ++E   IL+  SE           +LG   L  G   +A+
Sbjct: 120 SIIATTAVLRTASIHLQLGQHDEALSILEGHSEDG--FSGLNYNLLGDIYLNLGNRTEAQ 177

Query: 183 TIFEELAKDNNSPFGISTRSQMILANII 210
             +     + +    +S   Q+ L ++ 
Sbjct: 178 KYYSLAIDNVSENSNLSQLIQIKLDDLN 205


>gi|330957529|gb|EGH57789.1| hypothetical protein PMA4326_02984 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 213

 Score = 65.8 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 59/204 (28%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              L+ L + + +  +      +       + Q    AL        
Sbjct: 12  MKDWWQRNGKPLLTGGLLALVVVLGWQFWHRHQASQSQGASMLYQQLLETALTPSGQADT 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +       + A   LK   D  A   +   A
Sbjct: 72  ARVAELSGKLKSEFGGTIYAQFGSLFVAKVAVDAGKLDDAAAELKTVTDKPANDTLAEIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  ++  K+L    +          E+ G   ++ G+  +A   +++ A
Sbjct: 132 RQRLARVLAAQNKTDDALKLLDG--DADKAFLASREELKGDLLVQLGRTDEAHAAYQK-A 188

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
           K   S        QM L ++   D
Sbjct: 189 KSALSEEAAVGGLQMKLDDLAKGD 212


>gi|254499339|ref|ZP_05112010.1| transmembrane protein [Legionella drancourtii LLAP12]
 gi|254351444|gb|EET10308.1| transmembrane protein [Legionella drancourtii LLAP12]
          Length = 220

 Score = 65.8 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 67/180 (37%), Gaps = 2/180 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y  +    + ++L     +       +K        + Q +   +++ +  
Sbjct: 8   ESIKKWWKRYGNVVMFAVSLVLLAVAGYRYLTWHQDKLTQQASIAYEQMMLAMSNHNVKA 67

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            +S   +++   +K           + +    +  + A+  L++  D+   L+++  A +
Sbjct: 68  VKSYANELIKDHDKTVYADVAHMTLAKIYISKNKLDKAQAELRIVADNSKMLSLKQIAKI 127

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A IL    SY      L ++ + +       NE+ G      G+ Q+A + +++ + +
Sbjct: 128 RIARILTAEKSYANALTELSRIEDTT--YLPVINELKGDIYGATGQYQEAMSSYKKASDE 185


>gi|262280928|ref|ZP_06058711.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257828|gb|EEY76563.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 232

 Score = 65.8 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 28/205 (13%), Positives = 59/205 (28%), Gaps = 8/205 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK--- 68
              K     Y       IL+ L     +  +   +     +      Q ++  N++    
Sbjct: 10  DSLKSFAKKYGSAMISGILIALIAFFGWTYWQKKNLATSQVETAKVQQLMDEANASADNP 69

Query: 69  ---LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
                   S+ + +    + +    +   +A +   K D   A +   KV N  +    +
Sbjct: 70  NALSSVTASADKIVKDDIDSVQAIQTQFVLAKLAYEKQDYAAAEKALKKVENSKVKDEGL 129

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                L+ A   +  + Y+E  K L               E+ G   +    V  AK  +
Sbjct: 130 IQVVKLRLADAQLAQNKYDEALKTLSG--NVDPAFKATVEELRGDIFVAKKDVDSAKKAY 187

Query: 186 EELAKDNNSPFGISTRSQMILANII 210
           +                Q+ L ++ 
Sbjct: 188 QAAWNSLLERKQERQILQIKLESVG 212


>gi|84517348|ref|ZP_01004702.1| hypothetical protein SKA53_05930 [Loktanella vestfoldensis SKA53]
 gi|84508828|gb|EAQ05291.1| hypothetical protein SKA53_05930 [Loktanella vestfoldensis SKA53]
          Length = 235

 Score = 65.8 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 40/201 (19%), Positives = 69/201 (34%), Gaps = 7/201 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
            + K       Y W+A L++L I+    W           ++      A    L    + 
Sbjct: 32  RRDKLFGYLRRYGWVAVLIVLGIVGGTAWNEY-----RSAQDRAAAQAAGDALLAALAEN 86

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
           D+A  +              ++ +  AS     G  + AA     +A +       R  A
Sbjct: 87  DEAARATAMAAVSAAGNAAVITALLTASTQQQAGQAEAAAASLSALATNADTTAIYRDLA 146

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            ++AA + V           L  L++P  P    A E +    L+ G    A  I  ++A
Sbjct: 147 AIKAAMLPV--GDMPARLAALAPLAQPGQPFRLLALEQMAYLTLETGDQTGAVAILRQIA 204

Query: 190 KDNNSPFGISTRSQMILANII 210
           +D     G+S R Q +L  + 
Sbjct: 205 EDAAVTRGLSDRVQTLLIALG 225


>gi|323143786|ref|ZP_08078454.1| tetratricopeptide repeat protein [Succinatimonas hippei YIT 12066]
 gi|322416499|gb|EFY07165.1| tetratricopeptide repeat protein [Succinatimonas hippei YIT 12066]
          Length = 223

 Score = 65.8 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 69/216 (31%), Gaps = 6/216 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+   D +  +   K     Y     L +++ L   I F  +      K         Q 
Sbjct: 1   MDVLTDDHEREEVVKKWWHEYWKPIALGVVIALGGLIGFRQYQSYELNKSQEQALAVYQL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E  N   LD    + + I   DN     ++       +     T  AA +    A    
Sbjct: 61  QEQLNEKGLDVIADAQKFIAENDNIYGALVALDVATLQMTEDKFTDAAATLEQATAKGGD 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++ A TL  A +      Y++       ++   +       E+LG   +  G  QK
Sbjct: 121 L---LKPAITLTLARLQAQNQEYDKAVSTANSVNS--DAYALEKFEVLGDIYMASGDRQK 175

Query: 181 AKTIFEELAKDNNSPF-GISTRSQMILANIIASDQR 215
           A   ++   +   S    I+   QM   N+IA+   
Sbjct: 176 AHDAYKNAIELCKSKKLPINGILQMKFDNLIAAGDT 211


>gi|113969574|ref|YP_733367.1| hypothetical protein Shewmr4_1230 [Shewanella sp. MR-4]
 gi|114046807|ref|YP_737357.1| hypothetical protein Shewmr7_1301 [Shewanella sp. MR-7]
 gi|113884258|gb|ABI38310.1| conserved hypothetical protein [Shewanella sp. MR-4]
 gi|113888249|gb|ABI42300.1| conserved hypothetical protein [Shewanella sp. MR-7]
          Length = 206

 Score = 65.8 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 63/194 (32%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      K     + F Q 
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGTSIVIGAVVGLGGLYGWNYYSDMKIVKAEEASQAF-QT 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   +S++        E   + D K Y  L ++ +A   V   D   A E   KV     
Sbjct: 60  LTTKSSDEAAMLAGVAEFSKNHDQKGYQALLDLIVAKTAVEAKDFPKAEEALKKVIA-AK 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   ATL+ A I  +          L ++++          E+ G   ++ G+  K
Sbjct: 119 PGAGLDTVATLRLARIQAEQGQIGTALATLDQVTDK--AFLAQREELKGDFFVRQGEADK 176

Query: 181 AKTIFEELAKDNNS 194
           AKT ++    +   
Sbjct: 177 AKTAYQAAMDNGGV 190


>gi|149375009|ref|ZP_01892782.1| hypothetical protein MDG893_08125 [Marinobacter algicola DG893]
 gi|149360898|gb|EDM49349.1| hypothetical protein MDG893_08125 [Marinobacter algicola DG893]
          Length = 218

 Score = 65.8 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 25/210 (11%), Positives = 65/210 (30%), Gaps = 9/210 (4%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF----NSN 67
              K           + +   L++   +  +     +++      FA+ +  +    + N
Sbjct: 12  QAIKDWWKKNGSSLLIGVGAALAIVFGWQAWQNHQMQQRTEAASQFAELINAYSDETDEN 71

Query: 68  KLDDARSSFEKILSQDNKLYNPLSNMYI--ASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           + D      E +  + +     +  M +     ++ +GD + A E             A+
Sbjct: 72  RADTVAYVAENLREEYSDSAFAIYGMLMLARQQVMDQGDPEGAIESLTWAQEKAGESGAL 131

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                 + A        YE+    ++      +       E+ G   L  G  + A+  +
Sbjct: 132 AMVIRNRLARAQFAAEQYEDALATIEGTGNTGS-FGAIFTELKGDILLAQGNREGAREAY 190

Query: 186 EELAKDNNSPFGISTRSQMILANIIASDQR 215
               + N    G S   ++ L+++   +  
Sbjct: 191 LAAREMNQ--QGRSGILELKLSDLGVEEGA 218


>gi|54297455|ref|YP_123824.1| hypothetical protein lpp1500 [Legionella pneumophila str. Paris]
 gi|53751240|emb|CAH12651.1| hypothetical protein lpp1500 [Legionella pneumophila str. Paris]
          Length = 224

 Score = 65.8 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/184 (13%), Positives = 57/184 (30%), Gaps = 2/184 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y  +  + + ++L +   +   +  ++K K      +   +  F++  +  
Sbjct: 12  EIIKKWWKRYGNMITIFLSIVLLIIAGYRYMNWHNDKIKQQASIAYENMMIAFSNQNIKS 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            RS   +++   N            + +    +    A   LK    +     +R  A +
Sbjct: 72  VRSYANELIKNYNHTVYADIAHMTLAKIYVSKNKLEQARNELKAVASESQMTPLRQIAKI 131

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L    +Y      L  +           NE+ G      G+ Q A   +     +
Sbjct: 132 RIARLLAADKAYTNALNELSAV--EDEAYLPVINELKGDIYSAKGQYQDAMNAYRLAIDE 189

Query: 192 NNSP 195
             + 
Sbjct: 190 VRTN 193


>gi|119505387|ref|ZP_01627461.1| hypothetical protein MGP2080_14264 [marine gamma proteobacterium
           HTCC2080]
 gi|119458842|gb|EAW39943.1| hypothetical protein MGP2080_14264 [marine gamma proteobacterium
           HTCC2080]
          Length = 221

 Score = 65.8 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 28/224 (12%), Positives = 76/224 (33%), Gaps = 11/224 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGE---NF 57
           M  + + +      K             +++ ++  + +  + G   ++  +  +     
Sbjct: 1   MADHLEDDEQVEALKRWWDENGKSTMAAVVLAVAGTVGWQQYQGWSSQQAELASDTWGAI 60

Query: 58  AQALELFNSNKLDDARSSFEKILSQDNKL-YNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
             AL+  +    +D R+    +    ++  Y   + + +A++ V +G+   A        
Sbjct: 61  EVALQSGDDRSTEDVRALAGALKDDFSRTVYARFAALQLAALAVEEGNLDAAESELRWAL 120

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
             + A   +     L+ A +L D        +I   L+              G   +  G
Sbjct: 121 AKEDANSELGQLIQLRLARVLADKGDTATALEI---LNSGMGAYPAAYATAKGDIYVSEG 177

Query: 177 KVQKAKTIFEE----LAKDNNSPFGISTRSQMILANIIASDQRN 216
           +  +A   + +    L    N P  + T+   I + + +S++ +
Sbjct: 178 RHAEALGAYRDARAVLLALGNPPGILDTKITSIESRLASSEESS 221


>gi|325577798|ref|ZP_08148073.1| chaperone HscA [Haemophilus parainfluenzae ATCC 33392]
 gi|325160543|gb|EGC72669.1| chaperone HscA [Haemophilus parainfluenzae ATCC 33392]
          Length = 204

 Score = 65.4 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 60/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M    +      + K              ++ +   + +  +      +       +   
Sbjct: 1   MAYTIEEEQELNQLKEWWKDNGKTIIAAFILGVGGMLGWRYWQSYQANQIMQASAEYDAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   N +         E + + D   Y   S +  A   VAK D  +A     +      
Sbjct: 61  VYTTNKDAAAQQAKMAEFVKAHDKTSYAVFSLLDEAKGFVAKQDYASAENSLKQAIAQ-S 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   A L+ +++      ++     L ++           + + G   +  G V  
Sbjct: 120 QDDILTSLAALRLSAVQFQQGQFDAALASLNQVKSQG--FSARKDLLAGDIQIAKGDVNG 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE   K  N        +QM L N+
Sbjct: 178 AKASFENAQKSGN--PLEKQMAQMKLNNL 204


>gi|269140143|ref|YP_003296844.1| hypothetical protein ETAE_2800 [Edwardsiella tarda EIB202]
 gi|267985804|gb|ACY85633.1| hypothetical protein ETAE_2800 [Edwardsiella tarda EIB202]
 gi|304559977|gb|ADM42641.1| putative membrane protein [Edwardsiella tarda FL6-60]
          Length = 206

 Score = 65.4 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 77/211 (36%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +  N      +     Y     + +++ +   + +  + G  +       +++  A
Sbjct: 1   MEVYSTENEQVDAIRHFFQEYGKTLVVGVVIGVGALLGWRYWVGHQQANMAQASQSYQLA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E  +  K D    S E  + ++   Y  L+ + +A   V K D    A+  L  A    
Sbjct: 61  SEALSGGKQDGVALS-EAFIKENGNNYGVLAALQLAQYEVEKSDFAK-AQTQLVWAAGQA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  + L+ A + +  +  +   K L  ++         A ++ G   LK G  + 
Sbjct: 119 KDENLKSLSDLRLARVQLQENQLDAALKTLDGVTAKG--WQPLAQDVRGDVLLKKGDAKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +     ++   +    +M L N+ +
Sbjct: 177 AREAYSKGLA-ESASQSLQALLRMKLNNLSS 206


>gi|325134014|gb|EGC56669.1| tetratricopeptide repeat protein [Neisseria meningitidis M13399]
 gi|325144120|gb|EGC66427.1| tetratricopeptide repeat protein [Neisseria meningitidis
           M01-240013]
          Length = 209

 Score = 65.4 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 28/193 (14%), Positives = 56/193 (29%), Gaps = 2/193 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K   KW+  +LIL  L    +    + +  + +           +  N     +  +  
Sbjct: 18  WKTTGKWLFAVLILAALGYLGYTVYQNRAASQNQEAAAVLANIVEKAQNKAPQSEINAEL 77

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
            K+        +      +A+         + AE  LK    +     ++  A  +   +
Sbjct: 78  TKLQQSYPHSISAAQATLMAAATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVV 137

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           L+    Y+     L    E          E  G      GK Q+A   + +  +      
Sbjct: 138 LLQQKKYDAALAALDTPVEAD--FAPLLMETKGDVYAAQGKSQEALKNYGQALEKMPQDS 195

Query: 197 GISTRSQMILANI 209
                 QM L ++
Sbjct: 196 VGRELVQMKLDSL 208


>gi|120554057|ref|YP_958408.1| hypothetical protein Maqu_1129 [Marinobacter aquaeolei VT8]
 gi|120323906|gb|ABM18221.1| conserved hypothetical protein [Marinobacter aquaeolei VT8]
          Length = 217

 Score = 65.4 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 28/209 (13%), Positives = 59/209 (28%), Gaps = 8/209 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K           + I   L++   +  +     +++      FA  L  F+S   + 
Sbjct: 12  QAIKDWWKNNGSSLLIGIGAALAIVFGWQAWQNHQAQQRAEAANQFANLLNAFSSADDES 71

Query: 72  AR---SSFEKILSQDNKLYNPLSNMY--IASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
           A       E +  +       +          +V   D   A E             A+ 
Sbjct: 72  ADTVGFVAETLRDEHGDSAYAIYGNLVLARQQMVEGEDPAAAVESLNWALEKSAGHPALE 131

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
                + A        ++     L   +  ++      +E+ G   L  G    A+  + 
Sbjct: 132 LVIRNRLARAQFAAGEHDAALATLDN-AADADAFAAIFSELKGDVLLAKGDRDGAREAY- 189

Query: 187 ELAKDNNSPFGISTRSQMILANIIASDQR 215
            LA    S  G S   ++ L+++   +  
Sbjct: 190 -LAAREQSQQGRSGVLELKLSDLGVGEDA 217


>gi|117926863|ref|YP_867480.1| hypothetical protein Mmc1_3589 [Magnetococcus sp. MC-1]
 gi|117610619|gb|ABK46074.1| Tetratricopeptide TPR_2 repeat protein [Magnetococcus sp. MC-1]
          Length = 235

 Score = 65.4 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 36/217 (16%), Positives = 74/217 (34%), Gaps = 6/217 (2%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
              D    + +       YK       + + +    F      +  +     + + QALE
Sbjct: 13  QEVDEQLAQDRLHKLWENYKIWIIGSFIGLFAGLAIFVGVRDYYRAQDQDASDRYIQALE 72

Query: 63  LFNSNKLDDARSSFEKIL-SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
             + ++L  A  + + +        Y  LS++  A +L  +GD   A     ++     A
Sbjct: 73  ALDKDQLKVAAEALKGLQTKHGEHGYGLLSHLSEAQMLAKQGDFDGAVASLDRLITLAKA 132

Query: 122 -PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+   A + AA +L         + +        +     A E+ G+ A   G  + 
Sbjct: 133 GQPAMADLARINAAYLLSKQPQ---RAMVYLDAMRDPSAYSAHAYELRGVLAQAAGDNKL 189

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
           A + +++  +  N P  +S R    +  +   D   K
Sbjct: 190 ALSHYQKAMQ-FNPPNTLSQRLMEHMVRMGGMDAVRK 225


>gi|262371652|ref|ZP_06064931.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262311677|gb|EEY92762.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 232

 Score = 65.4 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 65/205 (31%), Gaps = 8/205 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNS----- 66
              K     Y       IL+ L     +  +   +  +         + ++   +     
Sbjct: 10  DSLKSFAKKYGSAMISGILIALIAFFGWEYWQKKNLAESQNQTAKVQKLMDEAKAVAGQP 69

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMY-IASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           N       + +KI+  D      +   + +A +   K D   A +   KV N  +    +
Sbjct: 70  NAFATVSEAADKIVKDDADSVQAIQTQFILAKLAYEKQDYAAAEKALKKVENSKVKDAGL 129

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                ++ A   +    Y+E  K L  +SEP        +E+ G   +    V+ A+  +
Sbjct: 130 MQIVKIRLADSQLAQKKYDEALKTLSNVSEP--AFKATVDELRGDIYVAKKDVESARKAY 187

Query: 186 EELAKDNNSPFGISTRSQMILANII 210
           +    +           Q+ L ++ 
Sbjct: 188 QSAWNNVLERKQERQLLQIKLESVG 212


>gi|169634403|ref|YP_001708139.1| hypothetical protein ABSDF2999 [Acinetobacter baumannii SDF]
 gi|169797241|ref|YP_001715034.1| hypothetical protein ABAYE3261 [Acinetobacter baumannii AYE]
 gi|260556123|ref|ZP_05828342.1| UPF0070 protein [Acinetobacter baumannii ATCC 19606]
 gi|332851254|ref|ZP_08433327.1| hypothetical protein HMPREF0021_00898 [Acinetobacter baumannii
           6013150]
 gi|332866123|ref|ZP_08436838.1| hypothetical protein HMPREF0020_00444 [Acinetobacter baumannii
           6013113]
 gi|332873248|ref|ZP_08441205.1| hypothetical protein HMPREF0022_00810 [Acinetobacter baumannii
           6014059]
 gi|169150168|emb|CAM88062.1| conserved hypothetical protein [Acinetobacter baumannii AYE]
 gi|169153195|emb|CAP02285.1| conserved hypothetical protein [Acinetobacter baumannii]
 gi|260410178|gb|EEX03477.1| UPF0070 protein [Acinetobacter baumannii ATCC 19606]
 gi|332730134|gb|EGJ61461.1| hypothetical protein HMPREF0021_00898 [Acinetobacter baumannii
           6013150]
 gi|332734764|gb|EGJ65858.1| hypothetical protein HMPREF0020_00444 [Acinetobacter baumannii
           6013113]
 gi|332738760|gb|EGJ69630.1| hypothetical protein HMPREF0022_00810 [Acinetobacter baumannii
           6014059]
          Length = 248

 Score = 65.4 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 58/205 (28%), Gaps = 8/205 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK--- 68
              K     Y       IL+ L     +  +   +            Q ++  N+     
Sbjct: 26  DSLKSFAKKYGSAMISGILIALIAFFGWEYWQKRNLATSQTETAKVQQLMDEANATADNP 85

Query: 69  ---LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
                   S+ + +    + +    +   +A +   K D   A +   KV N  +    +
Sbjct: 86  NALASITASADKIVKDDIDSVQAIQTQFVLAKLAYEKQDYAAAEKALKKVENSKVKDEGL 145

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                L+ A   +  + Y+E  K L    +          E+ G   +    +  AK  +
Sbjct: 146 IQVVKLRLADAQLAQNKYDEALKTLSG--DVDPAFKATVEELRGDIFVAKKDIDSAKKAY 203

Query: 186 EELAKDNNSPFGISTRSQMILANII 210
           +                Q+ L ++ 
Sbjct: 204 QAAWDSLLERKQERQILQIKLESVG 228


>gi|260549071|ref|ZP_05823292.1| UPF0070 protein [Acinetobacter sp. RUH2624]
 gi|260407799|gb|EEX01271.1| UPF0070 protein [Acinetobacter sp. RUH2624]
          Length = 248

 Score = 65.4 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 57/205 (27%), Gaps = 8/205 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK--- 68
              K     Y       IL+ L     +  +   +            Q ++  N+     
Sbjct: 26  DSLKSFAKKYGSAMISGILIALIAFFGWEYWQKRNLATSQTETAKVQQLMDEANATADNP 85

Query: 69  ---LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
                   S+ + +    + +    +   +A +   K D   A +   KV N  +    +
Sbjct: 86  NALASITASADKLVKDDIDSVQAIQTQFVLAKLAYEKQDYAAAEKALKKVENSKVKDEGL 145

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                L+ A   +  + Y+E  K L               E+ G   +    +  AK  +
Sbjct: 146 IQVVKLRLADAQLAQNKYDEALKTLSG--NVDPAFKATVEELRGDIFVAKKDIDSAKKAY 203

Query: 186 EELAKDNNSPFGISTRSQMILANII 210
           +                Q+ L ++ 
Sbjct: 204 QAAWDSLLERKQERQILQIKLESVG 228


>gi|322644424|gb|EFY40965.1| hypothetical protein SEEM054_12231 [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|323269815|gb|EGA53265.1| hypothetical protein SEEM8287_16694 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 192

 Score = 65.4 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 23/180 (12%), Positives = 59/180 (32%), Gaps = 4/180 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + +      K           + +++ +   + +  +     +        +  A
Sbjct: 1   MEIYENEHDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWSSHQTESARAASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   +++K D    + EK  +++   Y  L++M +A   V K + K A     +      
Sbjct: 61  VTAVSADKPDSI-PAAEKFAAENKNTYGALASMELAQQFVDKNELKKAEAQLQQGVAATS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A + +     +   K L  +            ++ G + L  G  + 
Sbjct: 120 -DENLKAVINLRLARVQLQLKQADAALKTLDAVKGEG--WTAIVADLRGEALLSKGDKKA 176


>gi|126668582|ref|ZP_01739536.1| hypothetical protein MELB17_11353 [Marinobacter sp. ELB17]
 gi|126626987|gb|EAZ97630.1| hypothetical protein MELB17_11353 [Marinobacter sp. ELB17]
          Length = 217

 Score = 65.4 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/214 (11%), Positives = 58/214 (27%), Gaps = 8/214 (3%)

Query: 7   ANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNS 66
                   K           + I   L++   +  +     +++      F   +  F +
Sbjct: 7   DEEQVEAIKQWWKNNGSSLLIGIGAALAIVFGWQAWQNQQAEQRTEAASQFVTLMNAFGT 66

Query: 67  NKLDDARSSF----EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
                A +             +  Y   +N+ +A + + + +    A   L+ A D    
Sbjct: 67  EDETSADTIAFVAKTLRDEHADSAYAVYANLMLARVQLMQNNDAEGAVESLQWALDKAVE 126

Query: 123 LAVRYAA-TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
                     + A   +    Y+     +   ++ S+       E+ G   L  G    A
Sbjct: 127 TQPLALVVRSRLAQAQMALEDYDAALATIDG-AKDSDAFGARFAELRGDILLAKGDQDGA 185

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           +  +    +            Q+ LA++      
Sbjct: 186 RDAYLAAREQGEENRN--GVLQLKLADLGVGGDA 217


>gi|54294414|ref|YP_126829.1| hypothetical protein lpl1483 [Legionella pneumophila str. Lens]
 gi|53754246|emb|CAH15723.1| hypothetical protein lpl1483 [Legionella pneumophila str. Lens]
          Length = 224

 Score = 65.4 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/184 (13%), Positives = 57/184 (30%), Gaps = 2/184 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y  +  + + ++L +   +   +  ++K K      +   +  F++  +  
Sbjct: 12  EIIKKWWKRYGNMITIFLSIVLLIIAGYRYMNWHNDKIKQQASIAYENMMIAFSNQNIKS 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            RS   +++   N            + +    +    A   LK    +     +R  A +
Sbjct: 72  VRSYANELIKNYNHTVYADIAHMTLAKIYVSKNKLEQARNELKAVAAESQMTPLRQIAKI 131

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L    +Y      L  +           NE+ G      G+ Q A   +     +
Sbjct: 132 RIARLLAADKAYTNALNELSTV--EDEAYLPVINELKGDIYSAKGQYQDAMNAYRLAIDE 189

Query: 192 NNSP 195
             + 
Sbjct: 190 VRTN 193


>gi|304387838|ref|ZP_07370012.1| tetratricopeptide repeat protein [Neisseria meningitidis ATCC
           13091]
 gi|304338103|gb|EFM04239.1| tetratricopeptide repeat protein [Neisseria meningitidis ATCC
           13091]
          Length = 209

 Score = 65.4 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 28/193 (14%), Positives = 56/193 (29%), Gaps = 2/193 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K   KW+  +LIL  L    +    + +  + +           +  N     +  +  
Sbjct: 18  WKTTGKWLFAVLILAALGYLGYTVYQNRAASQNQEAAAVLANIVEKAQNKAPQSEINAEL 77

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
            K+        +      +A+         + AE  LK    +     ++  A  +   +
Sbjct: 78  AKLQQSYPHSISAAQATLMAAATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVV 137

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           L+    Y+     L    E          E  G      GK Q+A   + +  +      
Sbjct: 138 LLQQKKYDAALAALDTPVEAD--FSPLLMETKGDVYAAQGKSQEALKNYGQALEKMPQDS 195

Query: 197 GISTRSQMILANI 209
                 QM L ++
Sbjct: 196 VGRELVQMKLDSL 208


>gi|262274785|ref|ZP_06052596.1| membrane protein [Grimontia hollisae CIP 101886]
 gi|262221348|gb|EEY72662.1| membrane protein [Grimontia hollisae CIP 101886]
          Length = 201

 Score = 65.4 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 21/177 (11%), Positives = 48/177 (27%), Gaps = 5/177 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+            K           L  ++ L     +  +    E  +    + + Q 
Sbjct: 1   MDVYTTEEQQVEAIKKWWRDNGKAVVLGAVIGLGGLYGWRYYQAEMETGREQASDAYTQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    +        +   I       Y  L  + +A   V  G                 
Sbjct: 61  VSALVAGDAQAEEKAATFI-KDHEGAYTSLLALQLAKSFVEAG--DLTLAAEQLRRVQSS 117

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
               ++  AT++ A +  +  +Y+     L  ++  ++       E+ G   L+ G 
Sbjct: 118 KDDTLKTLATVRLARVEAELGNYDAALSQLNSVT--TDSWKAQVEELRGDIELRRGD 172


>gi|148653697|ref|YP_001280790.1| hypothetical protein PsycPRwf_1900 [Psychrobacter sp. PRwf-1]
 gi|148572781|gb|ABQ94840.1| Uncharacterized protein-like protein [Psychrobacter sp. PRwf-1]
          Length = 278

 Score = 65.4 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 27/203 (13%), Positives = 63/203 (31%), Gaps = 11/203 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDG---------SHEKKKNIVGENFAQALELFNSNKLDDA 72
            +I   ++L ++    W YL +                    +    A ++  +      
Sbjct: 29  GYIIGAILLALIGYFGWTYLQNSGLKADTVAADKYSAIETANDELMGAPQVDAAASKKLN 88

Query: 73  RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQ 132
               + +    + +Y   + M  +   V   D K AA    K    D+    +     L+
Sbjct: 89  SDIDDLVAKHGSTIYAWQALMIKSRNAVDAKDYKTAAAALKKAMEIDVKDPGLHALTQLR 148

Query: 133 AASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
            AS+L+     +      Q  ++          E+LG   L   + +KA   ++      
Sbjct: 149 YASVLLSDGDIDGALT--QASTDVPVAFEATQQELLGDIYLAQKEDEKALRAYQNAWSLL 206

Query: 193 NSPFGISTRSQMILANIIASDQR 215
           +         ++ L ++  + + 
Sbjct: 207 SKRHEERPFLRLKLESLGVTPEA 229


>gi|332530163|ref|ZP_08406111.1| hypothetical protein HGR_09565 [Hylemonella gracilis ATCC 19624]
 gi|332040355|gb|EGI76733.1| hypothetical protein HGR_09565 [Hylemonella gracilis ATCC 19624]
          Length = 234

 Score = 65.0 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 26/210 (12%), Positives = 62/210 (29%), Gaps = 15/210 (7%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K     +  +   ++++ L     ++ +     ++       + +    A +       
Sbjct: 15  IKHFWKQHGNLLTAILVVALLALAGWWGWKAWQNRQATQATALYEELERIAADPGADPDG 74

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK-----NAAEIFLKVANDDLAPLA 124
                +   +  +  +           + + A+          AA   L+   ++     
Sbjct: 75  ARLTRALADMKDRFPRTAQAQQAALQVAAVHAQAGLTQPTRLEAARAALQWLAEEGRDQG 134

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
            R  A L+ A +L+D  SY+     L    +        A +  G   L  GK  +A + 
Sbjct: 135 YRALARLRLAGLLLDAKSYDAALAQLNA--DFPAEFAALAADRRGDIYLAQGKKAEAGSE 192

Query: 185 FEELAKDNNSPFG----ISTRSQMILANII 210
           + +  +   S  G            LA + 
Sbjct: 193 YLKAWQGLESQAGPGGNYRQVVDAKLAALG 222


>gi|213971516|ref|ZP_03399627.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|301386121|ref|ZP_07234539.1| hypothetical protein PsyrptM_25944 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302060179|ref|ZP_07251720.1| hypothetical protein PsyrptK_09317 [Pseudomonas syringae pv. tomato
           K40]
 gi|302135122|ref|ZP_07261112.1| hypothetical protein PsyrptN_27281 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213923708|gb|EEB57292.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|330872877|gb|EGH07026.1| hypothetical protein PSYMP_01544 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330965917|gb|EGH66177.1| hypothetical protein PSYAC_14990 [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331019378|gb|EGH99434.1| hypothetical protein PLA106_25353 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 213

 Score = 65.0 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 57/204 (27%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              L+ L + + +  +      +       + Q    AL        
Sbjct: 12  MKDWWQRNGKPLLTGGLLALVVVLGWQFWHRYQASQSQGASMLYQQLLETALTPSGQADT 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +       + A   LK   D  A   +   A
Sbjct: 72  ARVAEISGKLKSEFGGTTYAQFGSLFVAKVAVDAGKLDDAAAELKAVADKPANDTLGEIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  ++  K+L    +          E+ G    + G+  +A   +++  
Sbjct: 132 RQRLARVLAAQNKTDDALKLLAG--DADKAFLASREELKGDLLEQLGRTDEAHAAYQKAK 189

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
              +    +    QM L ++   D
Sbjct: 190 SALSEDAAVGG-LQMKLDDLAKGD 212


>gi|325203921|gb|ADY99374.1| tetratricopeptide repeat protein [Neisseria meningitidis
           M01-240355]
          Length = 209

 Score = 65.0 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 28/193 (14%), Positives = 57/193 (29%), Gaps = 2/193 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K   KW+  +LIL  L    +    + +  + +           +  N    ++  +  
Sbjct: 18  WKTTGKWLFAVLILAALGYLGYTVYQNRAASQNQEAAAVLANIVEKAQNKAPQNEINAEL 77

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
            K+        +      +A+         + AE  LK    +     ++  A  +   +
Sbjct: 78  TKLQQSYPHSISAAQATLMAAATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVV 137

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           L+    Y+     L    E          E  G      GK Q+A   + +  +      
Sbjct: 138 LLQQKKYDAALAALDTPVEAD--FAPLLMETKGDVYAAQGKSQEALKNYGQALEKMPQDS 195

Query: 197 GISTRSQMILANI 209
                 QM L ++
Sbjct: 196 VGRELVQMKLDSL 208


>gi|299771615|ref|YP_003733641.1| hypothetical protein AOLE_16905 [Acinetobacter sp. DR1]
 gi|298701703|gb|ADI92268.1| hypothetical protein AOLE_16905 [Acinetobacter sp. DR1]
          Length = 232

 Score = 65.0 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 28/205 (13%), Positives = 59/205 (28%), Gaps = 8/205 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK--- 68
              K     Y       IL+ L     +  +   +     +      Q ++  N++    
Sbjct: 10  DSLKSFAKKYGSAMISGILIALIAFFGWTYWQKKNLATSQVETAKVQQLMDEANASADNP 69

Query: 69  ---LDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
                   S+ + +    + +    +   +A +   K D   A +   KV N  +    +
Sbjct: 70  NALSSVTASADKIVKDDIDSVQAIQTQFVLAKLAYEKQDYAAAEKALKKVENSKVKDEGL 129

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                L+ A   +  + Y+E  K L               E+ G   +    V  AK  +
Sbjct: 130 IQVVKLRLADAQLAQNKYDEALKTLSG--NVDPAFKATVEELRGDIFVAKKDVDSAKKAY 187

Query: 186 EELAKDNNSPFGISTRSQMILANII 210
           +                Q+ L ++ 
Sbjct: 188 QAAWNSLLERKQERQILQIKLESVG 212


>gi|239997027|ref|ZP_04717551.1| putative membrane-associated protein with TPR-like domain
           [Alteromonas macleodii ATCC 27126]
          Length = 206

 Score = 65.0 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 69/213 (32%), Gaps = 9/213 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K     +     +   + L     +  +  +  + K      +  A
Sbjct: 1   MEQFATEEQQVEAIKRFWKEHGTAIIVGAALGLGGLWGWRAYSEAQIETKEAASVAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +E F +   D    +F  I    +  Y  ++++  A   V  GD   AA     V     
Sbjct: 61  VETFGTEGSDAKVKAF--IEENKDSGYASIASLLAAKQAVDAGDLDAAASHLNSVVTFAE 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                   A+L+ + + ++ +  +     L  ++   +      +E+ G    K GK   
Sbjct: 119 NDELKV-LASLRLSRVQIEMNQLDAALSTLSNVTN--DAFAAEVSELKGDVYQKQGKFDD 175

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           A+  +    + N +   +    QM L N+  S 
Sbjct: 176 ARLAYSNALEKNANNPLL----QMKLDNLSVSA 204


>gi|307610242|emb|CBW99803.1| hypothetical protein LPW_15661 [Legionella pneumophila 130b]
          Length = 224

 Score = 65.0 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 24/184 (13%), Positives = 57/184 (30%), Gaps = 2/184 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y  +  + + ++L +   +   +  ++K K      +   +  F++  +  
Sbjct: 12  EIIKKWWKRYGNMITIFLSIVLLIIAGYRYMNWHNDKIKQQASIAYENMMIAFSNQNIKS 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            RS   +++   N            + +    +    A   LK    +     +R  A +
Sbjct: 72  VRSYANELIKNYNHTVYADIAHMTLAKIYVSKNKLEQARNELKAVAAESQMTPLRQIAKI 131

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L    +Y      L  +           NE+ G      G+ Q A   +     +
Sbjct: 132 RIARLLAADKAYTNALNELSAV--EDEAYLPVINELKGDIYSAKGQYQDAMNAYRLAIDE 189

Query: 192 NNSP 195
             + 
Sbjct: 190 VRTN 193


>gi|301154678|emb|CBW14141.1| conserved protein [Haemophilus parainfluenzae T3T1]
          Length = 204

 Score = 65.0 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 61/209 (29%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M    +      + K              ++ +   + +  +      +       +   
Sbjct: 1   MAYTIEEEQELNQLKEWWKDNGKTIIAAFILGVGGMLGWRYWQSYQANQIMQASAEYDAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   N +         E + + D   Y   S +  A   VAK D  +A     +      
Sbjct: 61  VYTANKDAAAQQAKVAEFVKAHDKTSYAVFSLLDEAKGFVAKQDYASAENSLKQAIAQ-S 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   A L+ +++      ++     L ++           + + G   +  G V  
Sbjct: 120 QDDILTSLAALRLSAVQFQQGQFDAALASLNQVKSQG--FSARKDLLAGDIQVAKGDVNG 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE   K+ N        +QM L N+
Sbjct: 178 AKASFENAQKNGN--PLEKQMAQMKLNNL 204


>gi|325927623|ref|ZP_08188852.1| hypothetical protein XPE_2879 [Xanthomonas perforans 91-118]
 gi|325541990|gb|EGD13503.1| hypothetical protein XPE_2879 [Xanthomonas perforans 91-118]
          Length = 212

 Score = 65.0 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 55/173 (31%), Gaps = 10/173 (5%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +              +   ++   +  LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQTRTNTALVEANGRYEAVVKSIQAKDLDKAAKDIVALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A     K   D  A   ++     + A +L ++   +E  K+L      ++
Sbjct: 101 QVDAGKNAEAI----KTLRDVPAEGELKQIVQQRLARVLTESGKPDEAIKLL------AD 150

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
                + EI   + +  GK  +A+ ++       +         +  L ++  
Sbjct: 151 AQDHASLEIRADALVAQGKPDEARALYTRALTTVDVASPQRRLLETKLMDVGG 203


>gi|218767961|ref|YP_002342473.1| hypothetical protein NMA1064 [Neisseria meningitidis Z2491]
 gi|121051969|emb|CAM08278.1| putative membrane protein [Neisseria meningitidis Z2491]
 gi|261392798|emb|CAX50374.1| conserved hypothetical TPR-containing membrane protein [Neisseria
           meningitidis 8013]
          Length = 209

 Score = 65.0 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 28/193 (14%), Positives = 56/193 (29%), Gaps = 2/193 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K   KW+  +LIL  L    +    + +  + +           +  N     +  +  
Sbjct: 18  WKTTGKWLFAVLILAALGYLGYTVYQNRAASQNQEAAAVLANIVEKAQNKAPQSEINAEL 77

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
            K+        +      +A+         + AE  LK    +     ++  A  +   +
Sbjct: 78  AKLQQSYPHSISAAQATLMAAATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVV 137

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           L+    Y+     L    E          E  G      GK Q+A   + +  +      
Sbjct: 138 LLQQKKYDAALAALDTPVEAD--FAPLLMETKGDVYAAQGKSQEALKNYGQALEKMPQDS 195

Query: 197 GISTRSQMILANI 209
                 QM L ++
Sbjct: 196 VGRELVQMKLDSL 208


>gi|28868643|ref|NP_791262.1| hypothetical protein PSPTO_1436 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28851881|gb|AAO54957.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
          Length = 213

 Score = 65.0 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 57/204 (27%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ----ALELFNSNKL 69
            K              L+ L + + +  +      +       + Q    AL        
Sbjct: 12  MKDWWQRNGKPLLTGGLLALVVVLGWQFWHRYQASQSQGASMLYQQLLETALTPSGQADT 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +       + A   LK   D  A   +   A
Sbjct: 72  ARVAEISGKLKSEFGGTTYAQFGSLFVAKVAVDAGKLDDAAAELKAVADKPANDTLGEIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  ++  K+L    +          E+ G    + G+  +A   +++  
Sbjct: 132 RQRLARVLAAQNKTDDALKLLAG--DADKAFLASREELKGDLLEQLGRTDEAYAAYQKAK 189

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
              +    +    QM L ++   D
Sbjct: 190 SALSEDAAVGG-LQMKLDDLAKGD 212


>gi|294666612|ref|ZP_06731851.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603632|gb|EFF47044.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 212

 Score = 64.6 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 57/173 (32%), Gaps = 10/173 (5%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +              +   ++   +  LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQTRTNTALVEANGRYEAVVKSIQAKDLDKAAKDIVALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A     K   D  A   ++     + A +L ++   +E  K+L +  + ++
Sbjct: 101 QVDAGKNAEAI----KTLRDVPAEGELKQIVQQRLARLLTESGKPDEAIKLLAEAQDHAS 156

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
                  EI   + +  GK  +A+ ++ +     +         +  L ++  
Sbjct: 157 ------LEIRADALVVQGKPDEARALYTKALTTLDVASPQRRLLETKLMDVGG 203


>gi|325142104|gb|EGC64530.1| tetratricopeptide repeat protein [Neisseria meningitidis 961-5945]
 gi|325198053|gb|ADY93509.1| tetratricopeptide repeat protein [Neisseria meningitidis G2136]
          Length = 209

 Score = 64.6 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 28/193 (14%), Positives = 56/193 (29%), Gaps = 2/193 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K   KW+  +LIL  L    +    + +  + +           +  N     +  +  
Sbjct: 18  WKTTGKWLFAVLILAALGYLGYTVYQNRAASQNQEAAAILAEIVEKAQNKAPQSEINAEL 77

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
            K+        +      +A+         + AE  LK    +     ++  A  +   +
Sbjct: 78  TKLQQSYPHSISAAQATLMAAATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVV 137

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           L+    Y+     L    E          E  G      GK Q+A   + +  +      
Sbjct: 138 LLQQKKYDAALAALDTPVEAD--FAPLLMETKGDVYAAQGKSQEALKNYGQALEKMPQDS 195

Query: 197 GISTRSQMILANI 209
                 QM L ++
Sbjct: 196 VGRELVQMKLDSL 208


>gi|326403268|ref|YP_004283349.1| hypothetical protein ACMV_11200 [Acidiphilium multivorum AIU301]
 gi|325050129|dbj|BAJ80467.1| hypothetical protein ACMV_11200 [Acidiphilium multivorum AIU301]
          Length = 222

 Score = 64.6 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 69/210 (32%), Gaps = 8/210 (3%)

Query: 10  YKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL 69
              + +     Y          +L     +  +     ++     + +          + 
Sbjct: 13  RAERTREFLMRYAGALAGAAAFVLLAIGGWKAWQWHRHQQDLKAADRYVTLTSQIGQQEA 72

Query: 70  DDAR-------SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN-DDLA 121
              +                    Y  L+ +  A++    GD K A +++  VA  +  A
Sbjct: 73  GLTKSGDIGDAKRLVDFAGTAPAGYANLARLRAAALYAQAGDLKTAGQLWAAVAAPNSGA 132

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKA 181
              V   A L  A   +      ++   L  L++P NP    A   L +  +K GK + A
Sbjct: 133 TPPVHDLALLLLAQHEMGVKPDADVRARLATLNKPGNPWQPLAQLDLALLDMKAGKTKSA 192

Query: 182 KTIFEELAKDNNSPFGISTRSQMILANIIA 211
             + EE++ D  SP  +   +Q ++A +  
Sbjct: 193 HGLLEEVSADPASPPNLRNLAQGLIAKLNG 222


>gi|311694386|gb|ADP97259.1| conserved hypothetical protein [marine bacterium HP15]
          Length = 218

 Score = 64.6 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 27/210 (12%), Positives = 65/210 (30%), Gaps = 9/210 (4%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K           + I   L++   +  +     +++      FA  L  F+    + 
Sbjct: 12  QAIKDWWKKNGSSLLIGIGAALAIVFGWQAWQNHQAQQRTEAANQFANLLNAFSDQADET 71

Query: 72  ARSSFEKILSQDNKLYNPLSN------MYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
           +  +   +     + Y   +       +     L+  G+ + A +       +     A+
Sbjct: 72  SGETVAFVAQTLREDYTDSAYAVYGNLILARQQLMQDGNAEAAIDSLKWALENTGEHEAL 131

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                 + A        YE+    +   +  ++      +E+ G   L  G  + A+  +
Sbjct: 132 ALVVRNRLARAQFTAGQYEDALATIDG-AGNADAFDAMYSELRGDILLAQGDREGAREAY 190

Query: 186 EELAKDNNSPFGISTRSQMILANIIASDQR 215
             LA    S  G S   ++ LA++   +  
Sbjct: 191 --LAAREQSQQGRSGILELKLADLGVGEDA 218


>gi|117919680|ref|YP_868872.1| hypothetical protein Shewana3_1231 [Shewanella sp. ANA-3]
 gi|117612012|gb|ABK47466.1| conserved hypothetical protein [Shewanella sp. ANA-3]
          Length = 206

 Score = 64.6 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 63/194 (32%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      K     + F Q 
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGTSIVIGAVVGLGGLYGWNYYSDMKIVKAEEASQAF-QT 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   +S++        E   + D K Y  L ++ +A   V   D   A E   KV     
Sbjct: 60  LTTKSSDEAAMLAGVAEFSKNHDQKGYQALLDLIVAKTAVEAKDFAKAEEALKKVIAAKP 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   ATL+ A I  +          L ++++          E+ G   ++ G+  K
Sbjct: 120 G-AGLDTVATLRLARIQAEQGQIGTALATLDQVTDK--AFLAQREELKGDFFVRQGEADK 176

Query: 181 AKTIFEELAKDNNS 194
           AKT ++    +   
Sbjct: 177 AKTAYQAAMDNGGV 190


>gi|170718898|ref|YP_001784069.1| hypothetical protein HSM_0731 [Haemophilus somnus 2336]
 gi|168827027|gb|ACA32398.1| conserved hypothetical protein [Haemophilus somnus 2336]
          Length = 203

 Score = 64.6 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 26/178 (14%), Positives = 60/178 (33%), Gaps = 5/178 (2%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K  YK I  +++L    +  W   +      KK  +   + + +    +  + +A+   
Sbjct: 18  WKENYKSIIVIVLLAFSGVFGWR-YWQDYQTTKKQTLSAQYDELISSAENQSIYNAQLD- 75

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
             +       Y   + +  A + V++ +   A E   +   +    + +   A  + A++
Sbjct: 76  RFVQENGETTYAVFALLDKAKLEVSQQNFVQAEETLKQAIVNTSDDILMSITAI-RLATV 134

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
                 ++E    L ++             + G   L  G  + AK  FE+      S
Sbjct: 135 QYQLQKFDEALASLNQVK--GQSWDVSKLLLSGDIQLAKGNKEIAKDNFEQALTKATS 190


>gi|153001516|ref|YP_001367197.1| hypothetical protein Shew185_3003 [Shewanella baltica OS185]
 gi|151366134|gb|ABS09134.1| conserved hypothetical protein [Shewanella baltica OS185]
          Length = 206

 Score = 64.6 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 66/194 (34%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +   + L     +  +      +     + F Q 
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGTSIFIGAFVGLGGLYAWNYYSDVKVAQAEEASKAFHQ- 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   ++++        E   S D K Y  L  + +A   V   D   A E   KV     
Sbjct: 60  LTTNSADETAMLAGVAEFSKSHDQKGYQALLELIVAKTAVEAKDYPKAIEALNKVIAAKP 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   ATL+ A I  +    +     L+++++         +E+ G   ++ G+V+K
Sbjct: 120 G-AGLDVIATLRVARIQAEQGQIDAALATLEQVTDK--AFFAQRDELKGDFLVRQGEVEK 176

Query: 181 AKTIFEELAKDNNS 194
           AKT ++    +   
Sbjct: 177 AKTAYQAAMDNGGV 190


>gi|294625015|ref|ZP_06703665.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292600690|gb|EFF44777.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 212

 Score = 64.6 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 57/173 (32%), Gaps = 10/173 (5%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +              +   ++   +  LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQTRTNTALVEANGRYEAVVKSIQAKDLDKAAKDIVALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A     K   D  A   ++     + A +L ++   +E  K+L +  + ++
Sbjct: 101 QVDAGKNAEAI----KTLRDVPAEGELKQIVQQRLARLLTESGKPDEAIKLLAEAQDHAS 156

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
                  EI   + +  GK  +A+ ++ +     +         +  L ++  
Sbjct: 157 ------LEIRADALVVQGKPDEARALYTKALTTVDVASPQRRLLETKLMDVGG 203


>gi|73541772|ref|YP_296292.1| hypothetical protein Reut_A2084 [Ralstonia eutropha JMP134]
 gi|72119185|gb|AAZ61448.1| conserved hypothetical transmembrane protein [Ralstonia eutropha
           JMP134]
          Length = 210

 Score = 64.6 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/213 (11%), Positives = 67/213 (31%), Gaps = 4/213 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +        K     Y      +++  L     +  +     K+ +     + Q 
Sbjct: 1   MAYDLEEQEQLENLKAWWRQYGNALTWILIAALLAFAAWNGWKYWERKQASEAAVLYDQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           ++       +  + +   +  +  +      +  +A+ ++        A+  L+ A D  
Sbjct: 61  MKAAEGRDAERVKRAAGDLEDKFGRTAYGPMSALVAAKVLYDAGDLAGAKTQLQWAMDHG 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                 + A ++ A +L+D  +Y++   +L+   EP         +  G       K   
Sbjct: 121 -DGEYSHIARVRLAGVLLDEKAYDQGLALLKD--EPPAAFVAIYADRRGDLLAAQDKRAD 177

Query: 181 AKTIFEELAKDNNS-PFGISTRSQMILANIIAS 212
           A+  + +      +    +    Q  L  +  +
Sbjct: 178 ARAAYRKALDKLGADDQSMRQIIQFKLDALGTA 210


>gi|91792616|ref|YP_562267.1| tetratricopeptide TPR_2 [Shewanella denitrificans OS217]
 gi|91714618|gb|ABE54544.1| Tetratricopeptide TPR_2 [Shewanella denitrificans OS217]
          Length = 206

 Score = 64.6 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 35/212 (16%), Positives = 72/212 (33%), Gaps = 6/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     L  ++ L     +  +         +  E+F   
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGVSIALGAVVGLGGLYGWNTYSEHKVASAELASESFQS- 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           + L   N  +   ++ E   + D + Y  L    +A   V  GD + A + + KV     
Sbjct: 60  IALDAENSPNVMMAAVEFEKNHDQQGYQALLQFMLAKSAVEAGDLEKAEQAYTKVIAAKP 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   +   A L+ + +  +  +       L+ ++   +      +E+ G    + G+  K
Sbjct: 120 A-AGLDMIAALRLSRVQAEQGNLGMALATLEHVT--DSAYAAQRDELKGDFYARQGEFDK 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           AK  ++       +    S   QM L ++  +
Sbjct: 177 AKNAYQAAVTLGGT--LASPALQMKLDSLNKA 206


>gi|160876252|ref|YP_001555568.1| hypothetical protein Sbal195_3146 [Shewanella baltica OS195]
 gi|160861774|gb|ABX50308.1| conserved hypothetical protein [Shewanella baltica OS195]
 gi|315268441|gb|ADT95294.1| Protein of unknown function DUF2133 [Shewanella baltica OS678]
          Length = 206

 Score = 64.6 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 66/194 (34%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +   + L     +  +      +     + F + 
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGTSIFIGAFVGLGGLYAWNYYSDVKVAQAEEASKAFHE- 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   ++++        E   S D K Y  L  + +A   V   D   A E   KV     
Sbjct: 60  LTTKSADETAMLAGVAEFSKSHDQKGYQALLELIVAKTAVEAKDYPKAIEALNKVIAAKP 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   ATL+ A I  +    +     L+++++         +E+ G   ++ G+V+K
Sbjct: 120 G-AGLDVIATLRVARIQAEQGQIDAALATLEQVTDK--AFFAQRDELKGDFLVRQGEVEK 176

Query: 181 AKTIFEELAKDNNS 194
           AKT ++    +   
Sbjct: 177 AKTAYQAAMDNGGV 190


>gi|27363893|ref|NP_759421.1| hypothetical protein VV1_0425 [Vibrio vulnificus CMCP6]
 gi|37678952|ref|NP_933561.1| hypothetical protein VV0768 [Vibrio vulnificus YJ016]
 gi|27360010|gb|AAO08948.1| putative membrane protein [Vibrio vulnificus CMCP6]
 gi|37197694|dbj|BAC93532.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 204

 Score = 64.3 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 39/209 (18%), Positives = 75/209 (35%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  N         K           +  ++ L     +  +  S  + +    +N+  A
Sbjct: 1   MEVYNTEEEQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQDSVTQAREAASQNYTSA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    +   + A      I S D K Y+ L+ + +A   V  GD   AA   LK A  + 
Sbjct: 61  INALQAKGAEAAADVEAFIASNDVKEYSVLAALQLAKAQVTAGDLN-AALTQLKWAQSNS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    T + A +  +  +++     L K++           E+ G  AL+ G  + 
Sbjct: 120 KDAALIPLTTYRIARVEAELGNFDAAKAELAKVT--DASWTGRVAELRGDIALRQGDKEA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  +  ++   +    QM L ++
Sbjct: 178 AYAAYSEAQQAADAGQTL----QMKLDDL 202


>gi|88607077|ref|YP_505469.1| hypothetical protein APH_0894 [Anaplasma phagocytophilum HZ]
 gi|88598140|gb|ABD43610.1| conserved hypothetical protein [Anaplasma phagocytophilum HZ]
          Length = 202

 Score = 64.3 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 33/198 (16%), Positives = 71/198 (35%), Gaps = 6/198 (3%)

Query: 11  KGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLD 70
           + +       +K     ++L+ L  +   +  D   EK++   G+     L         
Sbjct: 3   REEIGQFFVRFKGAIMGVVLLALCASGIAFFLDSRSEKQRIKDGDAIYDVLR----RNDG 58

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT 130
                  ++ +    +   L+   +A+  V  G   +A E++  +A D      +R  A 
Sbjct: 59  SVEQRLAEVSNTSKGIVARLAKFKLAAGHVRSGSVVSAKELYYDLAADTGLTRELRELAE 118

Query: 131 LQAASILVDTSSYEEISK--ILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
             A  + +D    +E  +  +++  S   +     A E L +S L+   V  A  + +E+
Sbjct: 119 YFAIVLSLDGEDIDEALEERLVRLASGKDSIYRSSAKEALIVSELRKNDVDAAVLVMKEV 178

Query: 189 AKDNNSPFGISTRSQMIL 206
             D      I    + +L
Sbjct: 179 LGDPALNMEIRRNVEGLL 196


>gi|21242763|ref|NP_642345.1| hypothetical protein XAC2019 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21108243|gb|AAM36881.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 212

 Score = 64.3 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 56/173 (32%), Gaps = 10/173 (5%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +              +   ++   +  LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQTRTNTALVEANGRYEAVVKSIQAKDLDKAAKDIVALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A     K   D  A   ++     + A +L ++   +E  K+L      ++
Sbjct: 101 QVDAGKNDEAI----KTLRDVPAEGELKQIVQQRLARLLTESGKPDEAIKLL------AD 150

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
                + EI   + +  GK  +A+ ++ +     +         +  L ++  
Sbjct: 151 AQDHASLEIRADALVVQGKPDEARALYAKALTTVDVASPQRRLLETKLMDVGG 203


>gi|77460820|ref|YP_350327.1| hypothetical protein Pfl01_4599 [Pseudomonas fluorescens Pf0-1]
 gi|77384823|gb|ABA76336.1| putative membrane protein [Pseudomonas fluorescens Pf0-1]
          Length = 213

 Score = 64.3 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 59/204 (28%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF----NSNKL 69
            K              L+ L +   +  +      +       + Q LE           
Sbjct: 12  LKDWWTRNGKPLVTGGLLALVIVFGWQAYHKYQSNQSQGASVLYQQLLETTLTPDGKPDA 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +       + A   LK      A  A+   A
Sbjct: 72  ARVADLAGKLNSEFGGSAYAQYGSLFVAKVAVDSGKLDDAATELKAIVAKPANPALGEIA 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  +E  K+L+   +          E+ G   ++ G+  +A   +++ A
Sbjct: 132 RQRLAQVLGAQNKADEALKLLEG--DADKSFLATREELKGDLLVQLGRTDEANAAYQK-A 188

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
           K   S        Q+ L ++   D
Sbjct: 189 KAALSDEAAVGGLQIKLDDLAKGD 212


>gi|148359077|ref|YP_001250284.1| transmembrane protein [Legionella pneumophila str. Corby]
 gi|296107125|ref|YP_003618825.1| putative protein conserved in bacteria [Legionella pneumophila
           2300/99 Alcoy]
 gi|148280850|gb|ABQ54938.1| transmembrane protein [Legionella pneumophila str. Corby]
 gi|295649026|gb|ADG24873.1| putative protein conserved in bacteria [Legionella pneumophila
           2300/99 Alcoy]
          Length = 224

 Score = 64.3 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/184 (13%), Positives = 57/184 (30%), Gaps = 2/184 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y  +  + + ++L +   +   +  ++K K      +   +  F++  +  
Sbjct: 12  EIIKKWWKRYGNMITIFLSIMLLIIAGYRYMNWHNDKIKQQASIAYENMMIAFSNQNIKS 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            RS   +++   N            + +    +    A   LK    +     +R  A +
Sbjct: 72  VRSYANELIKNYNHTVYADIAHMTLAKIYVSKNKLEQARNELKAVASESQMTPLRQIAKI 131

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L    +Y      L  +           NE+ G      G+ Q A   +     +
Sbjct: 132 RIARLLAADKAYTNALNELSAV--EDEAYLPVINELKGDIYSAKGQYQDAMNAYRLAIDE 189

Query: 192 NNSP 195
             + 
Sbjct: 190 VRTN 193


>gi|90021083|ref|YP_526910.1| hypothetical protein Sde_1436 [Saccharophagus degradans 2-40]
 gi|89950683|gb|ABD80698.1| conserved hypothetical protein [Saccharophagus degradans 2-40]
          Length = 238

 Score = 64.3 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/208 (15%), Positives = 60/208 (28%), Gaps = 10/208 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  +          K           L +++++     +  +    E +       F   
Sbjct: 1   MSDHITEEEQIEAIKRWWSENWASIVLPVVILIVGYAGWSYWGDYKEARAQEGSAAFQVL 60

Query: 61  LELFN--------SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
           LE           ++ + DA+   + I S+ +       +  + + L  +    + AE  
Sbjct: 61  LEKVEAQPGQKLSADAITDAQLEAQSIASEFSGSLYADMSNLLLARLAVESGKLDEAEAA 120

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA 172
           L       A  +V   A  + A +      Y E S ++               EI G  A
Sbjct: 121 LNAVIASPANESVVGLAKARLAKVYAAQGKYAEASTLVGS--TEQEAYKALYAEIRGDIA 178

Query: 173 LKFGKVQKAKTIFEELAKDNNSPFGIST 200
           L  G +  A T + E      S      
Sbjct: 179 LAQGDLPTAHTAYNEALNGLTSAQYSRR 206


>gi|52841773|ref|YP_095572.1| transmembrane protein [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52628884|gb|AAU27625.1| transmembrane protein [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 224

 Score = 64.3 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/184 (13%), Positives = 57/184 (30%), Gaps = 2/184 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K     Y  +  + + ++L +   +   +  ++K K      +   +  F++  +  
Sbjct: 12  EIIKKWWKRYGNMITIFLSIMLLIIAGYRYMNWHNDKIKQQASIAYENMMIAFSNQNIKS 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
            RS   +++   N            + +    +    A   LK    +     +R  A +
Sbjct: 72  VRSYANELIKNYNHTVYADIAHMTLAKIYVNKNKLEQARNELKAVASESQMTPLRQIAKI 131

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L    +Y      L  +           NE+ G      G+ Q A   +     +
Sbjct: 132 RIARLLAADKAYTNALNELSAV--EDEAYLPVINELKGDIYSAKGQYQDAMNAYRLAIDE 189

Query: 192 NNSP 195
             + 
Sbjct: 190 VRTN 193


>gi|319787001|ref|YP_004146476.1| hypothetical protein Psesu_1398 [Pseudoxanthomonas suwonensis 11-1]
 gi|317465513|gb|ADV27245.1| Protein of unknown function DUF2133 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 207

 Score = 64.3 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 27/212 (12%), Positives = 70/212 (33%), Gaps = 17/212 (8%)

Query: 1   MESNNDANSYKGKCKMG-KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ 59
           ++   D +    + +   +     I   L L + ++      +   +   +      + Q
Sbjct: 3   IDDLLDEHEQGERVRAWLRKNLPGIIAGLALGLAAIWGMRQ-WQERNLGAQQQAHAAYTQ 61

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           AL    + + D   +           +Y  L  +++A   V  G T++A      +  + 
Sbjct: 62  ALAKVEAGEEDPGAALAG-----HEGVYATLGALHVAKAQVEAGKTEDAITTLRGIKAEP 116

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
                       + A +L  T   +E  K+L+              E+   + +  GK +
Sbjct: 117 ELEP----VVKQRLAQLLAATGKADEAVKLLE------GDDSGLGLELRADALVAAGKPE 166

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           +A+  ++   +  ++      R ++ L +   
Sbjct: 167 EARAQYQRALEVLDAEAPARRRIELKLQDAGG 198



 Score = 36.5 bits (82), Expect = 2.9,   Method: Composition-based stats.
 Identities = 17/146 (11%), Positives = 33/146 (22%), Gaps = 6/146 (4%)

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A         Q  ++   L       I            +      +  A      A T 
Sbjct: 2   AIDDLLDEHEQGERVRAWLRKNLPGIIAGLALGLAAIWGMRQWQERNLGAQQQAHAAYTQ 61

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
             A +                               +  + ++ GK + A T    +  +
Sbjct: 62  ALAKVEAGEEDPGAALA------GHEGVYATLGALHVAKAQVEAGKTEDAITTLRGIKAE 115

Query: 192 NNSPFGISTRSQMILANIIASDQRNK 217
                 +  R   +LA    +D+  K
Sbjct: 116 PELEPVVKQRLAQLLAATGKADEAVK 141


>gi|261379055|ref|ZP_05983628.1| tetratricopeptide repeat protein [Neisseria cinerea ATCC 14685]
 gi|269144511|gb|EEZ70929.1| tetratricopeptide repeat protein [Neisseria cinerea ATCC 14685]
          Length = 209

 Score = 64.3 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 26/193 (13%), Positives = 56/193 (29%), Gaps = 2/193 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K   KW+  +LIL  L    +    +    + +           +  N    ++  +  
Sbjct: 18  WKTTGKWLFAVLILAALGYLGYTVYQNRKVSQNQEAAAILAEIVEKAQNKAPQNEINAEL 77

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
            K+     +  +      +A+         + AE  LK    +     ++     +   +
Sbjct: 78  TKLQQSYPQSISAAQATLMAAATEFDAHRYDVAEAHLKWVLSNQQDSLIQALTAQRLGVV 137

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           L+    Y+     L   +           E  G      GK Q+A   + +  +      
Sbjct: 138 LLQQKKYDAALAALD--TPVDAAFAPLLMETKGDVYAAQGKNQEALKNYGQALEKMPQDS 195

Query: 197 GISTRSQMILANI 209
                 QM L ++
Sbjct: 196 VGRELVQMKLDSL 208


>gi|225077177|ref|ZP_03720376.1| hypothetical protein NEIFLAOT_02232 [Neisseria flavescens
           NRL30031/H210]
 gi|224951525|gb|EEG32734.1| hypothetical protein NEIFLAOT_02232 [Neisseria flavescens
           NRL30031/H210]
          Length = 209

 Score = 63.9 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/193 (12%), Positives = 48/193 (24%), Gaps = 2/193 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K   +WI  LLI+  L    +         K +           +              
Sbjct: 18  WKKTGRWIFALLIVAALGYLGYTIYQGQKASKDQEAAAVLAQMVEKAQQKTDPKAINVDL 77

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
            ++        +      + +         + AE  L     +     V+  A  +   +
Sbjct: 78  AELQKNYPDSISTAQATLMVAATEFDAGRYDVAEGHLNWVLKNQNAPLVQALAAQRLGVV 137

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           L+    Y+     L    E          E  G   +   K ++A   +E          
Sbjct: 138 LLQQKKYDAAINALNTQVEAD--FEPLMLETKGDVYVAQNKTKEAVQSYEAALSKMPQTA 195

Query: 197 GISTRSQMILANI 209
                 QM + ++
Sbjct: 196 VGRELLQMKIDSL 208


>gi|119775497|ref|YP_928237.1| hypothetical protein Sama_2363 [Shewanella amazonensis SB2B]
 gi|119767997|gb|ABM00568.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 206

 Score = 63.9 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 37/210 (17%), Positives = 64/210 (30%), Gaps = 6/210 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      K       + Q 
Sbjct: 1   MEIYSTEEQQVEAIKSFWKEYGTSILVGAVVGLGGLYGWNTYSDMKVAKAEAASVAYQQ- 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L    S++    +++       D + Y+ L  M +A   V   D   A E   KV     
Sbjct: 60  LSANTSDEAAILKAADGFKAEHDQQGYSLLVEMMVAKSAVEAKDYAKAEESLKKVIAAKD 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A   +   ATL+ A I  +          L  ++   +      +EI G      G+  K
Sbjct: 120 AGS-LGSVATLRLARIQAEQGQGAVALTTLDSIT--DSAFDAQRDEIKGDILTSQGETDK 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           AK  ++                +M L N+ 
Sbjct: 177 AKAAYQAALDKGGISAS--PLLKMKLDNLN 204


>gi|78047626|ref|YP_363801.1| hypothetical protein XCV2070 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78036056|emb|CAJ23747.1| putative membrane protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 212

 Score = 63.9 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 56/173 (32%), Gaps = 10/173 (5%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +              +   ++   +  LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQTRTNTALVEANGRYEAVVKSIQAKDLDKAAKDIVALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A +I      D  A   ++     + A +L ++   +E  K+L    + ++
Sbjct: 101 QVDAGKNAEAIKI----LRDVPAEGELKQIVQQRLARVLTESGKPDEAIKLLADAQDHAS 156

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
                  EI   + +  GK  +A+ ++       +         +  L ++  
Sbjct: 157 ------LEIRADALVAQGKPDEARALYTRALTTVDVASPQRRLLETKLMDVGG 203


>gi|71279045|ref|YP_270900.1| hypothetical protein CPS_4250 [Colwellia psychrerythraea 34H]
 gi|71144785|gb|AAZ25258.1| conserved hypothetical protein [Colwellia psychrerythraea 34H]
          Length = 223

 Score = 63.9 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 60/192 (31%), Gaps = 3/192 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K       +     + +  +  I F L+  +   ++  V +++   
Sbjct: 1   MEIYQTEEQQVEAIKSYWQQNGYTIIAGVTLGFAGFIGFNLYQDNKFDEEIAVSDSYQTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +E    +      ++ + I    +  Y  L+ + +A    +  D     +          
Sbjct: 61  IEQSGKDAKAFTANAEKFISENGDNSYVALTALALAKESASHKDWPQVQKQLTTAIESAP 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  A+L+ A + V    Y E    L               E+ G + L+ GK   
Sbjct: 121 TD-GIKAIASLRLARVQVQLEQYSEALATLNS--NLPESFTAAIEEVKGDAYLQQGKNDL 177

Query: 181 AKTIFEELAKDN 192
           A+  ++     +
Sbjct: 178 ARNAYQAAIAAD 189


>gi|329123604|ref|ZP_08252164.1| hypothetical protein HMPREF9095_1382 [Haemophilus aegyptius ATCC
           11116]
 gi|327469803|gb|EGF15268.1| hypothetical protein HMPREF9095_1382 [Haemophilus aegyptius ATCC
           11116]
          Length = 204

 Score = 63.9 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/209 (10%), Positives = 61/209 (29%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++ +     +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQAHQVEQISQASVQYDAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     N+     +  + + +     Y   + +  +     K D   AA + LK A    
Sbjct: 61  INSVQQNEQAKKANIEQFVQANSKTAYAVFALLDESKKATEKQDFA-AAGVNLKQALMQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|221133870|ref|ZP_03560175.1| putative membrane-associated protein with TPR-like domain
           [Glaciecola sp. HTCC2999]
          Length = 212

 Score = 63.5 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 33/215 (15%), Positives = 62/215 (28%), Gaps = 6/215 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K           +  ++ L     +  +  +    K      +   
Sbjct: 1   MEQFATEEQQVEAIKKFWKDNGSAIIIGAVLGLGALWGWRYYTDTQIMTKETASTEYQTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   + +   D  ++F  I +Q    Y PL+    A   V K D   A    L+      
Sbjct: 61  VTSLSEDAALDEATAF--ITAQGETGYAPLAGFIAAQAAVEKADFPAAIS-QLQNITTLT 117

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   A L+ A +   T  Y      L  ++            + G   +  G   +
Sbjct: 118 NDAVLLNVANLRLARVQFATVDYTAALTSLNNVTN--EAFIADKEALRGDILVAQGDFAQ 175

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           A++ +      N+    +  R   I A I A+   
Sbjct: 176 AQSAYTASLAAND-DRSVQIRLDNIGAMIDAAADA 209


>gi|88812663|ref|ZP_01127910.1| hypothetical protein NB231_00720 [Nitrococcus mobilis Nb-231]
 gi|88790079|gb|EAR21199.1| hypothetical protein NB231_00720 [Nitrococcus mobilis Nb-231]
          Length = 213

 Score = 63.5 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 69/204 (33%), Gaps = 3/204 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + +     Y       +++ L   + +  + G  ++++      +   +          
Sbjct: 12  DQIRRWWGEYGRSVIAGVIIALVSILGWQQWHGYRDRQELAAAAAYQALVADLGDGNTAA 71

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A+S  E++ S+       +      +    K D   AA   L+ A D     A++  A L
Sbjct: 72  AKSQAEQLQSEHEGSAYAVLAALQMAGQYVKQDDLQAAGKALRWAVDHTQLPALQTIARL 131

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +L+     +   ++ Q +  P +       E++G   +       A   ++    D
Sbjct: 132 RLARVLLGAGDAKAALQVAQPV--PKDAFAGQFQELIGDIHIAQSDQASAIKAYQAALAD 189

Query: 192 NNSPFGISTRSQMILANIIASDQR 215
             S        Q  L ++ +++  
Sbjct: 190 G-SNSQRHGLLQAKLNDLGSAESA 212


>gi|126175190|ref|YP_001051339.1| hypothetical protein Sbal_2988 [Shewanella baltica OS155]
 gi|125998395|gb|ABN62470.1| conserved hypothetical protein [Shewanella baltica OS155]
          Length = 206

 Score = 63.5 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 66/194 (34%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      +     + F + 
Sbjct: 1   MEIYSTEEQQVDAIKQFWTDYGNSILIGAVVGLGGLYAWNYYSDVKVAQAEEASKAFHE- 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   ++++        E   S D K Y  L  + +A   V   D   A E   KV     
Sbjct: 60  LTTKSADEAAMLAGVAEFSKSHDQKGYQALLELIVAKTAVEAKDYPKAIEALNKVIAAKP 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   ATL+ A I  +    +     L ++++         +E+ G   ++ G+V+K
Sbjct: 120 G-AGLDVIATLRVARIQAEQGQIDAALATLDQVTDK--AFFAQRDELKGDFLVRQGEVEK 176

Query: 181 AKTIFEELAKDNNS 194
           AKT ++    +   
Sbjct: 177 AKTAYQAAMDNGGV 190


>gi|304410033|ref|ZP_07391652.1| Protein of unknown function DUF2133 [Shewanella baltica OS183]
 gi|307302254|ref|ZP_07582012.1| Protein of unknown function DUF2133 [Shewanella baltica BA175]
 gi|304351442|gb|EFM15841.1| Protein of unknown function DUF2133 [Shewanella baltica OS183]
 gi|306914292|gb|EFN44713.1| Protein of unknown function DUF2133 [Shewanella baltica BA175]
          Length = 206

 Score = 63.5 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 66/194 (34%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      +     + F + 
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGNSILIGAVVGLGGLYAWNYYSDVKVAQAEEASKAFHE- 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   ++++        E   S D K Y  L  + +A   V   D   A E   KV     
Sbjct: 60  LTTKSADEAAMLAGVAEFSKSHDQKGYQALLELIVAKTAVEAKDYPKAIEALNKVIA-AK 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   ATL+ A I  +    +     L ++++         +E+ G   ++ G+V+K
Sbjct: 119 PGAGLDVIATLRVARIQAEQGQIDAALATLDQVTDK--AFFAQRDELKGDFLVRQGEVEK 176

Query: 181 AKTIFEELAKDNNS 194
           AKT ++    +   
Sbjct: 177 AKTAYQAAMDNGGV 190


>gi|153833527|ref|ZP_01986194.1| tetratricopeptide TPR_2 [Vibrio harveyi HY01]
 gi|156973382|ref|YP_001444289.1| hypothetical protein VIBHAR_01069 [Vibrio harveyi ATCC BAA-1116]
 gi|148870178|gb|EDL69119.1| tetratricopeptide TPR_2 [Vibrio harveyi HY01]
 gi|156524976|gb|ABU70062.1| hypothetical protein VIBHAR_01069 [Vibrio harveyi ATCC BAA-1116]
          Length = 204

 Score = 63.5 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 73/209 (34%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K           +  ++ L     +  +  S  +      +++   
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQDSVIQASEAASQSYTTV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    +   D        I S + K Y+ L+ + +A + V   D   A E  LK A  + 
Sbjct: 61  MNALQTKGADAQADIQAFIDSNEVKEYSVLAALQLAKVQVDAKDLSAALE-QLKWAQSNT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    + + A I  +  +++  +  L K++           E+ G  AL+ G  + 
Sbjct: 120 KDAALSPLISYRIARIEAEMGNFDAANAELGKVT--DAAWTGRIAELRGDIALRQGDKEA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  +  ++   +    QM L ++
Sbjct: 178 AYAAYTEAQQAADASPTL----QMKLDDL 202


>gi|325915369|ref|ZP_08177686.1| hypothetical protein XVE_1577 [Xanthomonas vesicatoria ATCC 35937]
 gi|325538416|gb|EGD10095.1| hypothetical protein XVE_1577 [Xanthomonas vesicatoria ATCC 35937]
          Length = 212

 Score = 63.5 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 57/173 (32%), Gaps = 10/173 (5%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +      +       +   ++      LD A      +      +Y  L+ + +A  
Sbjct: 41  WQWWQKHTNTELVEANARYEAVVKSIQGKDLDKAAKDIVALDDGKGGIYAELAALRLAKA 100

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V  G    A     K   D  A   +++    + A +L ++   +E  K+L    + ++
Sbjct: 101 QVDAGKNAEAI----KTLRDVPAEGELKHIVQQRLARVLTESGKPDEAIKLLADAQDNAS 156

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
                  EI   + +  GK  +A+ ++ +     +         +  L ++  
Sbjct: 157 ------LEIRADALVVQGKTDEARALYAKALTTVDVASPQRRLLETKLIDVGG 203


>gi|332992291|gb|AEF02346.1| putative membrane-associated protein with TPR-like domain
           [Alteromonas sp. SN2]
          Length = 206

 Score = 63.5 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/214 (13%), Positives = 69/214 (32%), Gaps = 9/214 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     +      K     +     +   + L     +  +  +    K      +  A
Sbjct: 1   MEQFATEDQQVEAIKRFWKEHGTAIIVGAALGLGGLWGWRYYSDTQMATKEAASVEYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +E +      D  ++F  I + ++  Y  ++++  A   V  GD   AA   L       
Sbjct: 61  VETYGEEGSADKITAF--INANEDSGYASVASLLAAKQAVDAGDFD-AAASHLNRVVTFA 117

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  A ++   + ++ +  +     L  ++          +E+ G    +  K   
Sbjct: 118 ENEELKALAAIRLTRVQIEMNQLDAALSTLGNITN--EAFAAEVSELKGDVYQQQSKFDD 175

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
           A+  +    + N +   +    QM L N+  +  
Sbjct: 176 ARLAYSGALEKNANNPLL----QMKLDNLAVAAG 205


>gi|304311810|ref|YP_003811408.1| hypothetical protein HDN1F_21800 [gamma proteobacterium HdN1]
 gi|301797543|emb|CBL45763.1| Hypothetical protein HDN1F_21800 [gamma proteobacterium HdN1]
          Length = 232

 Score = 63.1 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/216 (11%), Positives = 59/216 (27%), Gaps = 21/216 (9%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNS----- 66
              K     Y     +   + L++   +  +  S + K +     + Q  +   +     
Sbjct: 16  QAIKDWWKDYGNTVLIGFGLALAILFGWKAWQSSAKDKSDTAATAYMQMQDAAQAMRQQP 75

Query: 67  -------------NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFL 113
                         +        E+I          +      +      +   AAE+ L
Sbjct: 76  PVASAADGSKVETPQHATFLHMAEQIKKDYPDSGYAIMAALQLARDKVDNNDAAAAEVEL 135

Query: 114 KVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISAL 173
           + A D     A+     ++ A +L      +   K+L+ +            E+ G    
Sbjct: 136 RWALDHKPNPALTTIINMRLARVLAMKGDIDGGLKVLEGI--QPEAQRAEYEEVKGDLYY 193

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
             G + KA+  ++                +  L ++
Sbjct: 194 AKGDMTKAREAYQASMNAGGGSAS-QAILKTKLDDL 228


>gi|261379854|ref|ZP_05984427.1| tetratricopeptide repeat protein [Neisseria subflava NJ9703]
 gi|284797550|gb|EFC52897.1| tetratricopeptide repeat protein [Neisseria subflava NJ9703]
          Length = 209

 Score = 63.1 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/193 (12%), Positives = 49/193 (25%), Gaps = 2/193 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K   +WI  LLI+  L    +         K +           +           +  
Sbjct: 18  WKRTGRWIFALLIVAALGYLGYTIYQGQKASKDQEAAAVLAQMVEKAQQKTDPKAINADL 77

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
            ++        +      + +         + AE  L     +     V+  A  +   +
Sbjct: 78  AELQKNYPDSISTAQATLMVAATEFDAGRYDVAEGHLNWVLKNQNAPLVQALAAQRLGVV 137

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           L+    Y+     L    E          E  G   +   K ++A   +E          
Sbjct: 138 LLQQKKYDAAINALNTQVEAD--FEPLMLETKGDVYVAQNKTKEAVQSYEAALSKMPQTA 195

Query: 197 GISTRSQMILANI 209
                 QM + ++
Sbjct: 196 VGRELLQMKIDSL 208


>gi|223041967|ref|ZP_03612151.1| hypothetical protein AM202_0562 [Actinobacillus minor 202]
 gi|223017224|gb|EEF15652.1| hypothetical protein AM202_0562 [Actinobacillus minor 202]
          Length = 208

 Score = 63.1 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/198 (9%), Positives = 54/198 (27%), Gaps = 4/198 (2%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K           L I +  +    +  +     +       ++   +E +  +   +
Sbjct: 15  EEAKNWFKANSTPILLAIFICAAATFGWNFWKKHQVESAIQASTSYQNTMEAYLQDPAKN 74

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
                + +       Y   + +      +A+ D   A  +     +       ++     
Sbjct: 75  QPLVAKFLEEAKGTNYAVFAQLEEVKQAIAQADYAKAQTLLQNELSATN-DATLQIVIRF 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A I      Y+E   +L ++             +        G    AK+ +E+  K 
Sbjct: 134 RLAEIGYQLKQYDEALAVLAQI--QGRAWESRKQLLSADILSAKGDKAAAKSAYEQ-LKT 190

Query: 192 NNSPFGISTRSQMILANI 209
             +         + + N+
Sbjct: 191 TATSESEKALIDLKINNL 208


>gi|258545521|ref|ZP_05705755.1| conserved hypothetical protein [Cardiobacterium hominis ATCC 15826]
 gi|258519221|gb|EEV88080.1| conserved hypothetical protein [Cardiobacterium hominis ATCC 15826]
          Length = 210

 Score = 63.1 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 57/191 (29%), Gaps = 5/191 (2%)

Query: 7   ANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNS 66
                   +     Y       +++ L     +  +    E ++          L+    
Sbjct: 9   DEETVELIREWLQQYGLTIIAGLVLGLGAIGGYRYWQNQQETQRLNESAQLDTLLQALEK 68

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
           N L  A + ++ +L + + +    +    ++   A         + L  A        V 
Sbjct: 69  NDLQAAAAPYDALLKESSDITALAALNMASAYQKADKKEDAQTALKLAAA---SPDPLVA 125

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
            +A  Q A   V+   Y+   +    L    +     A  + G+   K  K+ +A   ++
Sbjct: 126 QSARWQQALFQVENGDYDAALQSADALKN--SAYAPQAAALQGLILEKQNKLPEALQAWQ 183

Query: 187 ELAKDNNSPFG 197
              +   SP  
Sbjct: 184 RSQELAPSPAT 194


>gi|307822497|ref|ZP_07652728.1| Protein of unknown function DUF2133 [Methylobacter tundripaludum
           SV96]
 gi|307736101|gb|EFO06947.1| Protein of unknown function DUF2133 [Methylobacter tundripaludum
           SV96]
          Length = 213

 Score = 62.7 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/208 (9%), Positives = 71/208 (34%), Gaps = 6/208 (2%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
              K           + ++M + + + +  +    + +       + Q L+  + NK D 
Sbjct: 10  EALKRWWKENSTATIVGLVMGIVIILGWNYWQDHKKAQSAQASATYDQLLKALDENKNDS 69

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
                +++  Q        +   +    +       AA   +           +   A +
Sbjct: 70  VDKLAQRMQEQFKGTEYA-AFSGLFQAKLKSQQGDFAAAKQILKTIAAEPNKQLSNIAKI 128

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL-GISALKFGKVQKAKTIFEELAK 190
           +   +++ T  YE+  +++ ++   +   +    + L G   +   ++ +A+T ++   +
Sbjct: 129 RLVRLMLATGEYEQGLQVINEVDAKAAASYSANYDELVGDLYVALDRLDEARTSYQNALR 188

Query: 191 DNNSPFGISTRSQMILANIIASDQRNKK 218
           +      +    Q  + ++ A ++   +
Sbjct: 189 NGQPSPLL----QFKIDDLAAQEKLETQ 212


>gi|188533176|ref|YP_001906973.1| hypothetical protein ETA_10300 [Erwinia tasmaniensis Et1/99]
 gi|188028218|emb|CAO96076.1| Conserved hypothetical protein [Erwinia tasmaniensis Et1/99]
          Length = 206

 Score = 62.7 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 71/211 (33%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  ++ N      K           + +++ +   I + L+    +     V   + QA
Sbjct: 1   MEVYSNENEQTDALKNFFAQNGKALVVGVVLGVGALIGWRLWSNQQDSGSREVSAAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               +++K     ++ +      N  Y  L+++ +A   +       AAE       +  
Sbjct: 61  TTGLDASKPASLAAAAKFASENSN-TYGALASLDVAKRYIDSNQLDKAAEQLQNGLKNTQ 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    ++ A I +     + + K L  +            ++ G + L  G  Q 
Sbjct: 120 -DANLQAVLNVRLARIQLQQKQPDAVLKTLDNVKGDG--WTAIVADVRGEALLSKGDTQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +    + +   +    QM + N+  
Sbjct: 177 ARDAWSKGIASDGASS-LKEMLQMKVNNLPG 206


>gi|260072546|gb|ACX30446.1| hypothetical protein SUP05_FGYC13F180010 [uncultured SUP05 cluster
           bacterium]
 gi|269468504|gb|EEZ80162.1| hypothetical protein Sup05_0385 [uncultured SUP05 cluster
           bacterium]
          Length = 205

 Score = 62.7 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 26/210 (12%), Positives = 71/210 (33%), Gaps = 9/210 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           +E +   +    + K             ++M LS    F  +     ++      ++   
Sbjct: 5   IEVHKTEDEQAEQIKKWIKENGGQIVAGVVMGLSAIWGFDYYKNYQNEQSTQARSHYLSL 64

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   N+ +      SF+K+ +          +  + +           A  +L    +  
Sbjct: 65  VVNPNNTE------SFDKLQNNYTGSGYVDQSSLLMAKNAVNNKQYQQALDYLSPLLE-S 117

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               V ++A L+ A+I ++ ++Y++   +L+     +N      N   G   L    +  
Sbjct: 118 ENEFVAHSAKLRMAAIHLEMNNYDQALSVLEA--TENNAFSGLYNHTKGDVYLAQNNIDS 175

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANII 210
           AK  +       ++   + +  ++ L ++ 
Sbjct: 176 AKKHYRLALSQLSNDSELKSLIKIKLNDLN 205


>gi|217972555|ref|YP_002357306.1| hypothetical protein Sbal223_1375 [Shewanella baltica OS223]
 gi|217497690|gb|ACK45883.1| conserved hypothetical protein [Shewanella baltica OS223]
          Length = 206

 Score = 62.7 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 65/194 (33%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +   + L     +  +      +     + F + 
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGTSIFIGAFVGLGGLYAWNYYSDVKVAQAEEASKAFHE- 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   +S++        E   S D K Y  L  + +A   V   D   A E   KV     
Sbjct: 60  LTTKSSDEAAMLAGVAEFSKSHDQKGYQALLELIVAKTAVEAKDYSKAIEALNKVIA-AK 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   ATL+ A I  +    +     L ++++         +E+ G   ++ G+V+K
Sbjct: 119 PGAGLDVIATLRVARIQAEQGQIDAALATLDQVTDK--AFFAQRDELKGDFLVRQGEVEK 176

Query: 181 AKTIFEELAKDNNS 194
           AKT ++    +   
Sbjct: 177 AKTAYQAAMDNGGV 190


>gi|294637687|ref|ZP_06715965.1| putative membrane protein [Edwardsiella tarda ATCC 23685]
 gi|291089163|gb|EFE21724.1| putative membrane protein [Edwardsiella tarda ATCC 23685]
          Length = 206

 Score = 62.7 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 72/211 (34%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +  N      +     Y     + +++ +     +  +    +       + + QA
Sbjct: 1   MEVYSTENEQVDAIRHFLQEYGKTLVVGVVIGVGALFGWRYWANHQQAGMAQASQTYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E  +  K D    S   I    N  Y  L+ + +A   V K +    A+  L  A    
Sbjct: 61  SEALSGGKQDGVALSEAFIKENAN-NYGVLAALQLAQHEVDKAEFSK-AQSQLAWAAGQA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  + L+ A + +  +  +   K L  ++         A ++ G   LK G  + 
Sbjct: 119 KDENLKALSDLRLARVQLQDNQLDAALKTLDGVTAKG--WQALAQDVRGDVLLKKGDAKG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +      +   +    +M L N+ +
Sbjct: 177 AREAYSKGLA-EGASQSLQALLRMKLNNLSS 206


>gi|312173200|emb|CBX81455.1| UPF0070 protein 1057 [Erwinia amylovora ATCC BAA-2158]
          Length = 206

 Score = 62.3 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/211 (13%), Positives = 69/211 (32%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  ++        K           + +++ +   I +  +    +     V   + Q 
Sbjct: 1   MEVYSNDQEQTDALKNFFAQNGKALVVGVVLGVGALIGWRFWSNHQDSGSREVSAAYQQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               +++K     ++ +      N  Y  L+++ +A   +       AAE       +  
Sbjct: 61  TTALDASKPASIAAAAKFASENSN-TYGALASLDVAKRYIDNNQLDKAAEQLQSGLKNTQ 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I +     + + K L  +            ++ G + L  G VQ 
Sbjct: 120 -DANLQAVLNLRLARIQLQQKQPDAVLKTLDSVKGDG--WATIVADVRGEALLSKGDVQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +     ++   +    QM + N+  
Sbjct: 177 ARDAWGKGIAS-DASSSLKEMLQMKVNNLPG 206


>gi|292489045|ref|YP_003531932.1| hypothetical protein EAMY_2577 [Erwinia amylovora CFBP1430]
 gi|292900174|ref|YP_003539543.1| membrane protein [Erwinia amylovora ATCC 49946]
 gi|291200022|emb|CBJ47147.1| putative membrane protein [Erwinia amylovora ATCC 49946]
 gi|291554479|emb|CBA22005.1| UPF0070 protein 1057 [Erwinia amylovora CFBP1430]
          Length = 206

 Score = 62.3 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/211 (13%), Positives = 69/211 (32%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  ++        K           + +++ +   I +  +    +     V   + Q 
Sbjct: 1   MEVYSNDQEQTDALKNFFAQNGKALVVGVVLGVGALIGWRFWSNHQDSGSREVSAAYQQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               +++K     ++ +      N  Y  L+++ +A   +       AAE       +  
Sbjct: 61  TTALDASKPASIAAAAKFASENSN-TYGALASLDVAKRYIDNNQLDKAAEQLQSGLKNTQ 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I +     + + K L  +            ++ G + L  G VQ 
Sbjct: 120 -DANLQAVLNLRLARIQLQQKQPDAVLKTLDGVKGDG--WATIVADVRGEALLSKGDVQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +     ++   +    QM + N+  
Sbjct: 177 ARDAWGKGIAS-DASSSLKEMLQMKVNNLPG 206


>gi|319637813|ref|ZP_07992579.1| hypothetical protein HMPREF0604_00202 [Neisseria mucosa C102]
 gi|317400968|gb|EFV81623.1| hypothetical protein HMPREF0604_00202 [Neisseria mucosa C102]
          Length = 209

 Score = 62.3 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 24/193 (12%), Positives = 49/193 (25%), Gaps = 2/193 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K   +WI  LLI+  L    +         K +           +           +  
Sbjct: 18  WKKTGRWIFALLIVAALGYLGYTIYQGQKASKDQEAAAVLAQMVEKAQQKTDQKAINADL 77

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
            ++        +      + +         + AE  L     +     V+  A  +   +
Sbjct: 78  VELQKNYPDSISTAQATLMVAATEFDAGRYDVAEGHLNWVLKNQKAPLVQALAAQRLGVV 137

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           L+    Y+     L    E          E  G   +   K ++A   +E          
Sbjct: 138 LLQQKKYDAAINALNTQVEAD--FEPLMLETKGDVYVAQNKTKEAVQSYEAALSKLPQTA 195

Query: 197 GISTRSQMILANI 209
                 QM + ++
Sbjct: 196 VGRELLQMKIDSL 208


>gi|149190088|ref|ZP_01868365.1| hypothetical protein VSAK1_12050 [Vibrio shilonii AK1]
 gi|148836118|gb|EDL53078.1| hypothetical protein VSAK1_12050 [Vibrio shilonii AK1]
          Length = 204

 Score = 62.3 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 34/202 (16%), Positives = 75/202 (37%), Gaps = 3/202 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K           L +++ L     +  +  S    +    E + +A
Sbjct: 1   MELYDSEEQQVEAIKDWWKENGKAVVLGVVVGLGGLFGWRYYQDSVTSAQEAASEQYTKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +E   +   D +      I    +  Y+ L+++ +A + V  G+ + A E  L+ A    
Sbjct: 61  VEAIAAKGTDASGDVQAFIDGSKDTEYSVLASLQLAKVQVEAGELEKALE-QLQWAQSKT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    T + A ++ +T + +     L K++   +       E+ G  A++ G    
Sbjct: 120 KDAAITPLVTYRIARLMAETGNVDGARAELAKIT--DDAWAGRVAELRGDIAIRDGDRDA 177

Query: 181 AKTIFEELAKDNNSPFGISTRS 202
           A T + E  +  ++  G+  + 
Sbjct: 178 AYTAYTEAQQAQDASQGLQIKL 199


>gi|269962409|ref|ZP_06176759.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269832905|gb|EEZ87014.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 204

 Score = 62.3 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 72/209 (34%), Gaps = 7/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K           +  ++ L     +  +  S  +      +++   
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVIIGAVVGLGGLFGWRYYQDSVIQASEAASQSYTTV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    +   D        I S + K Y+ L+ + +A + V   D   A E  LK A  + 
Sbjct: 61  MNALQTKGADAQADIQAFIDSNEVKEYSVLAALQLAKVQVDAKDLSAALE-QLKWAQSNT 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+    + + A I  +  +++  +  L K++           E  G  AL+ G  + 
Sbjct: 120 KDAALSPLISYRIARIEAEMGNFDAANAELDKVT--DAAWTGRIAEQRGDIALRQGDKEA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + E  +  ++   +    QM L ++
Sbjct: 178 AYAAYTEAQQAADASPTL----QMKLDDL 202


>gi|329897035|ref|ZP_08271807.1| membrane protein [gamma proteobacterium IMCC3088]
 gi|328921475|gb|EGG28861.1| membrane protein [gamma proteobacterium IMCC3088]
          Length = 227

 Score = 62.3 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/222 (11%), Positives = 61/222 (27%), Gaps = 9/222 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M++           K             +++ +  ++ +  +      +       + + 
Sbjct: 1   MDAYRTEEEQVEAIKRWWSENGKGVIAAVVIGVLGSVGWQSWQDRQVSQAEAASGIYQEL 60

Query: 61  LELFNSNKLDDARSS------FEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           L L       DA                    Y  L  +   S  V++G  + A      
Sbjct: 61  LALSAQELSSDADKVRLDELTATLTEDYAGTGYARLGQLLQVSAWVSQGRAEEALTALQA 120

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALK 174
           + +     +A+     L+ A +       E+  + L  L   ++ +     +      + 
Sbjct: 121 LESSVADDVAMYPIVKLRRARLQASLGDTEQALQALTSL--ETSAVAAAVWQAKADIYIV 178

Query: 175 FGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
             +   A      LA   +    + +  +  LA + A    N
Sbjct: 179 QEQYSLAAEA-LSLALVADENGDLRSDLETKLAFVNARRDSN 219


>gi|254281570|ref|ZP_04956538.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]
 gi|219677773|gb|EED34122.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]
          Length = 224

 Score = 62.3 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 22/219 (10%), Positives = 56/219 (25%), Gaps = 5/219 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  +          K             +++     + +  +      ++    + +   
Sbjct: 1   MSEHLQDEEQVEALKRWWSENGKSTLAAVVLAAGGTVGWQQYQAYSLDQRMEASQGYRAM 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKL--YNPLSNMYIASILVAKGDTKNAAEIFLKVAND 118
             + +S           + +  D     Y   + M +A+  VA  D   A          
Sbjct: 61  TAIASSGSESARVDDLGEAIRSDFSGSIYAQFAAMEVAANAVANDDFAKAESELRWALGA 120

Query: 119 DLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKV 178
                A+     L+ A +L    +      I   L   S+         LG      G+ 
Sbjct: 121 GDPDSALGQLIQLRLARVLTAAGNEAGALAI---LESGSSAYPLGFALALGDLHFTAGRN 177

Query: 179 QKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
            +A   +       ++           + ++ ++   + 
Sbjct: 178 DEALQAYRNARLTASALGVNPAALDEKIVSLESAAMADA 216


>gi|229844542|ref|ZP_04464682.1| hypothetical protein CGSHi6P18H1_09510 [Haemophilus influenzae
           6P18H1]
 gi|229812791|gb|EEP48480.1| hypothetical protein CGSHi6P18H1_09510 [Haemophilus influenzae
           6P18H1]
          Length = 204

 Score = 62.3 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/209 (10%), Positives = 60/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE+ L  A    
Sbjct: 61  INSVQQDEQTKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEVNLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|152979677|ref|YP_001345306.1| hypothetical protein Asuc_2025 [Actinobacillus succinogenes 130Z]
 gi|150841400|gb|ABR75371.1| conserved hypothetical protein [Actinobacillus succinogenes 130Z]
          Length = 202

 Score = 62.3 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 66/193 (34%), Gaps = 8/193 (4%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
               YK +  + ++ +  +  W   +      K   +   + QA+   +  K      +F
Sbjct: 18  WNENYKSLIAIFVIALAGVIGWR-YWQDYQTVKAQEMSMAYEQAISHQDGAKKQTQIDAF 76

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
             + + +   Y  L+ +  A   V K D   +A   LK A        +   A ++ A +
Sbjct: 77  --VQANEKTGYAALALLEKAKDAVNKQDFA-SAAEVLKQAAFHAPEPVLAATANMRLAEV 133

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
                 ++     L ++ E      +          L  G    AK  FEE+ K  N+  
Sbjct: 134 QFQQKDFDGALATLAQVKETGFANPKTLLT--AEIQLAKGDKASAKAGFEEVLK--NATA 189

Query: 197 GISTRSQMILANI 209
                +Q+ L N+
Sbjct: 190 LEQQEAQVRLNNL 202


>gi|294670886|ref|ZP_06735742.1| hypothetical protein NEIELOOT_02590 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307373|gb|EFE48616.1| hypothetical protein NEIELOOT_02590 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 209

 Score = 61.9 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 25/193 (12%), Positives = 53/193 (27%), Gaps = 2/193 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            +   +W+  +L+L  L    W         K +           +   S      ++  
Sbjct: 18  WRSKGRWLFVVLLLASLVYLGWVLYQGHIKTKNEEAATALAGLVEKAKTSQDKQSLQADL 77

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
             +     +  +      + +  +       AAE  L     +     VR  A  + A++
Sbjct: 78  SILQQNYPESISSAQATMMVAADLFDQGQYEAAEKQLNWVLQNQQIPFVRALAIQRLATV 137

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
            +    Y+     LQ              E  G      GK ++A  ++E+         
Sbjct: 138 QLQQKKYDAALATLQM--PVDAAFEALILETQGDVLYAQGKNKEALAVYEQALAKTVQDA 195

Query: 197 GISTRSQMILANI 209
                 Q+    +
Sbjct: 196 PGLQLLQLKADEL 208


>gi|167856484|ref|ZP_02479200.1| hypothetical protein HPS_02663 [Haemophilus parasuis 29755]
 gi|167852393|gb|EDS23691.1| hypothetical protein HPS_02663 [Haemophilus parasuis 29755]
          Length = 206

 Score = 61.9 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 20/187 (10%), Positives = 54/187 (28%), Gaps = 3/187 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K           + I ++ +    +  +     +       ++ Q +E +  N   +
Sbjct: 14  EEAKSWFKENGTPIVVAIFLVAAATFGWNYWQKHQIEVAQTTSASYQQVMESYLQNPEKN 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A    + I    +  Y   + +  A     KGD      +  +          ++     
Sbjct: 74  APLVQKFIAENKDSSYAVFAQLEEAKQAADKGDFATTKTLLTQSLG-STTDATLQNVIRF 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A++      ++     L ++ +           + G      G    AK+ +E+  + 
Sbjct: 133 RLATVDYQLKEFDAALATLSQIKDT--AWDFRKQLLTGDLLAAKGDKAAAKSAYEQAKEK 190

Query: 192 NNSPFGI 198
                 I
Sbjct: 191 AGDANQI 197


>gi|145632617|ref|ZP_01788351.1| hypothetical protein CGSHi3655_02344 [Haemophilus influenzae 3655]
 gi|144986812|gb|EDJ93364.1| hypothetical protein CGSHi3655_02344 [Haemophilus influenzae 3655]
          Length = 204

 Score = 61.9 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 22/209 (10%), Positives = 60/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE+ L  A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEVNLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|26987591|ref|NP_743016.1| hypothetical protein PP_0855 [Pseudomonas putida KT2440]
 gi|148546129|ref|YP_001266231.1| hypothetical protein Pput_0885 [Pseudomonas putida F1]
 gi|24982267|gb|AAN66480.1|AE016276_15 conserved hypothetical protein [Pseudomonas putida KT2440]
 gi|148510187|gb|ABQ77047.1| conserved hypothetical protein [Pseudomonas putida F1]
          Length = 213

 Score = 61.9 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 59/204 (28%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF----NSNKL 69
            K              L+   + + +  +      +     + +   +E           
Sbjct: 12  VKDWWNRNGKPLLTGALLAGVVVLGWNTWHKYQTNQSQGASQLYQALIETSLTPTGQPDA 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +       + A   LK   D  A + +   +
Sbjct: 72  TKVAELAGKLKSEFGGTAYAQYGSLFVAKVAVDSGKLDDAAAELKSVLDKPADVTLGEIS 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  E+  K+L    +          E+ G   ++ G+   A + +E+ A
Sbjct: 132 RQRLARVLAAQNKAEDALKLLDG--DADKAFLASREELKGDLLVQLGRADDAHSAYEK-A 188

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
           K   S        Q+ L ++   D
Sbjct: 189 KAALSDDAAVGGLQLKLDDLAKGD 212


>gi|218507875|ref|ZP_03505753.1| hypothetical protein RetlB5_09820 [Rhizobium etli Brasil 5]
          Length = 160

 Score = 61.9 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 35/149 (23%), Positives = 74/149 (49%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +      + K     +     +  ++I+       L+D   + + +  G+ F  A++L 
Sbjct: 12  VNEELRSDQMKGAWRRFGRYIIVAAILIVVGTAGKVLYDYWDDTRSSGAGDQFLAAMKLA 71

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           + NK D+A ++ +K+  + +  Y  L+ M  A++   KGD   A   F ++  D+  P A
Sbjct: 72  DENKNDEALAALDKLEKEGHGAYPVLARMRAATVQAQKGDANAAIAAFNEIGKDNGVPAA 131

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKL 153
           VR AA ++A  +L++  SYE++S  ++++
Sbjct: 132 VRDAARMRAGWLLIENGSYEQVSAAIEEM 160



 Score = 35.0 bits (78), Expect = 6.9,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 26/76 (34%), Gaps = 1/76 (1%)

Query: 130 TLQAASILVDTSSYEEISKILQKL-SEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
              AA  L D +  +E    L KL  E        A         + G    A   F E+
Sbjct: 63  QFLAAMKLADENKNDEALAALDKLEKEGHGAYPVLARMRAATVQAQKGDANAAIAAFNEI 122

Query: 189 AKDNNSPFGISTRSQM 204
            KDN  P  +   ++M
Sbjct: 123 GKDNGVPAAVRDAARM 138


>gi|313497224|gb|ADR58590.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 213

 Score = 61.9 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 59/204 (28%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF----NSNKL 69
            K              L+   + + +  +      +     + +   +E           
Sbjct: 12  VKDWWSRNGKPLLTGALLAGVVVLGWNTWHKYQNNQSQGASQLYQALIETSLTPTGQPDA 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +       + A   LK   D+ A + +   +
Sbjct: 72  TKVAELAGKLKSEFGGTAYAQYGSLFVAKVAVDSGKLDDAAAELKSVLDNPADVTLGEIS 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L      E+  K+L    +          E+ G   ++ G+   A + +E+ A
Sbjct: 132 RQRLARVLAAQDKAEDALKLLDG--DADKAFLASREELKGDLLVQLGRTNDAHSAYEK-A 188

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
           K   S        Q+ L ++   D
Sbjct: 189 KAALSDDAAVGGLQLKLDDLAKGD 212


>gi|219871011|ref|YP_002475386.1| hypothetical protein HAPS_0802 [Haemophilus parasuis SH0165]
 gi|219691215|gb|ACL32438.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 206

 Score = 61.9 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/177 (10%), Positives = 52/177 (29%), Gaps = 3/177 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K           + I ++ +    +  +     +       ++ Q +E +  N   +
Sbjct: 14  EEAKSWFKENGTPIVVAIFLVAAATFGWNYWQKHQIEVAQTTSASYQQVMESYLQNPEKN 73

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A    + I    +  Y   + +  A     KGD      +  +          ++     
Sbjct: 74  APLVQKFIAENKDSSYAVFAQLEEAKQAADKGDFATTKTLLTQSLG-STTDATLQNVIRF 132

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           + A++      ++     L ++ +           + G      G    AK+ +E+ 
Sbjct: 133 RLATVDYQLKEFDAALATLSQIKDT--AWDFRKQLLTGDLLAAKGDKAAAKSAYEQA 187


>gi|241758627|ref|ZP_04756741.1| tetratricopeptide repeat-containing domain protein [Neisseria
           flavescens SK114]
 gi|241321138|gb|EER57334.1| tetratricopeptide repeat-containing domain protein [Neisseria
           flavescens SK114]
          Length = 209

 Score = 61.9 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 24/193 (12%), Positives = 48/193 (24%), Gaps = 2/193 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K   +WI  LLI+  L    +         K +           +           +  
Sbjct: 18  WKSIGRWIFTLLIVASLGYLGYTIYQGQKASKDQEAAAVLAQMVEKAQQKTDQKAINADL 77

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
            ++        +      + +         + AE  L     +     V+  A  +    
Sbjct: 78  AELQKNYPDSISTAQATLMVAATEFDAGRYDVAEGHLNWVLKNQNAPLVQALAAQRLGVT 137

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           L+    Y+     L    E          E  G   +   K ++A   +E          
Sbjct: 138 LLQQKKYDAAINALNTQVEAD--FEPLMLETKGDVYVAQNKTKEAVQSYEAALSKMPQTA 195

Query: 197 GISTRSQMILANI 209
                 QM + ++
Sbjct: 196 VGRELLQMKIDSL 208


>gi|145631823|ref|ZP_01787582.1| hypothetical protein CGSHi22421_06618 [Haemophilus influenzae
           R3021]
 gi|144982542|gb|EDJ90096.1| hypothetical protein CGSHi22421_06618 [Haemophilus influenzae
           R3021]
          Length = 204

 Score = 61.9 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 22/209 (10%), Positives = 59/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQSHQAEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE  L  A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEANLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|259907720|ref|YP_002648076.1| hypothetical protein EpC_10480 [Erwinia pyrifoliae Ep1/96]
 gi|224963342|emb|CAX54827.1| conserved uncharacterized protein [Erwinia pyrifoliae Ep1/96]
 gi|283477574|emb|CAY73490.1| UPF0070 protein 1057 [Erwinia pyrifoliae DSM 12163]
 gi|310764772|gb|ADP09722.1| conserved uncharacterized protein [Erwinia sp. Ejp617]
          Length = 206

 Score = 61.6 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 27/211 (12%), Positives = 71/211 (33%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  ++ +      K           + +++ +   I + ++    +     V   + Q 
Sbjct: 1   MEVYSNEHEQTDALKNFFAQNGKALVVGVVLGVGALIGWRIWSNHQDSGSREVSAAYQQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               +++K     ++ +      N  Y  L+++ +A   +       AAE       +  
Sbjct: 61  TTALDASKPASIAAAAQFASENSN-TYGALASLDVAKRYIDNNQLDKAAEQLQSGLKNTQ 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++    L+ A I +     + + K L  +            ++ G + L  G +Q 
Sbjct: 120 -DANLQAVLNLRLARIQLQQKQPDAVLKTLDSVKGDG--WATIVADVRGEALLSKGDIQG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +     ++   +    QM + N+  
Sbjct: 177 ARDAWSKGIAS-DASSSLKEMLQMKVNNLPG 206


>gi|301169072|emb|CBW28669.1| conserved protein [Haemophilus influenzae 10810]
          Length = 204

 Score = 61.6 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 22/209 (10%), Positives = 58/209 (27%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQTHQVEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE  L  A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEANLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVK--GESFNARKTILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE   +           ++M L N+
Sbjct: 178 AKNSFEHAQQSG--SQLEQQMAKMKLNNL 204


>gi|319896699|ref|YP_004134892.1| hypothetical protein HIBPF03170 [Haemophilus influenzae F3031]
 gi|317432201|emb|CBY80553.1| conserved hypothetical protein [Haemophilus influenzae F3031]
          Length = 204

 Score = 61.6 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 22/209 (10%), Positives = 59/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQTHQAEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE  L  A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEANLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|309972471|gb|ADO95672.1| Conserved hypothetical protein [Haemophilus influenzae R2846]
          Length = 204

 Score = 61.6 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/209 (10%), Positives = 60/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE+ L  A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEVNLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L ++
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNDL 204


>gi|167031913|ref|YP_001667144.1| hypothetical protein PputGB1_0898 [Pseudomonas putida GB-1]
 gi|166858401|gb|ABY96808.1| conserved hypothetical protein [Pseudomonas putida GB-1]
          Length = 213

 Score = 61.6 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 27/204 (13%), Positives = 60/204 (29%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF----NSNKL 69
            K              L+   + + +  +      +     + +   LE           
Sbjct: 12  VKDWWNRNGKPLLTGALLAGVVVLGWNTWHKYQNNQSQGASQLYQALLETSLTPTGQPDA 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +  +    + A   LK   D  A + +   +
Sbjct: 72  TKVAELSGKLKSEFGGTAYAQYGSLFVAKVAVETGKLDDAAAELKSVLDKPADVTLGEIS 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  E+  K+L    +          E+ G   ++ G+   A + +E+ A
Sbjct: 132 RQRLARVLAAQNKAEDALKLLDG--DADKAFLASREELKGDLLVQLGRADDAHSAYEK-A 188

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
           K   S        Q+ L ++   D
Sbjct: 189 KAALSDDAAVGGLQLKLDDLAKGD 212


>gi|192361013|ref|YP_001981970.1| hypothetical protein CJA_1483 [Cellvibrio japonicus Ueda107]
 gi|190687178|gb|ACE84856.1| conserved hypothetical protein [Cellvibrio japonicus Ueda107]
          Length = 233

 Score = 61.6 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 32/218 (14%), Positives = 69/218 (31%), Gaps = 12/218 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  +          K        +     ++ ++       +     +K      ++ Q 
Sbjct: 1   MSIHLSEEEQLENLKRWWKENGKLIIGAAVIAIAGYFGVTSWQDHQRQKAEQASASYEQL 60

Query: 61  LELFN--------SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
           ++LFN                    ++ +  + +Y   +  ++A + V       A    
Sbjct: 61  IKLFNTEPGKTLSEADRATVVHLANELKAGSSSMYAYTAAFFLAKLAVEDNKLDAAVSEL 120

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA 172
             V +      A    A L+ A +L+   SY+E    L    EP+       NE+ G + 
Sbjct: 121 KWVLS-AKPDTATAEIARLRLARVLIAQQSYDEALTQLAS--EPAAAFATEYNELRGDAL 177

Query: 173 LKFGKVQKAKTIFEELAKDNNSPFGIS-TRSQMILANI 209
              G +  A+T +E+     +          QM + ++
Sbjct: 178 KSQGNLDAARTAYEKALAATDPQQQERYMLLQMKVNDL 215


>gi|170725903|ref|YP_001759929.1| tetratricopeptide TPR_4 [Shewanella woodyi ATCC 51908]
 gi|169811250|gb|ACA85834.1| Tetratricopeptide TPR_4 [Shewanella woodyi ATCC 51908]
          Length = 206

 Score = 61.6 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 29/212 (13%), Positives = 67/212 (31%), Gaps = 6/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      +     E F   
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGTSIVVGAVVGLGGLFGWNYYSEHKITQAESASEAFQAM 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                +       ++ E    + ++         I +    +      AE  LK      
Sbjct: 61  --SAPALDEAGMLAAAETFAKEHSQKGYQSLLSLIVAKAAVESGDLEKAETTLKSVIASA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           A  ++   AT++ A +  +          L+++S+P        +E+ G   ++ G  ++
Sbjct: 119 ADTSLVMVATIRLARVQAEQGQIATAITTLEQVSDP--AFTAQRDELKGDFLVRKGDAEQ 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           AK  ++    +  +    +   QM L N+  +
Sbjct: 177 AKAAYQAAVDNGGATASPA--LQMKLDNLNKA 206


>gi|170723484|ref|YP_001751172.1| hypothetical protein PputW619_4323 [Pseudomonas putida W619]
 gi|169761487|gb|ACA74803.1| conserved hypothetical protein [Pseudomonas putida W619]
          Length = 213

 Score = 61.2 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 27/204 (13%), Positives = 60/204 (29%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL----FNSNKL 69
            K              L+   + + +  ++   + +     + +   LE           
Sbjct: 12  VKDWWNRNGKPLLTGALLAGVVVLGWNTWNKYQDNQSQGASQLYQALLETSLTPSGQPDA 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +  +    + A   LK   D  A   +   +
Sbjct: 72  TKVAELSGKLKSEFGGTAYAQYGSLFVAKVAVESGKLDDAAAELKNVLDKPADDTLGEIS 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L      E+  K+L    +          E+ G   ++ G+   A + +E+ A
Sbjct: 132 RQRLARVLAAQDKAEDALKLLDG--DADKAFLASREELKGDLLVQLGRADDAHSAYEK-A 188

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
           K   S        Q+ L ++   D
Sbjct: 189 KAALSDEAAVGGLQLKLDDLAKGD 212


>gi|145640320|ref|ZP_01795904.1| hypothetical protein CGSHiR3021_09685 [Haemophilus influenzae
           R3021]
 gi|145274906|gb|EDK14768.1| hypothetical protein CGSHiR3021_09685 [Haemophilus influenzae
           22.4-21]
          Length = 204

 Score = 61.2 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/209 (11%), Positives = 59/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     N+     +  + + +     Y   + +  A     K D   AAE  L  A    
Sbjct: 61  INSVQQNEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEANLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|16272318|ref|NP_438531.1| hypothetical protein HI0370 [Haemophilus influenzae Rd KW20]
 gi|260580567|ref|ZP_05848395.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|1175233|sp|P43989|Y370_HAEIN RecName: Full=UPF0070 protein HI_0370
 gi|1573339|gb|AAC22028.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092909|gb|EEW76844.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
          Length = 204

 Score = 61.2 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/209 (10%), Positives = 59/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQTHQAEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE  L  A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEANLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALSTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|145638721|ref|ZP_01794330.1| co-chaperone HscB [Haemophilus influenzae PittII]
 gi|145272316|gb|EDK12224.1| co-chaperone HscB [Haemophilus influenzae PittII]
 gi|309750211|gb|ADO80195.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
          Length = 204

 Score = 61.2 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/209 (10%), Positives = 58/209 (27%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIIAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D    AE  L  A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-VAEANLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALSTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|229846457|ref|ZP_04466565.1| hypothetical protein CGSHi7P49H1_07290 [Haemophilus influenzae
           7P49H1]
 gi|229810550|gb|EEP46268.1| hypothetical protein CGSHi7P49H1_07290 [Haemophilus influenzae
           7P49H1]
          Length = 204

 Score = 61.2 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/209 (10%), Positives = 59/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE  L  A    
Sbjct: 61  INSVKQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEANLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|68248973|ref|YP_248085.1| hypothetical protein NTHI0490 [Haemophilus influenzae 86-028NP]
 gi|68057172|gb|AAX87425.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
          Length = 204

 Score = 61.2 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/209 (10%), Positives = 59/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQSHQAEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE  L  A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATQKQDFS-AAEANLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|145628726|ref|ZP_01784526.1| hypothetical protein CGSHi22121_06910 [Haemophilus influenzae
           22.1-21]
 gi|319775763|ref|YP_004138251.1| hypothetical protein HICON_11070 [Haemophilus influenzae F3047]
 gi|144979196|gb|EDJ88882.1| hypothetical protein CGSHi22121_06910 [Haemophilus influenzae
           22.1-21]
 gi|317450354|emb|CBY86570.1| conserved hypothetical protein [Haemophilus influenzae F3047]
          Length = 204

 Score = 60.8 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/209 (10%), Positives = 59/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE  L  A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEANLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALSTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|87118475|ref|ZP_01074374.1| hypothetical protein MED121_15649 [Marinomonas sp. MED121]
 gi|86166109|gb|EAQ67375.1| hypothetical protein MED121_15649 [Marinomonas sp. MED121]
          Length = 213

 Score = 60.8 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/191 (13%), Positives = 69/191 (36%), Gaps = 9/191 (4%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGEN-------F 57
            +  + + + +  K  +K     L+L +      ++ F    + ++N + E         
Sbjct: 2   TELKTEEEQIEAFKTWWKKNGTSLVLAVSLGVAGYFGFQAWQQNQENHLAEASSLFESMS 61

Query: 58  AQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
             A +L     L       +++++  +          + + +   G+  +AA   L  A 
Sbjct: 62  QAATDLSQDENLKTVSFIADQLVNDFDDTGYATFAHLLQAKVDVIGEDYDAAIARLNEAK 121

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
           +    + ++  + L+ + +LV     ++    L  +S           E+ G   L  GK
Sbjct: 122 ESTDDVTLKAISDLRISKVLVHQGELDKALTQLANISLTE--FDSLKLELKGDVLLAQGK 179

Query: 178 VQKAKTIFEEL 188
            ++A+  ++  
Sbjct: 180 EKEARDAYQAA 190


>gi|260913152|ref|ZP_05919634.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260632739|gb|EEX50908.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 204

 Score = 60.8 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/194 (11%), Positives = 62/194 (31%), Gaps = 3/194 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M    +      + K             +++  +  + +  +      K       +   
Sbjct: 1   MAYTIEEEQELNQLKAWWSENHKTVIASVILAFAAILGWNYWKSYQITKTQQTSAAYEYL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    ++  +  +   + +      +Y+ L+ +  A + V +     A +   +   D  
Sbjct: 61  IYRNTTDLTERNKDIEQFVQESGKNVYSTLALLNKAKVEVEQQFYALAEKTLKQAVTD-A 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   A+L+ AS+      Y      L K+    +        ++G  +L  G +  
Sbjct: 120 PDDILASIASLRLASVQYQQHDYNGALDSLNKVKS--DVWDSKKYLLMGDISLAKGDIVS 177

Query: 181 AKTIFEELAKDNNS 194
           AKT +E+  +  + 
Sbjct: 178 AKTNYEKAQEKASP 191


>gi|90417493|ref|ZP_01225416.1| hypothetical protein GB2207_07442 [marine gamma proteobacterium
           HTCC2207]
 gi|90330734|gb|EAS46013.1| hypothetical protein GB2207_07442 [marine gamma proteobacterium
           HTCC2207]
          Length = 255

 Score = 60.4 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/219 (10%), Positives = 69/219 (31%), Gaps = 12/219 (5%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  +          K           L I++ +     +  +    +++       + + 
Sbjct: 1   MADHITEEEQIEALKRWWDENGKQVVLAIVLTVGGYFGWQAWTDHLDEQTAAASLVYQEM 60

Query: 61  LEL---------FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEI 111
           L+           ++++  +     E +  + +          + + L  +G   +AA +
Sbjct: 61  LDNVGDAAAGDVLDADQQAEINQLAETLKQEYSSTQYAYYAALVKAKLAVEGADLSAATV 120

Query: 112 FLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGIS 171
            L+ A D+         A L+ A +     + +   +++Q +      +    +E  G  
Sbjct: 121 ELEWAMDNAEETLSENIARLRLARVQAAAGNLDTALQLVQGVDAGE--LKSAFDEAKGDF 178

Query: 172 ALKFGKVQKAKTIFEELAKDNNS-PFGISTRSQMILANI 209
             + G    A + +E      +      S   Q+ ++ +
Sbjct: 179 YQQQGNSGAAYSAYEAAMMGIDVGNSSASQLLQLKISQV 217


>gi|315185616|gb|EFU19384.1| hypothetical protein SpithDRAFT_1907 [Spirochaeta thermophila DSM
           6578]
          Length = 226

 Score = 60.4 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 32/200 (16%), Positives = 70/200 (35%), Gaps = 12/200 (6%)

Query: 9   SYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEK-------KKNIVGENFAQAL 61
           S   + +     ++W+    +L+++++   F+ +             +   + E FA+  
Sbjct: 11  STTPRVERFFSRFRWVILGTLLLVIAVLTGFFTYQQREAALLDKGTYEVEQLEERFARLQ 70

Query: 62  ELFNSNKLDDARSSFEK----ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
                   D+   S E+    ++    K Y     MY+   L    +  + A I+     
Sbjct: 71  TSDREQVGDEEVLSLEEDLKGVVDTYGKAYPSQRAMYLLGHLAFWQEDWDDASIWFDRLA 130

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS-NPMHQFANEILGISALKFG 176
            +     +   A L AA+   +       +   +K+ E   + +   A   LG      G
Sbjct: 131 KEFPRSYLAAVALLDAAAARENLGDTSGATTRYEKVIEAGFSVLKPRALFSLGRLKESSG 190

Query: 177 KVQKAKTIFEELAKDNNSPF 196
             + A+ I+ +L +D  S  
Sbjct: 191 DREGARQIYTQLLEDYPSSQ 210


>gi|197335105|ref|YP_002155388.1| Tetratricopeptide repeat family protein [Vibrio fischeri MJ11]
 gi|197316595|gb|ACH66042.1| Tetratricopeptide repeat family protein [Vibrio fischeri MJ11]
          Length = 203

 Score = 60.4 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 78/209 (37%), Gaps = 8/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME+           K           +  ++ +   + +  +  S    K      + +A
Sbjct: 1   MEAYETEEQQVEAIKSWWKENGKAVVIGGVVGIGAILGWKYYQSSQITAKETASAAYERA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L    ++  D   S+   I +  +  Y  L+ + +A + V  G  +NA E    VA++  
Sbjct: 61  LTALQASGADAVESTQVFIDANKSSEYASLAALQLAKVQVEAGQLENALEQLNWVASN-S 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              ++   A +++A I  +  +++     L  +            E+ G  AL+ G +  
Sbjct: 120 KDESLTAMAQVRSARIQAEQGNFDAALATLANVK--PASWAARVAELKGDIALRQGDIAT 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A++ + E  +      G++   QM L ++
Sbjct: 178 ARSAYTEALQ-----AGMNQAVQMKLDDL 201


>gi|325272133|ref|ZP_08138565.1| hypothetical protein G1E_04594 [Pseudomonas sp. TJI-51]
 gi|324102729|gb|EGC00144.1| hypothetical protein G1E_04594 [Pseudomonas sp. TJI-51]
          Length = 213

 Score = 60.0 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/204 (13%), Positives = 59/204 (28%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL----FNSNKL 69
            K              L+   + + +  +      +     + +   LE           
Sbjct: 12  VKDWWNRNGKPLLTGALLAGVVVLGWNTWHKYQNNQSQGASQLYQALLETSLTPSGQPDA 71

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
                   K+ S+              + +  +    + A   LK   D  A   +   +
Sbjct: 72  TKVAELAGKLKSEFGGTAYAQYGSLFVAKVAVESGKLDDAAAELKGVLDKPADATLGEIS 131

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +L   +  E+  K+L    +          E+ G   ++ G+   A + +E+ A
Sbjct: 132 RQRLARVLAAQNKAEDALKLLDG--DADKAFLASREELKGDLLVQLGRASDAHSAYEK-A 188

Query: 190 KDNNSPFGISTRSQMILANIIASD 213
           K   S        Q+ L ++   D
Sbjct: 189 KAALSDDAAVGGLQLKLDDLAKGD 212


>gi|312962903|ref|ZP_07777390.1| hypothetical protein PFWH6_4826 [Pseudomonas fluorescens WH6]
 gi|311282930|gb|EFQ61524.1| hypothetical protein PFWH6_4826 [Pseudomonas fluorescens WH6]
          Length = 213

 Score = 60.0 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/170 (11%), Positives = 43/170 (25%), Gaps = 6/170 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF----NSNKLD 70
           K              L+ L +   +  +      +       + Q LE            
Sbjct: 13  KDWWQRNGKPLVTGGLLALVVVFGWQAWHKYQANQSQGASVLYQQLLESTLTPDGKPDAA 72

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT 130
                  ++                 + +       + A + LK   D      +   A 
Sbjct: 73  KVAYLAGELKKDFGGSTYAQYGSLFVAKVAVDSGKLDDASVELKAIVDKPTNPTLGEIAR 132

Query: 131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
            + A +L   S  +E  K+L    +          E+ G   ++ G+  +
Sbjct: 133 QRLAQVLAAQSKADEALKLLDG--DADKAFVATREELKGDLLVQLGRTDE 180


>gi|307718781|ref|YP_003874313.1| hypothetical protein STHERM_c10950 [Spirochaeta thermophila DSM
           6192]
 gi|306532506|gb|ADN02040.1| hypothetical protein STHERM_c10950 [Spirochaeta thermophila DSM
           6192]
          Length = 226

 Score = 60.0 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 32/200 (16%), Positives = 70/200 (35%), Gaps = 12/200 (6%)

Query: 9   SYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEK-------KKNIVGENFAQAL 61
           S   + +     ++W+    +L+++++   F+ +             +   + E FA+  
Sbjct: 11  STTPRVERFFSRFRWVILGTLLLVIAVLTGFFTYQQREAALLDKGTYEVEQLEERFARLQ 70

Query: 62  ELFNSNKLDDARSSFEK----ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
                   D+   S E+    ++    K Y     MY+   L    +  + A I+     
Sbjct: 71  TSDREQVGDEEVLSLEEDLKRVVDTYRKAYPSQRAMYLLGHLAFWQEDWDDASIWFDRLA 130

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS-NPMHQFANEILGISALKFG 176
            +     +   A L AA+   +       +   +K+ E   + +   A   LG      G
Sbjct: 131 KEFPRSYLAAVALLDAAAARENLGDTSGATTRYEKVIEAGFSVLKPRALFSLGRLKESSG 190

Query: 177 KVQKAKTIFEELAKDNNSPF 196
             + A+ I+ +L +D  S  
Sbjct: 191 DREGARQIYTQLLEDYPSSQ 210


>gi|167623301|ref|YP_001673595.1| tetratricopeptide repeat-containing protein [Shewanella
           halifaxensis HAW-EB4]
 gi|167353323|gb|ABZ75936.1| tetratricopeptide TPR_4 [Shewanella halifaxensis HAW-EB4]
          Length = 206

 Score = 60.0 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 75/212 (35%), Gaps = 6/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      +     E+F QA
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGTSVVVGAVVGLGGLFGWNYYSDYQVAQAEAASESF-QA 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   NS+      ++         K Y  L  + +A   V  GD   A      V     
Sbjct: 60  LSNQNSSDAAMLGAAENFAKEHGQKGYQSLLELLVAKSAVEAGDLDKAETTLKTVIA-TN 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              ++   AT++ A +  +   Y      L ++++P++      +E+ G   ++ G+ +K
Sbjct: 119 VDNSIVLIATMRLARVQAEKGQYATAITTLDQITDPASV--AQRDELKGDFLVRQGETEK 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           AK  ++    +  +    +   QM L N+  +
Sbjct: 177 AKVAYQTAVDNGGTMTSPA--LQMKLDNLNKA 206


>gi|77164338|ref|YP_342863.1| hypothetical protein Noc_0820 [Nitrosococcus oceani ATCC 19707]
 gi|254434190|ref|ZP_05047698.1| hypothetical protein NOC27_1121 [Nitrosococcus oceani AFC27]
 gi|76882652|gb|ABA57333.1| conserved hypothetical protein [Nitrosococcus oceani ATCC 19707]
 gi|207090523|gb|EDZ67794.1| hypothetical protein NOC27_1121 [Nitrosococcus oceani AFC27]
          Length = 212

 Score = 60.0 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/168 (15%), Positives = 62/168 (36%), Gaps = 2/168 (1%)

Query: 42  FDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVA 101
           +    + + +     + Q L   + +   +  +S E +L + +     L ++ I +    
Sbjct: 44  WTNYEQSRTSEASSLYQQILAAKDQDANAEIYNSAEHLLQEYSDTPYGLFSVLILAKEDQ 103

Query: 102 KGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMH 161
                  A   LK A +     +++    L+ A +L+   S +E+  +L ++        
Sbjct: 104 ARGDLETATERLKGALEYARHPSLQKVIYLRLARLLLAMGSPQEVLTMLAEVK--PGSFS 161

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
               E+ G + +  G+  +A+  ++E               QM L N+
Sbjct: 162 SAYAELRGDAYVALGQPSEAQLAYQEALLGLGPSEQYRQILQMKLDNL 209


>gi|78186368|ref|YP_374411.1| TPR repeat-containing protein [Chlorobium luteolum DSM 273]
 gi|78166270|gb|ABB23368.1| TPR repeat [Chlorobium luteolum DSM 273]
          Length = 230

 Score = 60.0 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/221 (13%), Positives = 57/221 (25%), Gaps = 7/221 (3%)

Query: 4   NNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL 63
             +  +           YK +    +++IL      + +      ++N      A A   
Sbjct: 11  TEEKKTAVDNLLYFAIRYKNLIAGALILILIGGAAIFFWTERQASRENEAAPMMAAAAMA 70

Query: 64  FNSNKLDDA------RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
           F+      A          + I  Q N   +      + +           A      A+
Sbjct: 71  FDRGDFQRAIDGTEKEPGLKTIAEQYNGTPSGEMAELLLANAYYAIGKPKDALKAFDAAS 130

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
                LA    A   +    +        S +       +N +            L  G 
Sbjct: 131 PVSPDLAAAAIAGKASCQSDLQQYDAAAKSFLSASEKAENNALKAQYLMAAADCRLGAGD 190

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
            +KA  +F ++        G    +Q  L  I    + + K
Sbjct: 191 TEKAGELFGQVVDRYPGSSGARA-AQQALWKISGMQEVSNK 230


>gi|157374573|ref|YP_001473173.1| tetratricopeptide TPR_4 [Shewanella sediminis HAW-EB3]
 gi|157316947|gb|ABV36045.1| tetratricopeptide TPR_4 [Shewanella sediminis HAW-EB3]
          Length = 206

 Score = 59.6 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 34/212 (16%), Positives = 70/212 (33%), Gaps = 6/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      K     E F QA
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGTSIVVGAVVGLGGLFGWNYYSEYKVAKAESASEAF-QA 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +    ++      ++         K Y  L ++ +A   V  GD   A      V     
Sbjct: 60  MSGSATSDAAMLSAAENFAKDHSQKGYQSLLSLIVAKAAVESGDLDKAEAALKSVIG-SA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              ++   AT++ A +  +          L+++S+P         E+ G   ++ G+ + 
Sbjct: 119 PDASLVMVATMRLARVQAEQGQVATAITTLEQVSDP--AFIAQKEELKGDFLVRKGEAEL 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           AK  ++    +  +    +   QM L N+  +
Sbjct: 177 AKAAYQAAVDNGGATSSPA--LQMKLDNLNKA 206


>gi|59711238|ref|YP_204014.1| hypothetical protein VF_0631 [Vibrio fischeri ES114]
 gi|59479339|gb|AAW85126.1| conserved protein [Vibrio fischeri ES114]
          Length = 203

 Score = 59.6 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 78/209 (37%), Gaps = 8/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME+           K           +  ++ +   + +  +  S    K      + +A
Sbjct: 1   MEAYETEEQQVEAIKSWWKENGKAVVIGGVVGIGAILGWKYYQSSQITAKETASAAYERA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L    ++  D   S+   I +  +  Y  L+ + +A + V  G  +NA E    VA++  
Sbjct: 61  LTALQASGADAVESTQAFIDANKSSEYASLAALQLAKVQVEAGQLENALEQLNWVASN-S 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              ++   A +++A I  +  +++     L  +            E+ G  AL+ G +  
Sbjct: 120 KDESLTAMAQVRSARIQAEQGNFDAALATLANVK--PASWAARVAELKGDIALRQGDIAT 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A++ + E  +      G++   QM L ++
Sbjct: 178 ARSSYTEALQ-----AGMNQAVQMKLDDL 201


>gi|84684684|ref|ZP_01012584.1| hypothetical protein 1099457000245_RB2654_02209 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667019|gb|EAQ13489.1| hypothetical protein RB2654_02209 [Rhodobacterales bacterium
           HTCC2654]
          Length = 212

 Score = 59.6 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 53/174 (30%), Gaps = 8/174 (4%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
                   +++    G+    A         D A +    +     +         I   
Sbjct: 45  NEFLKAREQRQAQATGDAVLAA------QDADGAEARLAALDGVAAEGDAAAVIGLI--K 96

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
                  + A E+   + +D   P   R  ATL+   +     + +E    L  L  P  
Sbjct: 97  AAEAEAPERADELLAAIESDTSYPALYRDLATLKRVMLPGSPMTADEKVAALDPLLGPGA 156

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           P    A E L ++ ++ G  + A      L  D  +   +  R+  ++  +  +
Sbjct: 157 PFRVLAEEQLALAEIEAGDAEAALARLNALMDDAEAGDSLRERASQLIVALGGT 210


>gi|52425976|ref|YP_089113.1| hypothetical protein MS1921 [Mannheimia succiniciproducens MBEL55E]
 gi|52308028|gb|AAU38528.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 204

 Score = 59.6 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/181 (13%), Positives = 57/181 (31%), Gaps = 3/181 (1%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
            K           + +++ ++    +  +      + + + + + Q +  F  +      
Sbjct: 14  IKNFWKENGKTIIVSVIIAIAGVFGWRYWQSYQLSQHHQLSDQYQQVIYEFRQDPAAQKD 73

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
           +  E I       Y  L+    A   V K D   A     +  N+          A L+ 
Sbjct: 74  NLAEFIAQNGKSGYAALALFEQAKTAVEKQDFSQAETALKQALNN-APDEIFASIAALRL 132

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
           A++      ++     L  + + S    +      G   L  G    AK  +++  K+ +
Sbjct: 133 ANVQFQQKDFDGALVSLNLVKDTSWDSRKQILN--GDILLAKGDKAGAKAAYQQAQKNAS 190

Query: 194 S 194
           +
Sbjct: 191 A 191


>gi|256823053|ref|YP_003147016.1| hypothetical protein Kkor_1836 [Kangiella koreensis DSM 16069]
 gi|256796592|gb|ACV27248.1| conserved hypothetical protein [Kangiella koreensis DSM 16069]
          Length = 207

 Score = 59.6 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/203 (12%), Positives = 66/203 (32%), Gaps = 8/203 (3%)

Query: 8   NSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSH---EKKKNIVGENFAQALELF 64
            + + + +  K  +K     ++L  +      + ++      E +       +++ L L 
Sbjct: 4   ETEEQQVEAIKQFWKENGTSIVLGAVIGFGALFGWNYYQDHKESQSAQASMAYSEVLSLS 63

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           ++          + + ++          +   +  +   +    A   LK   D      
Sbjct: 64  DAANSTAMVGKVDGLKTEHAASSYASLAVLTYAEQLVNDNKFVEATEQLKWVVDQSND-T 122

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
               A L+ A + +    Y E    ++ + E        A  +   + L  G+ ++AK++
Sbjct: 123 FESIAQLRLARVQLQLEQYGEAIATVEAIDEQ--AYQANALLVKAEALLAQGETEQAKSV 180

Query: 185 FEEL--AKDNNSPFGISTRSQMI 205
             E   A+D      +  R   +
Sbjct: 181 LIEARDAEDGTVNPLLQMRLGQL 203


>gi|15603871|ref|NP_246945.1| hypothetical protein PM2006 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12722448|gb|AAK04090.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 788

 Score = 59.6 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 31/167 (18%), Positives = 55/167 (32%), Gaps = 5/167 (2%)

Query: 53  VGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
                  AL      + D A  +   +L +DN      +   +A I V K +   A E +
Sbjct: 111 AKAQLQLALIWAEKGEPDKAIKACNSVLREDNPEAYAKAQFQLAFIFVEKNERDKAIEAY 170

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFA-NEILGIS 171
             +  +D         A  Q A I  +    ++  K    +    NP         L   
Sbjct: 171 EAILREDSPEAY--AQAQFQLALIWAEKGEPDKAIKACNSVLREDNPEAYAKAQFQLAFI 228

Query: 172 ALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
            ++  +  KA   +E + +++        ++Q  LA I A      K
Sbjct: 229 FVEKNERDKAIEAYEAILRED--SPEAYAKAQFQLALIWAEKGDKNK 273



 Score = 53.1 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 32/158 (20%), Positives = 57/158 (36%), Gaps = 5/158 (3%)

Query: 53  VGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
               F  A      N+ D A  ++E IL +D+      +   +A I   KGD   A + +
Sbjct: 219 AKAQFQLAFIFVEKNERDKAIEAYEAILREDSPEAYAKAQFQLALIWAEKGDKNKAIKAY 278

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFA-NEILGIS 171
             V  +D      +  A    A +L   S  ++  K    +    +P         L + 
Sbjct: 279 RSVLREDNPDAYAK--AQFNLAFLLSKKSELDKAIKACNSVLREDSPEAYAKAQFQLALI 336

Query: 172 ALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
             + G   KA   +  + +++N       ++Q  LA I
Sbjct: 337 WAEKGDKNKAIKAYRSVLREDN--PEAYAKAQFQLACI 372



 Score = 51.2 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 54/150 (36%), Gaps = 3/150 (2%)

Query: 53  VGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
               F  A      N+ D A  ++E IL +D+      +   +A I   KG+   A +  
Sbjct: 147 AKAQFQLAFIFVEKNERDKAIEAYEAILREDSPEAYAQAQFQLALIWAEKGEPDKAIKAC 206

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFA-NEILGIS 171
             V  +D      +  A  Q A I V+ +  ++  +  + +    +P         L + 
Sbjct: 207 NSVLREDNPEAYAK--AQFQLAFIFVEKNERDKAIEAYEAILREDSPEAYAKAQFQLALI 264

Query: 172 ALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             + G   KA   +  + +++N       +
Sbjct: 265 WAEKGDKNKAIKAYRSVLREDNPDAYAKAQ 294



 Score = 50.8 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 64/165 (38%), Gaps = 3/165 (1%)

Query: 53  VGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
               F  A  L   ++LD A  +   +L +D+      +   +A I   KGD   A + +
Sbjct: 291 AKAQFNLAFLLSKKSELDKAIKACNSVLREDSPEAYAKAQFQLALIWAEKGDKNKAIKAY 350

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPM-HQFANEILGIS 171
             V  +D      +  A  Q A I ++    ++  K    +    NP  +  A  ILGI 
Sbjct: 351 RSVLREDNPEAYAK--AQFQLACIFIEKDEPDKAIKACNSVLHEDNPDVYAKAQFILGIL 408

Query: 172 ALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
                  +KA   +      N+       +++++L ++  S++ +
Sbjct: 409 YKSQSDFKKAIEAYSNAYGSNDPAIYYCAKAEILLLSVKGSERED 453



 Score = 44.6 bits (103), Expect = 0.009,   Method: Composition-based stats.
 Identities = 31/158 (19%), Positives = 60/158 (37%), Gaps = 5/158 (3%)

Query: 53  VGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
               F  A  L     LD A +++  I  +D+      + + +A I   KG+   A +  
Sbjct: 75  AQAQFNLAGILVEKGALDKAIATYCAISREDDPEAYAKAQLQLALIWAEKGEPDKAIKAC 134

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMH-QFANEILGIS 171
             V  +D      +  A  Q A I V+ +  ++  +  + +    +P     A   L + 
Sbjct: 135 NSVLREDNPEAYAK--AQFQLAFIFVEKNERDKAIEAYEAILREDSPEAYAQAQFQLALI 192

Query: 172 ALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
             + G+  KA      + +++N       ++Q  LA I
Sbjct: 193 WAEKGEPDKAIKACNSVLREDN--PEAYAKAQFQLAFI 228



 Score = 41.9 bits (96), Expect = 0.069,   Method: Composition-based stats.
 Identities = 34/159 (21%), Positives = 63/159 (39%), Gaps = 6/159 (3%)

Query: 52  IVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEI 111
              + F QA + ++    + A   F KI +  +K    L+   +ASIL  KG+   A E 
Sbjct: 3   KSEQYFDQAKQAYDDGNFEKAIELFNKI-NPHDKALYFLAQFNLASILREKGELDKAIET 61

Query: 112 FLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEI-LGI 170
           +  +         V   A    A ILV+  + ++       +S   +P      ++ L +
Sbjct: 62  YRTI--SRGDIPKVYAQAQFNLAGILVEKGALDKAIATYCAISREDDPEAYAKAQLQLAL 119

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
              + G+  KA      + +++N       ++Q  LA I
Sbjct: 120 IWAEKGEPDKAIKACNSVLREDN--PEAYAKAQFQLAFI 156



 Score = 35.0 bits (78), Expect = 7.7,   Method: Composition-based stats.
 Identities = 14/85 (16%), Positives = 33/85 (38%), Gaps = 2/85 (2%)

Query: 131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
              A    D  ++E+  ++  K++     ++  A   L     + G++ KA   +  +  
Sbjct: 8   FDQAKQAYDDGNFEKAIELFNKINPHDKALYFLAQFNLASILREKGELDKAIETYRTI-S 66

Query: 191 DNNSPFGISTRSQMILANIIASDQR 215
             + P  +  ++Q  LA I+     
Sbjct: 67  RGDIP-KVYAQAQFNLAGILVEKGA 90


>gi|288941006|ref|YP_003443246.1| hypothetical protein Alvin_1275 [Allochromatium vinosum DSM 180]
 gi|288896378|gb|ADC62214.1| Protein of unknown function DUF2133 [Allochromatium vinosum DSM
           180]
          Length = 208

 Score = 59.6 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 55/176 (31%), Gaps = 4/176 (2%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
            + L+ G  E   +     F Q +      + +      +++         P     +A+
Sbjct: 37  GWRLWIGHQESTASQASMAFEQLMLDAADKQTEAVSKQIDRLEDDFGSTPYPALGALVAA 96

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
             + +      A   L+ A D     A+   A L+ A +    +  +          + S
Sbjct: 97  KALHEAGQTAEAMTALQNAIDTAPDPAIARLAALRLARLQFAENQLDAA-ARTLDKYDVS 155

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
                    + G  A   G +  A+  ++   +       +S   ++ L N+ A+ 
Sbjct: 156 PAFAGEFAAVRGDIAAARGDLDAARAAYQRAIESG---SSLSQLIRLKLDNLPAAG 208


>gi|308050455|ref|YP_003914021.1| hypothetical protein Fbal_2745 [Ferrimonas balearica DSM 9799]
 gi|307632645|gb|ADN76947.1| Protein of unknown function DUF2133 [Ferrimonas balearica DSM 9799]
          Length = 204

 Score = 59.6 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 59/194 (30%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y        ++ L     +  +      K       + + 
Sbjct: 1   MEIYSTEEQQVEAIKRFWKEYGVSIIGGAVLGLGGLFGWNTYQDHLVGKAEQASAAYGRV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +E    ++     +  +         Y PLS + +A   V  GD   A  +  +V     
Sbjct: 61  IEQAGQSQDALDTAVAQFQNEYGESGYGPLSQLLLARAAVEAGDLAKAETLLTEVL--PS 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A     TL+ A + +     +     L+K++           E+ G   +K G++  
Sbjct: 119 MDSATAPMVTLRLARVQLAQDKLDAAQATLEKVTS--EAFAAQREELKGDVLVKKGEMDA 176

Query: 181 AKTIFEELAKDNNS 194
           A+  ++       +
Sbjct: 177 ARAAYQSALDAGGA 190


>gi|104780242|ref|YP_606740.1| hypothetical protein PSEEN1023 [Pseudomonas entomophila L48]
 gi|95109229|emb|CAK13926.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 213

 Score = 59.6 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/203 (12%), Positives = 55/203 (27%), Gaps = 7/203 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL----FNSNKLD 70
           K              L+   + + +  +      +       +   LE            
Sbjct: 13  KDWWNRNGKPLLTGALLAGVVVMGWQTWHKYQANQSQGASALYQALLETSLTPSGQPDAG 72

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT 130
                  K+ S+              + +       + A   LK   D  A   +   + 
Sbjct: 73  KVAELSGKLKSEFGGSAYAQYGSLFVAKVAVDSGKLDDAASELKGVMDKPADATLGEISR 132

Query: 131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
            + A +L      E+  K+L    +          E+ G   ++ G+   A + +E+   
Sbjct: 133 QRLARVLAAQDKAEDALKLLDG--DTDKAFLASREELKGDLLVQLGRADDAHSAYEKAKA 190

Query: 191 DNNSPFGISTRSQMILANIIASD 213
             +    I    Q+ L ++   D
Sbjct: 191 ALSDDAAIGG-LQLKLDDLAKGD 212


>gi|15603877|ref|NP_246951.1| hypothetical protein PM2012 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12722454|gb|AAK04096.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 203

 Score = 59.2 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/178 (14%), Positives = 61/178 (34%), Gaps = 5/178 (2%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K  YK +   +I+    +  W   +      K       + QAL    ++    +    
Sbjct: 18  WKENYKTLIASVIIAFGGVFGWN-YWQSHQLNKIQQTSAQYEQALYS-TADFASKSAQIE 75

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
           + + +     Y  L+ +  A + V K +   A +   +          +     L+ AS+
Sbjct: 76  QFVQANSKTSYAVLALLEKAKVEVEKKEFAQAEQSLKQALAQ-STDENLSSITALRLASV 134

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
                +++     L+++ E  +      N ++G   L  G    AK  +++   + + 
Sbjct: 135 QYQQQAFDMALDSLKQVKE--SSWDSRKNLLIGDILLAKGDKVAAKASYQQALNNASP 190


>gi|148825347|ref|YP_001290100.1| hypothetical protein CGSHiEE_01155 [Haemophilus influenzae PittEE]
 gi|148827509|ref|YP_001292262.1| hypothetical protein CGSHiGG_04660 [Haemophilus influenzae PittGG]
 gi|260582538|ref|ZP_05850328.1| chaperone HscA [Haemophilus influenzae NT127]
 gi|148715507|gb|ABQ97717.1| chaperone protein HscA [Haemophilus influenzae PittEE]
 gi|148718751|gb|ABQ99878.1| hypothetical protein CGSHiGG_04660 [Haemophilus influenzae PittGG]
 gi|260094349|gb|EEW78247.1| chaperone HscA [Haemophilus influenzae NT127]
          Length = 204

 Score = 59.2 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/209 (10%), Positives = 59/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKEWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE  L  A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEANLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALSTLNQVK--GESFNARKAILTGDIQIAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|145634634|ref|ZP_01790343.1| hypothetical protein CGSHiAA_05396 [Haemophilus influenzae PittAA]
 gi|145268179|gb|EDK08174.1| hypothetical protein CGSHiAA_05396 [Haemophilus influenzae PittAA]
          Length = 204

 Score = 59.2 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/209 (10%), Positives = 59/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +     +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKEWWKENGKTIIVAFILGVGGMFGWRYWQAHQAEQIAQASAQYDAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE  L  A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEANLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIIALRLSAVQFQLGQLDNALSTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQMG--SQLEQQMAKMKLNNL 204


>gi|332970232|gb|EGK09225.1| hypothetical protein HMPREF9373_2205 [Psychrobacter sp. 1501(2011)]
          Length = 275

 Score = 59.2 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 67/216 (31%), Gaps = 13/216 (6%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA---- 60
           N++N      +  K    +I   ++L +     W Y  +    K+  +  + +A      
Sbjct: 13  NNSNGDPQSMEKLKQAAGYIIGAILLALAGYFGWTYFQNS-GMKEDTVAADKYAAIEKTN 71

Query: 61  --LELFNSNKLDDARSSFEKIL----SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
             L        D ++     I        N +Y   + M  +   V   D K A E   K
Sbjct: 72  DELMGQPEGNADVSKKLNADIDKLVAEHGNTVYAWQALMIKSRNAVDANDMKTATEALKK 131

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALK 174
               DL    +     L+ A++L+   + +E      K             E+LG     
Sbjct: 132 ALEIDLKDPGLHSITQLRYATVLLADGNVDEALTQASKDVPV--AFEASQQELLGDIYSA 189

Query: 175 FGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
               +KA   ++      +         ++ L N+ 
Sbjct: 190 KKDKEKALRAYQNAWSLLSKRHEERPFLRLKLENLG 225


>gi|163749555|ref|ZP_02156802.1| hypothetical protein KT99_16084 [Shewanella benthica KT99]
 gi|161330665|gb|EDQ01602.1| hypothetical protein KT99_16084 [Shewanella benthica KT99]
          Length = 206

 Score = 59.2 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 29/212 (13%), Positives = 67/212 (31%), Gaps = 6/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +      +     E F   
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGTSIVVGAVVGLGGLFGWNYYSDHKIAQAESASEAFQAM 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
               ++       ++ E      ++         I +    +      AE  LK      
Sbjct: 61  --SADNISATSMLAAAENFAKDHSQKGYQSLLELIVAKAAVEAGDLEKAEATLKSVVSSA 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +   AT++ A +  +          L ++++P        +E+ G   ++ G  ++
Sbjct: 119 PDKGLVMVATMRLARVQAEQGQITTAITTLDQVADP--AFTAQRDELKGDFLVRKGDEKR 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           AK  ++   K+  +   +S+  QM L N+  +
Sbjct: 177 AKAAYQAAVKNGGTN--VSSGLQMKLDNLNKA 206


>gi|154253926|ref|YP_001414750.1| hypothetical protein Plav_3494 [Parvibaculum lavamentivorans DS-1]
 gi|154157876|gb|ABS65093.1| conserved hypothetical protein [Parvibaculum lavamentivorans DS-1]
          Length = 240

 Score = 58.9 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 37/214 (17%), Positives = 93/214 (43%), Gaps = 2/214 (0%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            +    +   K+    Y       ++ ++ +      +      ++      F + +   
Sbjct: 9   EEDLRREQFSKLW-DKYGAWLIGAVVALVLVVAAIVGWRAWSHSQRVEASARFEETVIKA 67

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
                 +A ++F ++    +  Y  L+ ++ A   +A G+   A  ++ +VA +  AP  
Sbjct: 68  QDAAPAEAAAAFAELAESTSGGYAVLARLHEADKRLAAGERDVALAVYGEVA-NGGAPAI 126

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           VR  A ++   +LVDT+SY+++   +  L + ++P  + A E+L ++A++ G+ + A   
Sbjct: 127 VRGMARIKEGLLLVDTASYDDMKARMSPLVDSASPWRENALELLALAAMRDGEWEDANRN 186

Query: 185 FEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              +  +  +P G+  R+ +I A +       ++
Sbjct: 187 AAAIIANQATPAGLRDRAHVIQALVAPHLLAEEE 220


>gi|319779673|ref|YP_004130586.1| hypothetical protein TEQUI_1531 [Taylorella equigenitalis MCE9]
 gi|317109697|gb|ADU92443.1| hypothetical conserved protein [Taylorella equigenitalis MCE9]
          Length = 214

 Score = 58.9 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 71/218 (32%), Gaps = 10/218 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K     Y  I   L+ +I    + F  +     ++       +   
Sbjct: 1   MAYDLEEQEKIDQIKSWWASYGNIVTTLLTLIAVAYLAFQGYQWYENRQAKK-SLIYYDI 59

Query: 61  LELFNSN------KLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           +   + N       +     + + +    +        + IAS +  K     ++ + L 
Sbjct: 60  VYSVSQNFNPQSSDIKRLEEAIKVLKDDFSSSAYTDRAILIASNIYFKNKDLASSALNLN 119

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALK 174
              D+   + ++  A L  +S+L+     ++   +   L  PS+      ++ L    + 
Sbjct: 120 WVLDNSDDVGIKETAKLNLSSVLLAQGEIQKAKDL---LKNPSDDFKALFDDRLADIYMS 176

Query: 175 FGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
            GK ++A  I++ L +             M L    A 
Sbjct: 177 EGKKEEAFKIWKSLLQIKTLDENFLEVINMKLKVYGAE 214


>gi|145636362|ref|ZP_01792031.1| co-chaperone HscB [Haemophilus influenzae PittHH]
 gi|145270527|gb|EDK10461.1| co-chaperone HscB [Haemophilus influenzae PittHH]
          Length = 204

 Score = 58.9 bits (140), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 23/209 (11%), Positives = 60/209 (28%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M  + +      + K           +  ++ +S    +  +     ++       +   
Sbjct: 1   MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVSGMFGWRYWQAHQAEQIAQASAQYDTL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +     ++     +  + + +     Y   + +  A     K D   AAE  L  A    
Sbjct: 61  INSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQDFS-AAEANLNQALTQS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ +++       +     L ++       +     + G   +  G    
Sbjct: 120 QDEVLTSIVALRLSAVQFQLGQLDNALSTLNQVK--GESFNARKAILTGDIQVAKGDKVA 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           AK  FE+  +           ++M L N+
Sbjct: 178 AKNSFEQAQQSG--SQLEQQMAKMKLNNL 204


>gi|71065250|ref|YP_263977.1| hypothetical protein Psyc_0684 [Psychrobacter arcticus 273-4]
 gi|71038235|gb|AAZ18543.1| hypothetical protein Psyc_0684 [Psychrobacter arcticus 273-4]
          Length = 264

 Score = 58.9 bits (140), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 29/218 (13%), Positives = 54/218 (24%), Gaps = 22/218 (10%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
               Y       IL+ L+    +  +  +H +   +  + +A    L     L       
Sbjct: 16  ALKQYGSYIVTAILLALAAYFGWTYWQDNHARVDTVAADQYADIQRLNAEVSLASQNPDL 75

Query: 77  EKILS--------------------QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           E                            +Y   + M  A   V   D K A E F K  
Sbjct: 76  EADAKASLEKSRTQLNKNIDTLVGTHGESVYAWQALMIKARQQVDSDDFKAAGESFKKAL 135

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
             DL    +     L+ A+ L+     +       +     +       E+LG   L   
Sbjct: 136 AIDLGDAGLEAITRLRYATTLLAAGDAKAALTEASRY--MPSSFEASQQELLGDIYLAQD 193

Query: 177 KVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
               A   +                  + + ++    +
Sbjct: 194 NTDSAIKSYNNAWNLLRERQETRAVLALKMESLGIVPE 231


>gi|223939519|ref|ZP_03631395.1| Tetratricopeptide TPR_2 repeat protein [bacterium Ellin514]
 gi|223891791|gb|EEF58276.1| Tetratricopeptide TPR_2 repeat protein [bacterium Ellin514]
          Length = 254

 Score = 58.5 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 27/216 (12%), Positives = 65/216 (30%), Gaps = 6/216 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+S    ++   K        +      +L I  +      +  +  +++   GE  ++ 
Sbjct: 1   MDSEATQSTDLIKLVDWLHKNQKQLIGFVLAIAVIGGGIAFYVANKNRQEVKAGEALSEL 60

Query: 61  L---ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
                   +        ++ K+ ++          + +A   + +      A+       
Sbjct: 61  RPSRATPGTQAPSVPPDAYLKVANEHPGTSAGGQALLLAGGALFEAGKFKEAQAQFDRFL 120

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFAN--EILGISALKF 175
            +    A+   A +  A+ L       + +   Q L                L     K 
Sbjct: 121 GEHGDSALASQARIGVAASLEAQGEDAQAAAKYQALISSQPNDSVIPQAKSALARLYEKQ 180

Query: 176 GKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           GK   A  +++EL K  N     S  + + +  ++A
Sbjct: 181 GKYADALRLYQELTKQGN-NDSWSAEAGIQIEELLA 215


>gi|126640575|ref|YP_001083559.1| hypothetical protein A1S_0504 [Acinetobacter baumannii ATCC 17978]
          Length = 210

 Score = 58.5 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 56/191 (29%), Gaps = 8/191 (4%)

Query: 26  PLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK------LDDARSSFEKI 79
              IL+ L     +  +   +            Q ++  N+             S+ + +
Sbjct: 2   ISGILIALIAFFGWEYWQKRNLATSQTETAKVQQLMDEANATADNPNALASITASADKIV 61

Query: 80  LSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVD 139
               + +    +   +A +   K D   A +   KV N  +    +     L+ A   + 
Sbjct: 62  KDDIDSVQAIQTQFVLAKLAYEKQDYAAAEKALKKVENSKVKDEGLIQVVKLRLADAQLA 121

Query: 140 TSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
            + Y+E  K L    +          E+ G   +    +  AK  ++             
Sbjct: 122 QNKYDEALKTLSG--DVDPAFKATVEELRGDIFVAKKDIDSAKKAYQAAWDSLLERKQER 179

Query: 200 TRSQMILANII 210
              Q+ L ++ 
Sbjct: 180 QILQIKLESVG 190


>gi|93005484|ref|YP_579921.1| hypothetical protein Pcryo_0654 [Psychrobacter cryohalolentis K5]
 gi|92393162|gb|ABE74437.1| conserved hypothetical protein [Psychrobacter cryohalolentis K5]
          Length = 264

 Score = 58.1 bits (138), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 27/218 (12%), Positives = 54/218 (24%), Gaps = 22/218 (10%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
               Y       IL+ L+    +  +  +H +   +  + +A    L     L       
Sbjct: 16  ALKQYGSYIVTAILLALAAYFGWTYWQDNHARVDTVAADQYADIQRLNEEVSLASQNPDL 75

Query: 77  EKILS--------------------QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
                                        +Y   + M  A   V   D K A + F K  
Sbjct: 76  GAEAKASLEKSRTQLDKNIDTLVGTHGESVYAWQALMIKARQQVDNDDFKAAGDTFKKAL 135

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
             DL    +     L+ A+ L+     +      +   +  +       E+LG   L   
Sbjct: 136 AIDLGDAGLEAITRLRYATTLLAAGDAKAALT--EASRDMPSSFEASQQELLGDIYLAQD 193

Query: 177 KVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQ 214
               A   +                  + + ++    +
Sbjct: 194 NSDSAIKSYNNAWSLLRERQETRAVLALKMESLGIVPE 231


>gi|209694320|ref|YP_002262248.1| putative outer membrane protein [Aliivibrio salmonicida LFI1238]
 gi|208008271|emb|CAQ78416.1| putative outer membrane protein [Aliivibrio salmonicida LFI1238]
          Length = 203

 Score = 58.1 bits (138), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 72/209 (34%), Gaps = 8/209 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME+           K           +  ++ +   + +  +       K      + + 
Sbjct: 1   MEAYETEEQQVEAIKSWWKENGKAVVIGGVVGIGAILGWKYYQSMQVTAKETASAGYERT 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           L   +++      ++   I +     Y  L+ + +A + V       A E  L   +++ 
Sbjct: 61  LTALHTSGAKAEETTQTFIAAHAKSEYAALAALQLAKVQVEANQLDAALE-QLIWISNNS 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+   A ++AA I  + + ++     L  +   S        E+ G  AL  G +  
Sbjct: 120 KDDALVAMAQVRAARIQAEQNKFDAALTTLAGVKSTS--WSARVAELKGDIALSQGDIAT 177

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A++ + E  +D  +P       QM L ++
Sbjct: 178 ARSEYTESLQDGMNPS-----VQMKLDDL 201


>gi|70732276|ref|YP_262032.1| hypothetical protein PFL_4952 [Pseudomonas fluorescens Pf-5]
 gi|68346575|gb|AAY94181.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 213

 Score = 57.7 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 29/208 (13%), Positives = 60/208 (28%), Gaps = 15/208 (7%)

Query: 14  CKMGKCCYKWIAP----LLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALEL----FN 65
            K               L ++++      +  +      +       + Q LE       
Sbjct: 12  LKDWWQRNGKPLVTGGLLALVIVFG----WQAWHKYQNNQSQGASVLYQQLLETTLTPDG 67

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
                       K+ S+              + +       + A   LK   D  A   +
Sbjct: 68  KPDAARVTDLAGKLNSEFGGTAYAQYGNLFVAKVAVDTGKLDDAAAQLKAVADKPANPTL 127

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
              A  + A +L   +  +E  K+L    +          E+ G   ++ G+V +A   +
Sbjct: 128 GEVARQRLAQVLAAQNKADEALKLLDG--DADKAFLATREELKGDLLVQLGRVDEAHAAY 185

Query: 186 EELAKDNNSPFGISTRSQMILANIIASD 213
           ++ AK   S        Q+ L ++   D
Sbjct: 186 QK-AKAALSDEAAVGGLQIKLDDLAKGD 212


>gi|119944925|ref|YP_942605.1| hypothetical protein Ping_1170 [Psychromonas ingrahamii 37]
 gi|119863529|gb|ABM03006.1| conserved hypothetical protein [Psychromonas ingrahamii 37]
          Length = 226

 Score = 57.7 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/183 (15%), Positives = 61/183 (33%), Gaps = 3/183 (1%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K  K     +    ++ +  L  W + ++ S    +    + ++  L  F S   +    
Sbjct: 20  KWWKENGNTLMIAAVIGLAGLWGWRF-YNASVITGQEEASQAYSDMLVKFESQGGEAGLD 78

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
           S    ++ +      +    + +    +      A+              +     L+ A
Sbjct: 79  SIRAFIAGNQDNNYGVLASLLLAKEAVQQKDFALAKAQFVQLQSQNEYAPLNAVINLRLA 138

Query: 135 SILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
            +      YE+  K L  ++EPS       N++ G   L  G ++KA+T F++       
Sbjct: 139 RVEAQLGEYEQALKTLTLITEPSFLAKA--NQVKGSIYLNMGDIEKARTAFQDAVNAIEG 196

Query: 195 PFG 197
             G
Sbjct: 197 NIG 199


>gi|183599736|ref|ZP_02961229.1| hypothetical protein PROSTU_03239 [Providencia stuartii ATCC 25827]
 gi|188021995|gb|EDU60035.1| hypothetical protein PROSTU_03239 [Providencia stuartii ATCC 25827]
          Length = 207

 Score = 57.3 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/194 (12%), Positives = 59/194 (30%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +     +  +            + FA+A
Sbjct: 1   MEVYTNENEQVDAIKRFFANNGVALVVGLVLGVGAVWGWNYWQSHKTNMLQESAQQFAKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E  +S        + +K  +    +Y+ +  + +A + V KGD   A +          
Sbjct: 61  SEELHSGSTQGI-EAAQKFAADTTDVYSAMIGLELAQVAVDKGDLALAEKSLSAALTKAK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +      + A + +   + +     +  +          A ++ G + L  G    
Sbjct: 120 TDD-MLDLINFRLARVQLAQGNADAALASVGNIK--GKAWQAAAQDVRGDALLHKGDNAG 176

Query: 181 AKTIFEELAKDNNS 194
           AK  + +      S
Sbjct: 177 AKAAYTQGLDSEGS 190


>gi|189347289|ref|YP_001943818.1| hypothetical protein Clim_1800 [Chlorobium limicola DSM 245]
 gi|189341436|gb|ACD90839.1| Tetratricopeptide TPR_2 repeat protein [Chlorobium limicola DSM
           245]
          Length = 227

 Score = 57.3 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/200 (10%), Positives = 58/200 (29%), Gaps = 7/200 (3%)

Query: 19  CCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDA------ 72
             YK +    +++I++L      +    +  +       ++   L +  +   A      
Sbjct: 28  IKYKNVLIGALVLIIALGGGTAFWLNQQKAAEQEASMQLSKIAPLLDRGEYRKAIDGTSG 87

Query: 73  RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQ 132
            +  + I  +     +      + +         ++A       +     L+    A   
Sbjct: 88  NAGLKSISGKHGSTPSGSMASLLLANAYYLLGQPDSALAVYDGISIKNKDLSAAVLAGTG 147

Query: 133 AASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
           A        +    +         +  +          + L  GK++KA  +++++  D 
Sbjct: 148 ACHAKKKAFAQAAAAYEKAAEKAENKALKAQYAFNAADNYLDSGKLEKALELYKKIVADY 207

Query: 193 NSPFGISTRSQMILANIIAS 212
               G    +Q  L  +  S
Sbjct: 208 PGSTGA-ALAQRTLWQLSGS 226


>gi|307543974|ref|YP_003896453.1| hypothetical protein HELO_1385 [Halomonas elongata DSM 2581]
 gi|307215998|emb|CBV41268.1| hypothetical protein HELO_1385 [Halomonas elongata DSM 2581]
          Length = 219

 Score = 56.9 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 58/180 (32%), Gaps = 7/180 (3%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD-----ARSSFEKILSQDNKLYNPL 90
              +  +      +     + + Q L L +  +LDD     A      ++ +        
Sbjct: 36  VFGWKTWQDYQAGQAEAASQRYQQLLTLSSQEQLDDAARERAEEVATTLVEEHGGTLYAD 95

Query: 91  SNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKIL 150
               +++ L  +G  + AA   L+    +     +   A L+ A + V     E   K L
Sbjct: 96  MAQLLSARLSVEGGDQAAARETLEALIANSEHDYLSGLARLRLARLQVAADEAEAALKTL 155

Query: 151 QKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
                   P+     +I G +     +  +A+  + E  +   +        Q+ L N+ 
Sbjct: 156 DGAI--PAPLAAQQADIRGDAHFALEQTDQARDAWREALRLAENGERPLYGVQLKLDNLG 213


>gi|300114864|ref|YP_003761439.1| hypothetical protein Nwat_2290 [Nitrosococcus watsonii C-113]
 gi|299540801|gb|ADJ29118.1| Protein of unknown function DUF2133 [Nitrosococcus watsonii C-113]
          Length = 212

 Score = 56.9 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 61/168 (36%), Gaps = 2/168 (1%)

Query: 42  FDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVA 101
           +    + + +     + Q L   + +   +  +S E +L + +     L ++ I +    
Sbjct: 44  WTKYEQSRTSEASSLYQQILVATDQDANAEIYNSAEYLLQEYSDTSYGLFSVLILAKEDQ 103

Query: 102 KGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMH 161
                  A   LK A +     +++    L+ A +L+   + +E+   L ++        
Sbjct: 104 VRGDLETATERLKGALEHARHSSLQKVIYLRLARLLLAAGNPQEVLTTLAEVK--PGSFS 161

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
               E+ G + +  G+  +A+  ++E               QM L ++
Sbjct: 162 SAYAEMRGDAYVALGQPSEAQLAYQEALLGLGPSEQYQQILQMKLDDL 209


>gi|261820575|ref|YP_003258681.1| hypothetical protein Pecwa_1260 [Pectobacterium wasabiae WPP163]
 gi|261604588|gb|ACX87074.1| Protein of unknown function DUF2133 [Pectobacterium wasabiae
           WPP163]
          Length = 206

 Score = 56.5 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 32/211 (15%), Positives = 72/211 (34%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +             ++ Q 
Sbjct: 1   MEVYTTENEQVDALRRFLAENGKALVVGVVLGVGALVGWRFWQSHQNDSVQAASASYQQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E   + K  +A +S EK  +++   Y  L+++ +A   V + D   AA+  L +A    
Sbjct: 61  TEQLAAGK-AEAIASTEKFTAENKNTYGALASLELARHYVDQKDFAKAAQ-QLVLAQSQT 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +  +  ++  K L  +            E+ G   +  G  Q 
Sbjct: 119 KDADLLAVVNLRLARVQLQENKADDALKTLDAIKPEGWASQA--AEVRGDILVSKGDNQA 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +     N         +M L N+ +
Sbjct: 177 ARDAYNKGLSS-NPSQAQQALLRMKLNNLSS 206


>gi|323170214|gb|EFZ55867.1| hypothetical protein ECLT68_5102 [Escherichia coli LT-68]
          Length = 103

 Score = 56.5 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 10/103 (9%), Positives = 29/103 (28%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + N      K           + +++ +   I +  ++             +  A
Sbjct: 1   MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKG 103
           +   +  K D   ++ +        +   L     +++L    
Sbjct: 61  VTAVSEGKPDSIPAAEKFAAENKILMVRWLLWNLRSNLLTKMN 103


>gi|189183688|ref|YP_001937473.1| hypothetical protein OTT_0781 [Orientia tsutsugamushi str. Ikeda]
 gi|189180459|dbj|BAG40239.1| hypothetical protein OTT_0781 [Orientia tsutsugamushi str. Ikeda]
          Length = 225

 Score = 56.5 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 29/212 (13%), Positives = 75/212 (35%), Gaps = 9/212 (4%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
                +    +C +    +  I     L I +  +    ++   E     + + F ++++
Sbjct: 6   QEIKDSDRYQRCLLYYKKFLLIVFSSSLFITAAMMINNFYNARQEAYYQKITDIFIESID 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             ++N     +S  + +LS  N     L+++ +    +  G      ++  ++       
Sbjct: 66  QDSNNSELIVKSLEKFLLSNYNTKVQELAHIQLLVHKIKVGSFTEVKQLANEILAIKNYS 125

Query: 123 LAVRYAATLQAASILVDTSSYEE---------ISKILQKLSEPSNPMHQFANEILGISAL 173
              +    L   ++ +D    ++         + + L     PS P    A+    I A 
Sbjct: 126 DFTKAYVRLNLLAMAIDVKQNDDNSNYDSQTQLIEQLFSEFSPSMPFWSIASIYYAIWAH 185

Query: 174 KFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
           + G   KA    E + K   S + + ++++M+
Sbjct: 186 ENGDDNKAIQYLEAVIKSKYSSWNLKSQAKML 217


>gi|163802475|ref|ZP_02196368.1| histidyl-tRNA synthetase [Vibrio sp. AND4]
 gi|159173776|gb|EDP58591.1| histidyl-tRNA synthetase [Vibrio sp. AND4]
          Length = 204

 Score = 56.5 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 30/212 (14%), Positives = 69/212 (32%), Gaps = 13/212 (6%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSH---EKKKNIVGENF 57
           ME  +         K            +I+  +      + +        +      +++
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGK---AVIIGAVVGLGGLFGWRYYQDSVTQASEAASQSY 57

Query: 58  AQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
              +    +   D        I S + K Y+ L+ + +A + V   D   A E  LK A 
Sbjct: 58  TTVMSTLQTKGADAQADIQAFIDSNEVKEYSVLAALQLAKVQVEAKDLSAALE-QLKWAQ 116

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGK 177
            +     +    + + A I  + ++++  +  L  ++           E+ G  AL+   
Sbjct: 117 SNTKDAVLAPLISYRIARIEAEMNNFDAANAELALVT--DAAWTGRIAELRGDIALRQND 174

Query: 178 VQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
              A   + E  +  ++   +    QM L ++
Sbjct: 175 KAAAYAAYTEAQQATDASPTL----QMKLDDL 202


>gi|83647148|ref|YP_435583.1| hypothetical protein HCH_04454 [Hahella chejuensis KCTC 2396]
 gi|83635191|gb|ABC31158.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 217

 Score = 56.2 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/203 (12%), Positives = 64/203 (31%), Gaps = 9/203 (4%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ-------ALELFNS 66
            K           + I + L+    +  ++ +  +KK    + + +       A    + 
Sbjct: 14  IKNWWKENGNALLIGIGLALAAIFGWKAYNQNELQKKEEASQMYQELVQAAGAAQMADDE 73

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
               +      ++ S+       L      +           AE  LK    +    A++
Sbjct: 74  KSQANITFLATELQSKFPGTTYALYAKLYEAQQAVAKKDFAGAETALKAVASETEDEALK 133

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
              +L+ A +L     +++    L+   +  +  +    E+ G      G   +AK  +E
Sbjct: 134 RVVSLRLARVLAAQQKFDDALAALKA--QKGDVFYSHFQELAGDILKMKGSRAEAKAAYE 191

Query: 187 ELAKDNNSPFGISTRSQMILANI 209
           +   D       +   Q+ L ++
Sbjct: 192 QALADAKEHELPTELLQIKLNDL 214


>gi|88799907|ref|ZP_01115479.1| hypothetical protein MED297_15005 [Reinekea sp. MED297]
 gi|88777338|gb|EAR08541.1| hypothetical protein MED297_15005 [Reinekea sp. MED297]
          Length = 210

 Score = 56.2 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/200 (13%), Positives = 60/200 (30%), Gaps = 5/200 (2%)

Query: 12  GKCKMGKCCYK-WIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN-SNKL 69
              K        W+   ++L   S   +   +  S E+ +      + Q LE        
Sbjct: 10  EAIKRWWSQNANWVIGAIVLFFASYVGYN-WYVSSTEQHRLEASTTYEQLLEAVTAEQGN 68

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
            + +    ++L  D    +  S   + +   A       A +       D A  A+    
Sbjct: 69  SEEQDRLTRLLKTDYSDLSYASMAALLAAEAAVESEDYDAALTELNWAADHADSALLPVI 128

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
             + A +       +     L K+            E+ G   L  G +  A++ ++   
Sbjct: 129 HYRTAMVQYQLDQLDTALATLDKIKGEG--HQAVTFELKGDILLAQGNIDDARSAYQAAL 186

Query: 190 KDNNSPFGISTRSQMILANI 209
             ++     +   ++ L ++
Sbjct: 187 DLSSDQSINNPYLKIKLDDL 206


>gi|240949089|ref|ZP_04753437.1| hypothetical protein AM305_01489 [Actinobacillus minor NM305]
 gi|240296484|gb|EER47116.1| hypothetical protein AM305_01489 [Actinobacillus minor NM305]
          Length = 208

 Score = 56.2 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/198 (9%), Positives = 54/198 (27%), Gaps = 4/198 (2%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            + K           L I +  +    +  +     +       ++   +E +  +   +
Sbjct: 15  EEAKNWFKANSTPILLAIFICAAATFGWNFWKKHQVESAIQASTSYQNTMEAYLQDPAKN 74

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
                + +       Y   + +      V + D   A  +     +       ++     
Sbjct: 75  QPLVAKFLEEAKGTNYAVFAQLEEVKQAVTQADYAKAQTLLQNTLSATN-DATLQVVIRF 133

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A I      Y+E   +L ++    +        +        G    AK+ +E+  K 
Sbjct: 134 RLAEIGYQLKQYDEALAVLAQI--QGSAWESRKQLLSADILAAKGDKAAAKSAYEQ-LKA 190

Query: 192 NNSPFGISTRSQMILANI 209
             +         + + N+
Sbjct: 191 TATSESEKALIDLKINNL 208


>gi|212710613|ref|ZP_03318741.1| hypothetical protein PROVALCAL_01679 [Providencia alcalifaciens DSM
           30120]
 gi|212686694|gb|EEB46222.1| hypothetical protein PROVALCAL_01679 [Providencia alcalifaciens DSM
           30120]
          Length = 207

 Score = 56.2 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/212 (11%), Positives = 66/212 (31%), Gaps = 5/212 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   +        K           + +++ +     +  +              +   
Sbjct: 1   MEVYTNEQDQVDAIKRFFANNGVALVVGLVIGVGGVFGWNYWQSHKSNVLQESAAKYEVV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                S    +   + +K  ++ N +Y+ ++ + +A +   KGD   A +          
Sbjct: 61  NTQLRSGS-AEGIQAAQKFAAETNDVYSAMTGLELAQVFADKGDLAGAEKALTDALAKAK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
             + ++    L+ A I +   + +     + K+          A ++ G + L+ G    
Sbjct: 120 T-VDMQDVINLRLARIQLALGNADAALASVAKI--QGKSWQATAQDVRGDALLQKGDKSG 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIAS 212
           AK  + +  +       +     + L N+  S
Sbjct: 177 AKAAYTQGLESEG-SQSLRGILTLKLNNVSNS 207


>gi|227112684|ref|ZP_03826340.1| hypothetical protein PcarbP_06969 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 206

 Score = 56.2 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 71/211 (33%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +             ++ Q 
Sbjct: 1   MEVYTTENEQVDALRRFLAENGKALVVGVVLGVGALVGWRFWQSHQNDSVMAASSSYQQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E     K D A ++ EK  +++   Y  L+++ +A   V + D   AA+  ++ A    
Sbjct: 61  TEQLAEGKAD-AITATEKFTAENKNTYGALASLELARHYVDQKDFAKAAQQLVQ-AQSQT 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +  +  ++  K L  +            E+ G   +  G  Q 
Sbjct: 119 KDADLLAVVNLRLARVQLQENKADDALKTLDAIKLEGWASQA--AEVRGDILVSKGDNQA 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +     N         +M L N+ +
Sbjct: 177 ARDAYNKGLSS-NPSQAQQALLRMKLNNLSS 206


>gi|227328674|ref|ZP_03832698.1| hypothetical protein PcarcW_15586 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 206

 Score = 55.8 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 71/211 (33%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +             ++ Q 
Sbjct: 1   MEVYTTENEQVDALRRFLAENGKALVVGVVLGVGALVGWRFWQSHQNDSVMAASASYQQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E     K D A ++ EK  +++   Y  L+++ +A   V + D   AA+  ++ A    
Sbjct: 61  TEQLAEGKAD-AITATEKFTAENKNTYGALASLELARHYVDQKDFAKAAQQLVQ-AQSQT 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +  +  ++  K L  +            E+ G   +  G  Q 
Sbjct: 119 KDADLLAVVNLRLARVQLQENKADDALKTLDAIKLEGWASQA--AEVRGDILVSKGDNQA 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +     N         +M L N+ +
Sbjct: 177 ARDAYNKGLSS-NPSQAQQALLRMKLNNLSS 206


>gi|330720579|gb|EGG98849.1| hypothetical protein imdm_1826 [gamma proteobacterium IMCC2047]
          Length = 217

 Score = 55.8 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/204 (11%), Positives = 59/204 (28%), Gaps = 7/204 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
            K           + +L+ ++    +  +  + +       E +   +E    +      
Sbjct: 14  VKRWWKENGKSLVIGVLLAIAAVFGWQSWQANKQASGEAASEIYFSLIEAVALSNESQTS 73

Query: 74  SSF----EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
           +      +      +  Y     +  A   V +GD + A        ++     ++   A
Sbjct: 74  TVMHLAEQLKSDYGSLTYAQYGALLAAKQTVLEGDFEEAESQLTWAVDNADKAGSLHKVA 133

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPS-NPMHQFANEILGISALKFGKVQKAKTIFEEL 188
            L+ A ++      +   + L  +            +E+ G   L  G+  +A       
Sbjct: 134 LLRLARVVAAQGGEDNQQRALALIEGVDAGAHQASYDEVKGDIYLSLGR--EADARSAYQ 191

Query: 189 AKDNNSPFGISTRSQMILANIIAS 212
           A    S  G      + L ++ A 
Sbjct: 192 AAAAASETGARPLLNLKLDDVAAE 215


>gi|255292048|dbj|BAH90529.1| putative transmembrane protein [uncultured bacterium]
 gi|255292516|dbj|BAH89631.1| hypothetical protein [uncultured bacterium]
 gi|255293028|dbj|BAH90123.1| hypothetical protein [uncultured bacterium]
          Length = 205

 Score = 55.8 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 56/177 (31%), Gaps = 7/177 (3%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
            +    + +     ++       +A   +        +     EK+  +          +
Sbjct: 33  GILGGRF-YGTYQTRQAQQAAALYATYQQPPAGQTAAE---LAEKLRGEHPASSYATFAV 88

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
           +  +    +      A   L+   +       R  A L+ A +L+      E +  L+  
Sbjct: 89  FDQAAQAVQAGDPQQAVQQLRWVAEHAGQQTDRGLARLRLARVLLAQGKVAEAASALEHE 148

Query: 154 SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANII 210
           +   +P      E+ G  AL  G+ Q+A+  +++   D     G +    + L  + 
Sbjct: 149 AVGPSPAR---EELKGDIALAEGRPQQAREHYQQALADLAGDAGAAALINLKLDALG 202


>gi|241667851|ref|ZP_04755429.1| hypothetical protein FphipA2_03711 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876393|ref|ZP_05249103.1| tetratricopeptide repeat domain-containing protein [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254842414|gb|EET20828.1| tetratricopeptide repeat domain-containing protein [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
          Length = 212

 Score = 55.8 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 22/183 (12%), Positives = 68/183 (37%), Gaps = 16/183 (8%)

Query: 40  YLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEK---ILSQDNKLYNPLSNMYIA 96
             ++  +EK+     + + +AL    + K   +    +      +  +  +   ++  +A
Sbjct: 30  QFYNSDNEKRMFEASDIYQRALIANENPKSPTSVKIAKFEEVTKNYPDTSFGIFASWQLA 89

Query: 97  SILVAKGDTKNAAEIF-----------LKVANDDLAPLAVRYAATLQAASILVDTSSYEE 145
            + +A  D    +              L+ +       ++     ++ A + + +++ ++
Sbjct: 90  DLYMAPTDLDTKSFNVNLSNLPKAIDVLQQSVQSNPNDSLTDITKVRLAKLYISSNNPDK 149

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
              ILQ +S  ++  + +   +LG +  +     KA   +++  +D NS          +
Sbjct: 150 AISILQSISSLNS--NAYPLTLLGEAYSEKKDKDKALDAWKKALQDPNSSAEFKQIITQL 207

Query: 206 LAN 208
           + N
Sbjct: 208 INN 210


>gi|50122140|ref|YP_051307.1| hypothetical protein ECA3218 [Pectobacterium atrosepticum SCRI1043]
 gi|49612666|emb|CAG76116.1| putative membrane protein [Pectobacterium atrosepticum SCRI1043]
          Length = 206

 Score = 55.8 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 27/173 (15%), Positives = 59/173 (34%), Gaps = 5/173 (2%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  +             ++ Q  E     K  +A +S EK  +++   Y  L+++ +A  
Sbjct: 39  WRFWQSHQNDSVQAASASYQQVTEQLAEGK-AEAIASTEKFTAENKNTYGALASLELARH 97

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN 158
            V + D   A +  ++ A        +     L+ A + +  +  ++  K L  +     
Sbjct: 98  YVDQKDFAKAVQQLVQ-AQSQTKDADLLAVVNLRLARVQLQENKADDALKTLDAIKLEGW 156

Query: 159 PMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
                  E+ G      G  Q A+  + +     N         +M L N+ +
Sbjct: 157 ASQA--AEVRGDILASKGDNQAARDAYNKGLSS-NPSQAQQALLRMKLNNLSS 206


>gi|225677202|ref|ZP_03788195.1| hypothetical protein WUni_006950 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590726|gb|EEH11960.1| hypothetical protein WUni_006950 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 204

 Score = 55.8 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 41/185 (22%), Positives = 73/185 (39%), Gaps = 10/185 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L +  +L     + L +  + K+    G+ F + L L   NK          +L 
Sbjct: 25  KYIFLLALAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLFLKKDNKP---------LLE 75

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           + +  +  L+N   A   ++     + A I+  +A+D  AP  +R  A       L+ ++
Sbjct: 76  EIDSNWEYLANFERAFNHISDSMPTDTASIYNDLADDKDAPGVLRELAQYLEVMSLLHSN 135

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             E+I+K      E S      + E + I  +    V+ A  I   L  D   P  I   
Sbjct: 136 G-EKINKDKIDNLESSTVYPYSSQEAIAIVKIHNNDVKGATEILRSLLNDRKCPILIKAN 194

Query: 202 SQMIL 206
           +Q +L
Sbjct: 195 AQELL 199


>gi|118602670|ref|YP_903885.1| TPR-like domain-containing protein [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
 gi|118567609|gb|ABL02414.1| puttive membrane-associated protein with TPR-like domain
           [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
          Length = 202

 Score = 55.8 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/204 (9%), Positives = 63/204 (30%), Gaps = 9/204 (4%)

Query: 7   ANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNS 66
             + + + K           + + + L     F  +      +       +   +   N 
Sbjct: 8   DKTEEEQIKRWIKENTLQIVVGVALGLGGIFGFDAYKNYQHSQLIKARSIYLTLVSNPND 67

Query: 67  NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVR 126
                   ++E++ +             I +           A  +L   +D    +++ 
Sbjct: 68  ------TQAYEQLKNNHASSGYLDQATLILAKNAVANKNYMQALEYLAPLSDTS-NISIA 120

Query: 127 YAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFE 186
               ++ AS+ ++   Y++    L  +  P++      N++ G   L   ++  AK  ++
Sbjct: 121 KVVNMRIASLYLEMGHYKQALGALNTV--PNSAFDGLYNQLKGDIYLADKQIDNAKKHYK 178

Query: 187 ELAKDNNSPFGISTRSQMILANII 210
                 +    +    ++ L ++ 
Sbjct: 179 LALNQISKDSKLQNLIKIKLNDLN 202


>gi|148284793|ref|YP_001248883.1| hypothetical protein OTBS_1468 [Orientia tsutsugamushi str.
           Boryong]
 gi|146740232|emb|CAM80545.1| conserved hypothetical protein [Orientia tsutsugamushi str.
           Boryong]
          Length = 226

 Score = 55.4 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 28/213 (13%), Positives = 76/213 (35%), Gaps = 10/213 (4%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
                +    +C +    +  I     L I +  +    ++   E     + + F ++++
Sbjct: 6   QEIKDSDRYQRCLLYYKKFLLIVFSSSLFITAAMMINNFYNARQEAYYQKITDIFIESID 65

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             ++N     +S  + +LS  N     L+++ + +  +  G      ++  ++       
Sbjct: 66  QDSNNSDLIVQSLEKFLLSNYNTKVQELAHIQLLAHKIKVGSFTEVKQLANEILAMKSYS 125

Query: 123 LAVRYAATLQAASILVDTSSYEE----------ISKILQKLSEPSNPMHQFANEILGISA 172
              +    L   ++ +D    ++          + + L     PS P    A+    I A
Sbjct: 126 NFTKAYVRLNLLAMAIDVKQNDDNNSNYDSQIKLIEQLFSEFSPSMPFWSIASIYYAIWA 185

Query: 173 LKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
            + G   KA    E + +   S + + ++++M+
Sbjct: 186 HENGDDNKAVQYLEAVIRSKYSSWNLKSQAKML 218


>gi|148244762|ref|YP_001219456.1| hypothetical protein COSY_0619 [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326589|dbj|BAF61732.1| conserved hypothetical protein [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 205

 Score = 55.4 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/186 (9%), Positives = 64/186 (34%), Gaps = 9/186 (4%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
             + I + LS    F  +      +     + +       ++ ++ +           ++
Sbjct: 29  IIIAITVSLSGIWGFNYYKKYQHSQTIKARDIYLTFRSKPHNIQVYEQL-------KNNH 81

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
           K    L +  +     A  +      +   +  ++ +  ++     ++ A + ++  +Y+
Sbjct: 82  KNSIYLDHAILILAKNAVTNKNYIQALEYLIPLNNTSNPSIAKVINMRIAGLHLEMGNYK 141

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
           +    L  +  P++  +   N++ G   L    +  AK  ++      +    +    ++
Sbjct: 142 KALDALNTV--PNSTFNGLYNQLKGDIYLANNNIDNAKKHYKLALNQISKNSELQNLIKI 199

Query: 205 ILANII 210
            L+++ 
Sbjct: 200 KLSDLN 205


>gi|238897951|ref|YP_002923631.1| hypothetical protein HDEF_0754 [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465709|gb|ACQ67483.1| conserved hypothetical protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 207

 Score = 55.4 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 25/181 (13%), Positives = 59/181 (32%), Gaps = 2/181 (1%)

Query: 18  KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFE 77
           +   K +A  L++ +L+L  W Y  +                +    N   + +   S  
Sbjct: 19  RKNRKALALGLLIGVLALFAWRYWQNYQSSFVSISSSSYQDISQLFLNDKDISEPNISKA 78

Query: 78  KILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASIL 137
           +   Q N            +    +    + AE  L  A  +     +     L+ A + 
Sbjct: 79  EKFIQKNYNNYSGFIALQLAKKFVENQAFDKAEQQLISALLNTKDNNLLSLIYLRLARVQ 138

Query: 138 VDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
           +    +++  K L  +   S+     A  I G   L+   +  A+  +++  + + +   
Sbjct: 139 LQLKQFDKALKSLDNI--YSDFWLGMAENIRGDILLEKNDIAGARAAYKKSIESSIASSQ 196

Query: 198 I 198
           +
Sbjct: 197 L 197


>gi|109899429|ref|YP_662684.1| TPR-like domain-containing protein [Pseudoalteromonas atlantica
           T6c]
 gi|109701710|gb|ABG41630.1| putative membrane-associated protein with TPR-like domain
           [Pseudoalteromonas atlantica T6c]
          Length = 207

 Score = 55.4 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 25/180 (13%), Positives = 50/180 (27%), Gaps = 4/180 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K           +  ++ L     +  ++      K      F   
Sbjct: 1   MEHYETEEQQVEAIKRFWKENGTAIIVGAVLGLGGLWGWRYYNDEQIAAKEQASAAFETQ 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                +    +   +   I    +  Y  L    +A   + + D   A +     A +  
Sbjct: 61  TAALQAQDT-NFGQAKAYIDENSDTGYAVLMAFQLAQQAIDRKDLNEAEKQLSFAAANSE 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           +   V   A L+ A + +     E+    + K++      +    EI G   +K G   K
Sbjct: 120 SDA-VNALANLRLARVQLALEQPEKALASVDKVTTT--AFNAQQQEIKGDIYVKQGMFDK 176


>gi|325294498|ref|YP_004281012.1| hypothetical protein Dester_0297 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064946|gb|ADY72953.1| hypothetical protein Dester_0297 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 224

 Score = 55.0 bits (130), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 23/195 (11%), Positives = 58/195 (29%), Gaps = 9/195 (4%)

Query: 13  KCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDA 72
           K       +      +++  L +   +  +       +    +   + L      K+ +A
Sbjct: 39  KIGTYLITHWKKIFAVVVAFLIVGGGYLSYMWYQNSIEVKASQLVDEGLFKLEKGKIKEA 98

Query: 73  RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQ 132
              F +   +  +  + L   ++   L    D         K      +           
Sbjct: 99  LQLFSEAEKKYPEAPSTLIARFLKGKLEKNSDEFRYLAYKNKYIVSPPS--------KTS 150

Query: 133 AASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
             +  ++     E  K+   L    +  +  A     I AL+ G  +KA  +  E+ K +
Sbjct: 151 LTADYIEKGQLTEAEKLFSTLKRDKDWTYPEALYDSIIVALRKGDRKKALELL-EILKGD 209

Query: 193 NSPFGISTRSQMILA 207
                I+  ++ ++ 
Sbjct: 210 YKDLPITIVAEKLVE 224


>gi|331007916|ref|ZP_08330986.1| putative membrane protein [gamma proteobacterium IMCC1989]
 gi|330418276|gb|EGG92872.1| putative membrane protein [gamma proteobacterium IMCC1989]
          Length = 222

 Score = 55.0 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 76/223 (34%), Gaps = 18/223 (8%)

Query: 6   DANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLF---DGSHEKKKNIVGENFAQALE 62
           D  + + + +  K  +K     L + +L   I ++ F       +++       +++ +E
Sbjct: 3   DHLTEEEQLEQFKNWWKANGASLAIAVLVGLIAYFGFQWWQNHQQQQAEQASALYSELVE 62

Query: 63  LFNSN----------KLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
              +N              A    E++ +        ++    A+ +        AAE  
Sbjct: 63  AIEANPVSGAPVSDENKQTAYYITEQLQTSYAGSQYAVNASLFAAKMAVDDKNVEAAEKA 122

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA 172
           L+ A D+         A+L+ A + V    Y++   +   +   S  +     E+ G   
Sbjct: 123 LQWAVDNSNDALKG-IASLRLARLYVSQEKYDDALAL---IDTKSEALKSLNAELRGDIL 178

Query: 173 LKFGKVQKAKTIFEELAKDNNSPFGI-STRSQMILANIIASDQ 214
           L    V  A+  ++E   +             + LAN+  + +
Sbjct: 179 LAKNDVSGARDAYQEAIDNVGETASFRRQLLPIKLANLAPAGE 221


>gi|257453873|ref|ZP_05619151.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
 gi|257448800|gb|EEV23765.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
          Length = 279

 Score = 55.0 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 66/230 (28%), Gaps = 31/230 (13%)

Query: 8   NSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDG--------------SHEKKK--- 50
           N  +      K    +I   +IL++     W Y                      +    
Sbjct: 11  NDEQQSLGALKQYGGYILSAIILVLAGYFGWSYWQKHGGNIDTAAANDFAKIQSDQNNIE 70

Query: 51  ----NIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
                   +  AQA        LD     F          +  L  M  A     K D K
Sbjct: 71  TLTTQAASDTKAQAQLTTAQTNLDKDLGEFVANHDNSVYTWQAL--MLQAKQQTDKNDLK 128

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANE 166
            AA    K +   L    ++  A L+ A +L+  +  +   K LQ              E
Sbjct: 129 AAAATLQKASQLTLKDDGLKAIAILRQAQVLLSDNQADAAQKRLQS--PLPAAFEASKLE 186

Query: 167 ILGISALKFGKVQKAKTIFEELA------KDNNSPFGISTRSQMILANII 210
           ILG  A + G  + A T +++          NN         ++ + ++ 
Sbjct: 187 ILGDIANQQGDKKAAATHYQKAWQLIEQRNQNNPNPQDRALLRIKMESLG 236


>gi|42521017|ref|NP_966932.1| hypothetical protein WD1220 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410758|gb|AAS14866.1| hypothetical protein WD_1220 [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 204

 Score = 55.0 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 39/185 (21%), Positives = 73/185 (39%), Gaps = 10/185 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L +  +L     + L +  + K+    G+ F + L L   NK          +L 
Sbjct: 25  KYIFLLALAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLFLKKDNKP---------LLE 75

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           + +  +  L+N   A   ++     + A I+  +A+D  AP  +R  A       L+ ++
Sbjct: 76  EIDSNWEYLANFERAFNHISDSMPTDTASIYNDLADDKDAPNVLRELAQYLEVMSLLHSN 135

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             E+I+K      E S      + E + +  +    ++ A  I   L  D   P  I   
Sbjct: 136 G-EKINKDKIDNLESSTVYPYSSQEAIAVVKIHNNDIKGATEILRSLLNDRKCPILIKAN 194

Query: 202 SQMIL 206
           +Q +L
Sbjct: 195 AQELL 199


>gi|90408607|ref|ZP_01216762.1| hypothetical protein PCNPT3_04791 [Psychromonas sp. CNPT3]
 gi|90310299|gb|EAS38429.1| hypothetical protein PCNPT3_04791 [Psychromonas sp. CNPT3]
          Length = 224

 Score = 54.6 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 25/177 (14%), Positives = 56/177 (31%), Gaps = 3/177 (1%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
            K          ++++ SL  W +    +   +   V + +   +  F +   +   +  
Sbjct: 22  WKKNGNTFIITALVVLASLWGWRFYHSSAATSQ-EEVSQEYTDMMIKFTAQGSNKDFTVI 80

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
           EK +S ++     L                N A+  LK         ++     L+ A +
Sbjct: 81  EKFISANSGNNYALLASLSLVKEAVLQKDFNLAKTQLKQLQVSDYSESLNPVINLRLARV 140

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
                 Y+   + L  +SE S        +  G   L    ++ A+  F+   + + 
Sbjct: 141 EAQLKEYDHALETLALISEKS--FMAQVEQARGSVYLLQNDLENARLAFKRGIEASQ 195


>gi|160871620|ref|ZP_02061752.1| transmembrane protein [Rickettsiella grylli]
 gi|159120419|gb|EDP45757.1| transmembrane protein [Rickettsiella grylli]
          Length = 208

 Score = 54.6 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 26/200 (13%), Positives = 52/200 (26%), Gaps = 7/200 (3%)

Query: 12  GKCKMGKCCYKW-IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLD 70
              K     Y   I   +I  I     W Y              +     + + ++  + 
Sbjct: 11  EHVKKWFRDYGGGIVLGIIFAIFVSLGWNYWHQSRENNLSIASMQYEHLVVAIISNENIT 70

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT 130
             +   E+I+                + +    +    A   L    D      +R  A 
Sbjct: 71  TLKKRAEEIIKNYAYTPYASLAALQLAKIAVNQNNLVLAANRLTWVVDHGHDQTLRSIAK 130

Query: 131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
           ++   IL+  +   E  K + +             E  G      G  +KA   +     
Sbjct: 131 MRLVRILLAQNRPIEALKRVSQ--NEDKAYAPIFLEEKGDIFKYLGYNRKALLNY---LA 185

Query: 191 DNNSPFGIST-RSQMILANI 209
              +   I     +M + N+
Sbjct: 186 AKQAFGNIKQPLLEMKINNL 205


>gi|15676749|ref|NP_273894.1| hypothetical protein NMB0853 [Neisseria meningitidis MC58]
 gi|7226089|gb|AAF41264.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|316984260|gb|EFV63236.1| tetratricopeptide repeat family protein [Neisseria meningitidis
           H44/76]
 gi|325140002|gb|EGC62531.1| tetratricopeptide repeat protein [Neisseria meningitidis CU385]
 gi|325200470|gb|ADY95925.1| tetratricopeptide repeat protein [Neisseria meningitidis H44/76]
          Length = 209

 Score = 54.6 bits (129), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 48/173 (27%), Gaps = 3/173 (1%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLD-DARSSFEKILSQDNKLYNPLSNMYIA 96
            + ++      +        A  +E   S     +  +   K+        +      +A
Sbjct: 38  GYTVYQNRKVSQNQEAAAVLANIVEKAQSKAPQSEINAELTKLQQSYPHSISAAQATLMA 97

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
           +         + AE  LK    +     ++  A  +   +L+    Y+     L    E 
Sbjct: 98  AATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEA 157

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
                    E  G      GK Q+A   + +  +            QM L ++
Sbjct: 158 D--FAPLLMETKGDVYAAQGKSQEALKNYGQALEKMPQDSVGRELVQMKLDSL 208


>gi|330859277|emb|CBX69627.1| UPF0070 protein yfgM [Yersinia enterocolitica W22703]
          Length = 125

 Score = 54.2 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/121 (12%), Positives = 39/121 (32%), Gaps = 1/121 (0%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +              + QA
Sbjct: 1   MEVYTTENDQVDAVRRFFSENGKALAVGVVLGIGALVGWRYWQSHQNTVLTEASSAYQQA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  ++N  D    + EK +  +   Y  L+ + +A   V + +   AA+   +  +   
Sbjct: 61  SDALSANSADGVAVA-EKFVQSNKNNYGVLAGLELAHHFVEQNEFDKAAQQLTQALSQTK 119

Query: 121 A 121
            
Sbjct: 120 M 120


>gi|58698192|ref|ZP_00373113.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630884|ref|YP_002727675.1| hypothetical protein WRi_011980 [Wolbachia sp. wRi]
 gi|58535273|gb|EAL59351.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225592865|gb|ACN95884.1| hypothetical protein WRi_011980 [Wolbachia sp. wRi]
          Length = 204

 Score = 53.9 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 40/185 (21%), Positives = 73/185 (39%), Gaps = 10/185 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L +  +L     + L +  + K+    G+ F + L L   NK          +L 
Sbjct: 25  KYIFLLALAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLFLKKDNKP---------LLE 75

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           + +  +  L+N   A   ++     + A I+  +A+D  AP  +R  A       L+ ++
Sbjct: 76  EIDSNWEYLANFERAFNHISDSMPTDTASIYNDLADDKDAPGVLRELAQYLEVMSLLHSN 135

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             E+I+K      E S      + E + +  +    V+ A  I   L  D   P  I   
Sbjct: 136 G-EKINKDKIDNLESSAVYPYSSQEAIAVVKIHNNDVKGATEILHSLLNDRKCPILIKAN 194

Query: 202 SQMIL 206
           +Q +L
Sbjct: 195 AQELL 199


>gi|253689381|ref|YP_003018571.1| hypothetical protein PC1_3012 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251755959|gb|ACT14035.1| conserved hypothetical protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 206

 Score = 53.9 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 68/211 (32%), Gaps = 5/211 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME     N      +           + +++ +   + +  +             ++ Q 
Sbjct: 1   MEVYTTENEQVDALRRFLAENGKALVVGVVLGVGALVGWRFWQNHQNDSVMAASASYQQV 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            E     K D A ++ EK  +++   Y  L+++ +A   V   D   A +  ++  +   
Sbjct: 61  TEQLAEGKTD-AIAATEKFTAENKNAYGALASLELARHYVDLKDFAKAEQQLVQALSQTK 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               +     L+ A + +  +  ++  K L  +            E+ G      G  Q 
Sbjct: 120 -DADLLAVVNLRLARVQLQENKADDALKTLDAIKLEGWASQA--AEVRGDILASKGDNQA 176

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           A+  + +     N         +M L N+ +
Sbjct: 177 ARDAYNKGLSS-NPSQAQQALLRMKLNNLSS 206


>gi|111073626|emb|CAL29488.1| hypothetical protein OW2-B [Wolbachia endosymbiont of Onchocerca
           volvulus]
          Length = 202

 Score = 53.9 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 38/185 (20%), Positives = 70/185 (37%), Gaps = 12/185 (6%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L ++  L + I + L++    K+  I G  F + L                K+L 
Sbjct: 25  KYILLLTLIPFLVIIILYSLYNIDSTKQSTIAGNKFYKVLFSKKD----------IKLLE 74

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           +    +  L+N   A   ++     +AA I+  +A++   P  +R  A       L    
Sbjct: 75  EIGSSWKCLANFESAFNHISNLTPTDAASIYNDMADNQDIPNVLRELAQYLEVMSLF--C 132

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
           + E+I++      E S      + E + I  +    ++ A  I   L  D   P  I   
Sbjct: 133 NNEKINEDKINNLESSIVYPYSSQEAIAIIKIHNNDIKGAVKILHSLLNDRKCPTLIKAN 192

Query: 202 SQMIL 206
           +Q +L
Sbjct: 193 AQELL 197


>gi|328952453|ref|YP_004369787.1| hypothetical protein Desac_0726 [Desulfobacca acetoxidans DSM
           11109]
 gi|328452777|gb|AEB08606.1| hypothetical protein Desac_0726 [Desulfobacca acetoxidans DSM
           11109]
          Length = 224

 Score = 53.9 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/197 (14%), Positives = 71/197 (36%), Gaps = 6/197 (3%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
             + +   + I     ++I++ A W Y+       ++    E +  ++   +S+  D  +
Sbjct: 28  LDLARKNLRTIVIGFAVIIVAGAAWGYIQK-RQMDRQERAAEFYQASVGRASSHVPDLLK 86

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
                I    +      + +Y+A++L  +   + AA  F  +         +R       
Sbjct: 87  ELEIIIQDYPDTGGALQARLYLANVLFGERRYQEAAAAFTALGEAA---PELRVLVAENL 143

Query: 134 ASILVDTSSYEEISKILQKLSEPSN-PMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
           +        Y++ S +L+ L +  N P  Q       +     G+  KA  +F+++ ++ 
Sbjct: 144 SYCYEAQKEYQKASAVLEPLVQDKNLPYRQELQRRQALLYELGGEPAKALKVFKQMLEEK 203

Query: 193 NSPFGISTRSQMILANI 209
             P       +  +  +
Sbjct: 204 -PPADFIPYIREKIKIL 219


>gi|99035091|ref|ZP_01314879.1| hypothetical protein Wendoof_01000285 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 182

 Score = 53.9 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 39/185 (21%), Positives = 73/185 (39%), Gaps = 10/185 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L +  +L     + L +  + K+    G+ F + L L   NK          +L 
Sbjct: 3   KYIFLLALAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLFLKKDNKP---------LLE 53

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           + +  +  L+N   A   ++     + A I+  +A+D  AP  +R  A       L+ ++
Sbjct: 54  EIDSNWEYLANFERAFNHISDSMPTDTASIYNDLADDKDAPNVLRELAQYLEVMSLLHSN 113

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             E+I+K      E S      + E + +  +    ++ A  I   L  D   P  I   
Sbjct: 114 G-EKINKDKIDNLESSTVYPYSSQEAIAVVKIHNNDIKGATEILRSLLNDRKCPILIKAN 172

Query: 202 SQMIL 206
           +Q +L
Sbjct: 173 AQELL 177


>gi|58584744|ref|YP_198317.1| hypothetical protein Wbm0487 [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58419060|gb|AAW71075.1| Predicted protein [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 181

 Score = 53.9 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 35/185 (18%), Positives = 67/185 (36%), Gaps = 11/185 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L +++IL       L +  + K+    G  F + L     NK          +L 
Sbjct: 3   KYIFLLALVLILVGITLHLLHNIDNTKQSITAGNQFYEILFSKKDNK----------LLE 52

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           + +  +  L+N   A   ++     +A  I+  +A++   P  +R  A       L+  +
Sbjct: 53  ETDSNWKHLANFEGAFNHISNLTLTDAVSIYSSMADNKDVPNILRELAQYLEIMNLLHLN 112

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             +     +  L          + E + I  +    ++ A  I   L  D   P  I  R
Sbjct: 113 GEKINENKINNLESSI-VYPYSSQEAIAIVKIHNNDIKGAIKILHLLLNDRKCPTLIKDR 171

Query: 202 SQMIL 206
           +Q +L
Sbjct: 172 AQELL 176


>gi|167627294|ref|YP_001677794.1| hypothetical protein Fphi_1070 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167597295|gb|ABZ87293.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 212

 Score = 53.5 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/183 (11%), Positives = 65/183 (35%), Gaps = 16/183 (8%)

Query: 40  YLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEK---ILSQDNKLYNPLSNMYIA 96
             ++  +EK+     + + +AL    + K   +    +         N  +   ++  +A
Sbjct: 30  QFYNSDNEKRMFEASDIYQRALIANENPKSPTSIKISKFEEVTKDYPNTSFGIFASWQLA 89

Query: 97  SILVAKGDTKNAAEI-----------FLKVANDDLAPLAVRYAATLQAASILVDTSSYEE 145
            + +A  D    +              L+ +       ++     ++ A + + +++ ++
Sbjct: 90  DLYMAPTDLDTKSFNVNLSNLPKAIDVLQQSVQSNPSDSLTDITKVRLAKLYISSNNPDK 149

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
               LQ ++  ++  + +   +LG +  +     KA   + +  +D NS          +
Sbjct: 150 AISTLQSINSLNS--NAYPLMLLGEAYSEKKDKNKALDAWNKALQDPNSSAEFKQIITQL 207

Query: 206 LAN 208
           + N
Sbjct: 208 INN 210


>gi|325130013|gb|EGC52807.1| tetratricopeptide repeat protein [Neisseria meningitidis
           OX99.30304]
 gi|325135933|gb|EGC58543.1| tetratricopeptide repeat protein [Neisseria meningitidis M0579]
          Length = 209

 Score = 53.5 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 48/173 (27%), Gaps = 3/173 (1%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLD-DARSSFEKILSQDNKLYNPLSNMYIA 96
            + ++      +        A  +E   +     +  +   K+        +      +A
Sbjct: 38  GYTVYQNRATSQNQEAAAVLANIVEKAQNKAPQSEINAELTKLQQSYPHSISTAQATLMA 97

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
           +         + AE  LK    +     ++  A  +   +L+    Y+     L    E 
Sbjct: 98  AATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEA 157

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
                    E  G      GK Q+A   + +  +            QM L ++
Sbjct: 158 D--FAPLLMETKGDVYAAQGKSQEALKNYGQALEKMPQDSVGRELVQMKLDSL 208


>gi|304322073|ref|YP_003855716.1| hypothetical protein PB2503_12684 [Parvularcula bermudensis
           HTCC2503]
 gi|303300975|gb|ADM10574.1| hypothetical protein PB2503_12684 [Parvularcula bermudensis
           HTCC2503]
          Length = 260

 Score = 53.5 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 34/203 (16%), Positives = 72/203 (35%), Gaps = 6/203 (2%)

Query: 5   NDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELF 64
            D +  + K       Y  +A     ++      F +     ++        F++A+   
Sbjct: 11  VDDDLLQDKVMATARRYGPLALGAAAIVTVAVGAFSITQSRGDRAAVERATLFSEAV-AA 69

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
                    +       + + LY  ++ M  A+ L  +G    AA     +A D   P+ 
Sbjct: 70  AEQDESAGAAIMLAAADRLDGLYQRMAEMQAAAYLAREGLGAEAATELQAIAADGSLPMR 129

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
           +R  A L+A  I+ D    ++           +  M   A E+  +  L+  K   A   
Sbjct: 130 LRDVARLKAGYIMAD---LDQDVAARLAADVETPAMKGLARELEALILLEQEKYGDAYAA 186

Query: 185 FEELAKDNNS--PFGISTRSQMI 205
             +LA+   +    G++ R++++
Sbjct: 187 LTDLAEGQGAGVTAGLAARARLL 209


>gi|332534675|ref|ZP_08410506.1| putative membrane protein [Pseudoalteromonas haloplanktis ANT/505]
 gi|332035887|gb|EGI72369.1| putative membrane protein [Pseudoalteromonas haloplanktis ANT/505]
          Length = 206

 Score = 53.5 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/209 (13%), Positives = 64/209 (30%), Gaps = 10/209 (4%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           M+  +         K           L IL+ L     +  ++ +         +++   
Sbjct: 1   MDIYSTEEQQAEAIKRFFRENGISLALGILVGLGGLYGWKAYNQNQITTAEKASDSYTAL 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +E       D   S+   I    +  Y  L+    A   V       A+E    + ++  
Sbjct: 61  VES-----DDVLSSADAFISENKDTNYATLAAFVAAKDAVEAKKLDVASEKLSWIVSNTE 115

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  A  + A I +  ++Y++    L          +    E+ G    + G   +
Sbjct: 116 -NTELKAIAITRLARIQIAQTNYDDALTTLNA--PLPEAFNANVAELKGDIYTQQGNKDQ 172

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A+T ++                Q+ L ++
Sbjct: 173 ARTAYQAAIDAGGLTSN--PLLQIKLDDL 199


>gi|254804724|ref|YP_003082945.1| hypothetical protein NMO_0736 [Neisseria meningitidis alpha14]
 gi|254668266|emb|CBA05140.1| putative membrane protein [Neisseria meningitidis alpha14]
 gi|254673334|emb|CBA08524.1| putative membrane protein [Neisseria meningitidis alpha275]
 gi|325132266|gb|EGC54959.1| tetratricopeptide repeat protein [Neisseria meningitidis M6190]
 gi|325137763|gb|EGC60338.1| tetratricopeptide repeat protein [Neisseria meningitidis ES14902]
 gi|325202360|gb|ADY97814.1| tetratricopeptide repeat protein [Neisseria meningitidis
           M01-240149]
 gi|325206316|gb|ADZ01769.1| tetratricopeptide repeat protein [Neisseria meningitidis
           M04-240196]
 gi|325207888|gb|ADZ03340.1| tetratricopeptide repeat protein [Neisseria meningitidis NZ-05/33]
          Length = 209

 Score = 53.5 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 48/173 (27%), Gaps = 3/173 (1%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLD-DARSSFEKILSQDNKLYNPLSNMYIA 96
            + ++      +        A  +E   +     +  +   K+        +      +A
Sbjct: 38  GYTVYQNRAASQNQEAAAVLANIVEKAQNKAPQSEINAELTKLQQSYPHSISAAQATLMA 97

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
           +         + AE  LK    +     ++  A  +   +L+    Y+     L    E 
Sbjct: 98  AATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEA 157

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
                    E  G      GK Q+A   + +  +            QM L ++
Sbjct: 158 D--FSPLLMETKGDVYAAQGKSQEALKNYGQALEKMPQDSVGRELVQMKLDSL 208


>gi|254670449|emb|CBA06086.1| putative membrane protein [Neisseria meningitidis alpha153]
          Length = 209

 Score = 53.1 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 49/173 (28%), Gaps = 3/173 (1%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLD-DARSSFEKILSQDNKLYNPLSNMYIA 96
            + ++      +        A+ +E   S     +  +   K+        +      +A
Sbjct: 38  GYTVYQNRAASQNQEAAAILAEIVEKAQSKAPQSEINAELTKLQQSYPHSISAAQATLMA 97

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
           +         + AE  LK    +     ++  A  +   +L+    Y+     L    E 
Sbjct: 98  AATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEA 157

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
                    E  G      GK Q+A   + +  +            QM L ++
Sbjct: 158 D--FAPLLMETKGDVYAAQGKSQEALKNYGQALEKMPQDSVGRELVQMKLDSL 208


>gi|162448875|ref|YP_001611242.1| hypothetical protein sce0605 [Sorangium cellulosum 'So ce 56']
 gi|161159457|emb|CAN90762.1| Hypothetical protein sce0605 [Sorangium cellulosum 'So ce 56']
          Length = 1450

 Score = 53.1 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/163 (10%), Positives = 43/163 (26%), Gaps = 2/163 (1%)

Query: 51   NIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              +G+ + Q   L           +  KI  +                            
Sbjct: 1284 AELGDAYWQRGVLLQKQGASRDALADLKIALEKRPSRYEAYATMALCYQDQGNWAAAEEA 1343

Query: 111  IFLKVANDDLAPLAVRYAATLQAASILVD--TSSYEEISKILQKLSEPSNPMHQFANEIL 168
                +A +D  P        + A+        S  E+   + +     + P    A+ +L
Sbjct: 1344 WRKAIAANDKVPEWHYRLGKIYASRGNRAGTASEMEQAVALGEAPDRSTPPWLFDAHFLL 1403

Query: 169  GISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
              +       +K+   ++   +   +       ++  L ++ A
Sbjct: 1404 AEALRATNNREKSIHHYQRFLETAPTDNAYRRDAEQALESLGA 1446


>gi|296314653|ref|ZP_06864594.1| tetratricopeptide repeat protein [Neisseria polysaccharea ATCC
           43768]
 gi|296838562|gb|EFH22500.1| tetratricopeptide repeat protein [Neisseria polysaccharea ATCC
           43768]
          Length = 209

 Score = 53.1 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 48/173 (27%), Gaps = 3/173 (1%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLD-DARSSFEKILSQDNKLYNPLSNMYIA 96
            + ++      +        A  +E   +     +  +   K+        +      +A
Sbjct: 38  GYTVYQNRAASQNQEAAAVLANIVEKAQNKAPQSEINAELTKLQQSYPHSISAAQATLMA 97

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
           +         + AE  LK    +     ++  A  +   +L+    Y+     L    E 
Sbjct: 98  AATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEA 157

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
                    E  G      GK Q+A   + +  +            QM L ++
Sbjct: 158 D--FAPLLMETKGDVYAAQGKSQEALKNYGQALEKMPQDSVGRELVQMKLDSL 208


>gi|187735551|ref|YP_001877663.1| hypothetical protein Amuc_1056 [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187425603|gb|ACD04882.1| hypothetical protein Amuc_1056 [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 245

 Score = 53.1 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 61/165 (36%), Gaps = 3/165 (1%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQAL-ELFNSNKLDDARSSFEKILSQDNKLYNPLSN 92
             A W  +++G  +  +   G     A+ E   + ++       +++++  +     ++ 
Sbjct: 52  GAAGWI-IYNGVQDSMERKAGAALVAAMPESPATGEISLDEQGLQQVVADFDSSRAAVTA 110

Query: 93  MYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQK 152
            Y+ +I +     ++     +K   D       +  A++  A  L++    +E   + + 
Sbjct: 111 SYLQAIALWNAGKEDEGVAKMKAFIDSAPTEEWKAQASVTLACRLMNRGKADEAEGLFRS 170

Query: 153 LSEPSNP-MHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
           + +  +P    FA   LG  A        A   + ELA+   S  
Sbjct: 171 VVDAGDPTFSGFATMCLGDIARAKKDNAAAGAFYRELAEKFPSSA 215


>gi|114562296|ref|YP_749809.1| hypothetical protein Sfri_1118 [Shewanella frigidimarina NCIMB 400]
 gi|114333589|gb|ABI70971.1| conserved hypothetical protein [Shewanella frigidimarina NCIMB 400]
          Length = 206

 Score = 52.7 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 62/194 (31%), Gaps = 4/194 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K     Y     +  ++ L     +  +            E+F   
Sbjct: 1   MEIYSTEEQQVDAIKQFWKDYGTSIVVGAVVGLGGLYGWNTYSDMKVTAAEEASESFQSI 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +   ++N       +       D + Y  L  + +A   V  GD   A   F KV     
Sbjct: 61  VTQ-SANPAALLVQAENFTSEHDQQGYQALLELMVAKSAVEAGDLAKAEASFTKVIAAQP 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                   A ++ A I  + ++       L+++++          E+ G   ++ G + K
Sbjct: 120 GSGLGM-VAMIRLARIQAEQNNLGMALATLEQVTDK--AFASQREELKGDFLVRQGDLDK 176

Query: 181 AKTIFEELAKDNNS 194
           AK+ ++    +  +
Sbjct: 177 AKSAYQAAVDNGGA 190


>gi|187931101|ref|YP_001891085.1| hypothetical protein FTM_0230 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|187712010|gb|ACD30307.1| conserved hypothetical protein [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 212

 Score = 52.7 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/185 (11%), Positives = 63/185 (34%), Gaps = 16/185 (8%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEK---ILSQDNKLYNPLSNMY 94
           +   ++ S++KK       + +AL    + K        +    +    N  +   ++  
Sbjct: 28  FLQFYNSSNDKKMLEASTIYQKALIANENPKSSVETKIAKFEQVVNDYPNTSFGIFASWQ 87

Query: 95  IASILVAKGDTKNAAEI-----------FLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
           +A +        +                L+ + ++    ++   + ++ A + +     
Sbjct: 88  LADLYTTPTKPDSKNFNVNITNLPKAIVILQQSIENNPKDSLSDISKVRLARLYIVAKQP 147

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           ++  K LQ +    +  + +   +LG +  +     KA   +++  +D NS         
Sbjct: 148 DQAIKTLQGIKSFKD--NAYPLMLLGQAYSEKKDKVKAIESWQKALQDPNSSDQFKQIIS 205

Query: 204 MILAN 208
            ++ N
Sbjct: 206 QLINN 210


>gi|261400172|ref|ZP_05986297.1| tetratricopeptide repeat protein [Neisseria lactamica ATCC 23970]
 gi|269210171|gb|EEZ76626.1| tetratricopeptide repeat protein [Neisseria lactamica ATCC 23970]
          Length = 209

 Score = 52.7 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 49/173 (28%), Gaps = 3/173 (1%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSS-FEKILSQDNKLYNPLSNMYIA 96
            + ++      +        A  +E   +    +  ++   K+        +      +A
Sbjct: 38  GYTVYQNRTASQNQEAAAVLADIVEKAQNKAPQNEINAELTKLQQSYPHSISAAQATLMA 97

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
           +         + AE  LK    +     ++  A  +   +L+    Y+     L    E 
Sbjct: 98  AATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEA 157

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
                    E  G      GK Q+A   + +  K            QM L ++
Sbjct: 158 D--FSPLLMETKGDVYAAQGKNQEALKNYGQALKKMPQDSVGRELLQMKLDSL 208


>gi|121634629|ref|YP_974874.1| hypothetical protein NMC0793 [Neisseria meningitidis FAM18]
 gi|120866335|emb|CAM10077.1| putative membrane protein [Neisseria meningitidis FAM18]
 gi|308389026|gb|ADO31346.1| putative membrane protein [Neisseria meningitidis alpha710]
 gi|325127950|gb|EGC50851.1| tetratricopeptide repeat protein [Neisseria meningitidis N1568]
          Length = 209

 Score = 52.7 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 49/173 (28%), Gaps = 3/173 (1%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSS-FEKILSQDNKLYNPLSNMYIA 96
            + ++      +        A  +E   +    +  ++   K+        +      +A
Sbjct: 38  GYTVYQNRAASQNQEAAAVLANIVEKAQNKAPQNEINAELAKLQQSYPHSISAAQATLMA 97

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
           +         + AE  LK    +     ++  A  +   +L+    Y+     L    E 
Sbjct: 98  AATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEA 157

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
                    E  G      GK Q+A   + +  +            QM L ++
Sbjct: 158 D--FSPLLMETKGDVYAAQGKSQEALKNYGQALEKMPQDSVGRELVQMKLDSL 208


>gi|58696863|ref|ZP_00372380.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58536925|gb|EAL60101.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila simulans]
          Length = 193

 Score = 52.7 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 40/185 (21%), Positives = 73/185 (39%), Gaps = 10/185 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L +  +L     + L +  + K+    G+ F + L L   NK          +L 
Sbjct: 14  KYIFLLALAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLFLKKDNKP---------LLE 64

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
           + +  +  L+N   A   ++     + A I+  +A+D  AP  +R  A       L+ ++
Sbjct: 65  EIDSNWEYLANFERAFNHISDSMPTDTASIYNDLADDKDAPGVLRELAQYLEVMSLLHSN 124

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR 201
             E+I+K      E S      + E + +  +    V+ A  I   L  D   P  I   
Sbjct: 125 G-EKINKDKIDNLESSAVYPYSSQEAIAVVKIHNNDVKGATEILHSLLNDRKCPILIKAN 183

Query: 202 SQMIL 206
           +Q +L
Sbjct: 184 AQELL 188


>gi|332184659|gb|AEE26913.1| hypothetical protein FN3523_1610 [Francisella cf. novicida 3523]
          Length = 211

 Score = 52.3 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/183 (9%), Positives = 61/183 (33%), Gaps = 16/183 (8%)

Query: 40  YLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEK---ILSQDNKLYNPLSNMYIA 96
             ++ +++KK       + +AL    + K        +    +    +  +   ++  +A
Sbjct: 30  QFYNSNNDKKMLDASTIYQKALIASENPKSPLDTKIAKFEQVVNDYPSTSFGIFASWQLA 89

Query: 97  SILVAKGDTKNAAEIF-----------LKVANDDLAPLAVRYAATLQAASILVDTSSYEE 145
            +                         L+ + ++    ++   + ++ A + +     ++
Sbjct: 90  DLYTTATQPDTKNFNMNLTNLPKAILVLQQSIENNPKDSLSDISKVRLARLYIAAKQPDQ 149

Query: 146 ISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
             K L+ +    +  + +   +LG +  +     KA   +++  +D NS          +
Sbjct: 150 AIKTLENIKSFKD--NAYPLMLLGQAYSEKKDKTKAIETWQKALQDPNSSAEFKQIISQL 207

Query: 206 LAN 208
           + N
Sbjct: 208 INN 210


>gi|119356540|ref|YP_911184.1| TPR repeat-containing protein [Chlorobium phaeobacteroides DSM 266]
 gi|119353889|gb|ABL64760.1| Tetratricopeptide TPR_2 repeat protein [Chlorobium phaeobacteroides
           DSM 266]
          Length = 226

 Score = 52.3 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/210 (8%), Positives = 52/210 (24%), Gaps = 8/210 (3%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVG------ 54
           ++          +       YK    + + +I++     + +    +  +          
Sbjct: 9   LKQQPVKEKLVDQLLYIVIKYKTALIITLALIITAGAGIFFWIRYQDTSEKEAALHLSRI 68

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
                  +   +   D      +KI  +   + +      + +         ++A     
Sbjct: 69  APLVDLGQYRAAIDGDSKIPGLKKIDEKYGHVLSGKMAGLLLANTYYALRQPDSALTVFN 128

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALK 174
             +     L+    A                 +      +  ++ +          S L 
Sbjct: 129 RLSFKNKDLSAAALAGSGDCYTEKKQFDNAAKAYEKAAETAENSTLKAQYLASAADSYLA 188

Query: 175 FGKVQKAKTIFEELAKDNNSPFG--ISTRS 202
              V+KA   +  +  D     G  +S R+
Sbjct: 189 TKDVKKASDFYTRIIADYPGSTGAILSQRA 218


>gi|313668680|ref|YP_004048964.1| membrane protein [Neisseria lactamica ST-640]
 gi|313006142|emb|CBN87603.1| putative membrane protein [Neisseria lactamica 020-06]
          Length = 209

 Score = 52.3 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 49/173 (28%), Gaps = 3/173 (1%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLD-DARSSFEKILSQDNKLYNPLSNMYIA 96
            + ++      +        A+ +E   +     +  +   K+        +      +A
Sbjct: 38  GYTVYQNRKVSQNQEAAAILAEIVEKAQNKAPQSEINAELTKLQQSYPHSISAAQATLMA 97

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
           +         + AE  LK    +     ++  A  +   +L+    Y+     L    E 
Sbjct: 98  AATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEA 157

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
                    E  G      GK Q+A   + +  +            QM L ++
Sbjct: 158 D--FAPLLMETKGNVYAAQGKNQEALKNYGQALEKMPQDSVGRELLQMKLDSL 208


>gi|161869788|ref|YP_001598956.1| membrane protein [Neisseria meningitidis 053442]
 gi|161595341|gb|ABX73001.1| membrane protein [Neisseria meningitidis 053442]
          Length = 205

 Score = 51.9 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 63/209 (30%), Gaps = 5/209 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME   + +++K      K   KW+  LLIL  L    +    + +  + +          
Sbjct: 1   MEEQQELDNFKYF---WKTTGKWLFALLILAALGYLGYTVYQNRATSQNQEAAAVLANIV 57

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            +  N     +  +   K+        +      +A+         + AE  LK    + 
Sbjct: 58  EKAQNKAPQSEINAELTKLQQSYPHSISTAQATLMAAATEFDAQRYDVAEGHLKWVLSNQ 117

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
               ++  A  +   +L+    Y+     L    E          E  G      GK Q+
Sbjct: 118 KDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEAD--FAPLLMETKGDVYAAQGKSQE 175

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILANI 209
           A   + +  +            QM L ++
Sbjct: 176 ALKNYGQALEKMPQDSVGRELVQMKLDSL 204


>gi|329120374|ref|ZP_08249041.1| tetratricopeptide repeat protein [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327462329|gb|EGF08655.1| tetratricopeptide repeat protein [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 209

 Score = 51.9 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 43/173 (24%), Gaps = 3/173 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYK-WIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQ 59
           M ++ D        K     +  W+  LLI    +   W         K         A 
Sbjct: 1   MAAHIDEQQELENFKYFWRNWGRWLFALLIAGAAAYFAWVMYQQHQKTKNGEAAAALAAL 60

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
             +  NS      ++    +               + +         + AE  L     +
Sbjct: 61  VGKAQNSKDDKAVQADLSGLQQNYPSSIAAAQATMMVAADAFDKGRYDEAEKQLSWVLQN 120

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISA 172
                V+  A  + A++ +    Y+     L   +          +E  G   
Sbjct: 121 QKEPFVQALAVQRLATVQMQQKKYDAALATLN--TPTDPAFAAAIDETRGDVY 171


>gi|309379418|emb|CBX21985.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 209

 Score = 51.9 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 48/173 (27%), Gaps = 3/173 (1%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLD-DARSSFEKILSQDNKLYNPLSNMYIA 96
            + ++      +        A  +E   +     +  +   K+        +      +A
Sbjct: 38  GYTVYQNRAASQNQEAAAVLANIVEKAQNKAPQSEINAELAKLQQSYPHSISAAQATLMA 97

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
           +         + AE  LK    +     ++  A  +   +L+    Y+     L    E 
Sbjct: 98  AATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEA 157

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
                    E  G      GK Q+A   + +  +            QM L ++
Sbjct: 158 D--FSPLLMETKGDVYAAQGKNQEALKNYGQALEKMPQDSVGRELLQMKLDSL 208


>gi|145219351|ref|YP_001130060.1| TPR repeat-containing protein [Prosthecochloris vibrioformis DSM
           265]
 gi|145205515|gb|ABP36558.1| TPR repeat-containing protein [Chlorobium phaeovibrioides DSM 265]
          Length = 224

 Score = 51.9 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 27/215 (12%), Positives = 52/215 (24%), Gaps = 7/215 (3%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
            N+ A+S           YK       L  L  A   Y +      ++   G   +   +
Sbjct: 9   INDSASSAVDNLLFFGIKYKNALIGATLFCLLAAAGTYFWMSRQADRELEAGMQLSAVEQ 68

Query: 63  LFNSNKL------DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           L            D      E I +  N   +      + +         ++A       
Sbjct: 69  LLQRGDYRAAIKGDKENPGLETIAASYNGTRSGEMAALLLANAWYSLGEPDSALTAFNTV 128

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
           +     L     A   A        +              +N +             K G
Sbjct: 129 SMKNPDLQAAVLAGKGACFSNRKEYAKAAEHYEKASGKAVNNALKASYLVDAADCMAKDG 188

Query: 177 KVQKAKTIFEELAKDNNSPFGISTRSQMILANIIA 211
           K   A+  +  + +      G ++ +Q  L  +  
Sbjct: 189 KEDNARQRYSNIIETYPGSAGAAS-AQRSLWMLSG 222


>gi|134301373|ref|YP_001121341.1| hypothetical protein FTW_0257 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|134049150|gb|ABO46221.1| hypothetical protein FTW_0257 [Francisella tularensis subsp.
           tularensis WY96-3418]
          Length = 212

 Score = 51.9 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 21/185 (11%), Positives = 63/185 (34%), Gaps = 16/185 (8%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEK---ILSQDNKLYNPLSNMY 94
           +   ++ S++KK       + +AL    + K        +    +    N  +   ++  
Sbjct: 28  FLQFYNSSNDKKMLEASTIYQKALIANENPKSSVETKIAKFEQVVNDYPNTSFGIFASWQ 87

Query: 95  IASILVAKGDTKNAAEI-----------FLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
           +A +        +                L+ + ++    ++   + ++ A + +     
Sbjct: 88  LADLYTTPTKPDSKNFNVNITNLPKAIAILQQSIENNPKDSLSDISKVRLARLYIVAKQP 147

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           ++  K LQ +    +  + +   +LG +  +     KA   +++  +D NS         
Sbjct: 148 DQAIKTLQGIKSFKD--NAYPLMLLGQAYSEKKDKVKAIESWQKALQDPNSSDQFKQIIS 205

Query: 204 MILAN 208
            ++ N
Sbjct: 206 QLINN 210


>gi|296234103|ref|XP_002762334.1| PREDICTED: kinesin light chain 3-like [Callithrix jacchus]
          Length = 493

 Score = 51.9 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 57/199 (28%), Gaps = 18/199 (9%)

Query: 8   NSYKGKCKMGKCCYKWIAPLLILMILSLA------IWFYLFDGSHEKKKNIVGENFAQAL 61
           NS   +C+           L +   +S+       + FYL +   + K     +    AL
Sbjct: 212 NSSNERCRRFYSE------LAVAGPVSVWHDGMGCVLFYLENEWDQNKYKEATDLLHDAL 265

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           ++               + +  N L                          +  A+    
Sbjct: 266 QIREQ----TLGPEHPAVAATLNNLAVLYGKRGRYREAEPLCQRALEIREKVLGADHPDV 321

Query: 122 PLAVRYAATLQAASILVDTSS--YEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
              +   A L       +     Y     I + L  P +P        L  + LK  K Q
Sbjct: 322 AKQLNNLALLCQNQGKFEDVERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNKYQ 381

Query: 180 KAKTIFEELAKDNNSPFGI 198
           +A+ +++E+    + P  +
Sbjct: 382 QAEELYKEILHQEDLPAPL 400


>gi|238021956|ref|ZP_04602382.1| hypothetical protein GCWU000324_01861 [Kingella oralis ATCC 51147]
 gi|237866570|gb|EEP67612.1| hypothetical protein GCWU000324_01861 [Kingella oralis ATCC 51147]
          Length = 203

 Score = 51.9 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 33/193 (17%), Positives = 60/193 (31%), Gaps = 12/193 (6%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
                KW+A +L+   L    +         K +   G   A  L            +  
Sbjct: 23  WHSGGKWVAAVLVAGALGYVGYVAY------KGRVHQGSAQAAQLAAQVKGDAAKLAALQ 76

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
           ++           L     A+ L   G   +AA+ +  V  +D  P   + AA    A++
Sbjct: 77  QQFPKDTATTQASL---QTAAALFQAGKLDDAAKAYQWVLANDKTP-VFQAAAMQNLANV 132

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
            +    Y++  K L        P     NE  G      GK ++A   ++          
Sbjct: 133 YIQQKKYDDALKTLAMPVS--EPYQPLINETKGDVFAAQGKAKEAGEAYKLALDKLPENS 190

Query: 197 GISTRSQMILANI 209
           G     +M ++ +
Sbjct: 191 GNRQFIRMKMSQL 203


>gi|116751468|ref|YP_848155.1| sporulation domain-containing protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116700532|gb|ABK19720.1| Sporulation domain protein [Syntrophobacter fumaroxidans MPOB]
          Length = 538

 Score = 51.9 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 31/174 (17%), Positives = 53/174 (30%), Gaps = 11/174 (6%)

Query: 45  SHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD 104
              ++  ++GE F  A +   + K   A         Q       L      +       
Sbjct: 33  YSAEQLRVMGEKFLAAGDSIQAVKYLTAA-------EQKTPKDPTLLYYIGVAYSGRNMH 85

Query: 105 TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFA 164
            +  +     +A     P        L A     D +         + L+ P     QFA
Sbjct: 86  AEALSYYQKALAEKPDYPEVYNAMGVLYAGRGQYDQAQA----AFQKVLASPFYETPQFA 141

Query: 165 NEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK 218
              LG+   K G  Q A   ++E A+   +      R+ MIL     + +  K+
Sbjct: 142 RYNLGLVYEKKGDQQAALQQYQEAARLQPTHALSHHRTAMILEAQGRAGEAQKE 195


>gi|313676599|ref|YP_004054595.1| hypothetical protein [Marivirga tractuosa DSM 4126]
 gi|312943297|gb|ADR22487.1| Tetratricopeptide TPR_1 repeat-containing protein [Marivirga
           tractuosa DSM 4126]
          Length = 232

 Score = 51.5 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 75/209 (35%), Gaps = 13/209 (6%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            K +      K I   L  +I  + + F+ +            +   QA+  + + + D 
Sbjct: 26  SKTEEFIENNKKIVFGLGGIIALIIVAFFGYRYYMNNLNQEAQKEMFQAVYWYENEEYDL 85

Query: 72  ARSS-------FEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           A +           +    +     L++ Y+ SI + +G+ + A +     ++D    L 
Sbjct: 86  ALNGDGNNFGFLAIVEDYGSTKAGNLASFYLGSIYLQQGEFETAIDYLEDFSSD---DLL 142

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFGKVQKAK 182
           V+  A        ++  +Y   +    K +   +        ++  G++  K   ++ A 
Sbjct: 143 VQARAYALIGDAYMELGNYSTAADHYGKAANYKSNKEFSPEYLMKQGLAYEKANDLEAAM 202

Query: 183 TIFEELAKDNNSPFGISTRSQMILANIIA 211
             + ++ KD  S     T +Q  L+ + A
Sbjct: 203 GSYRKVVKD-FSDSKQKTEAQKYLSRLEA 230


>gi|254481862|ref|ZP_05095105.1| tetratricopeptide repeat domain protein [marine gamma
           proteobacterium HTCC2148]
 gi|214037991|gb|EEB78655.1| tetratricopeptide repeat domain protein [marine gamma
           proteobacterium HTCC2148]
          Length = 402

 Score = 51.5 bits (121), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 56/167 (33%), Gaps = 3/167 (1%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKK-KNIVGENFAQALELFNSNKLDDARSSFEKILSQ 82
                +  +  +  W+    G  +      +   + + L      K D A  +F   L  
Sbjct: 4   YLVFALFFVAIVIGWYLGRRGQAKSASAPDLPGQYYKGLNYLLDGKPDGAVDAFINALEV 63

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSS 142
           +++      ++ + ++L  +G+   A  I   +      P A  + A L+ A   +    
Sbjct: 64  NSETLET--HIALGNLLRKRGEVDRAIRIHQNLLARPSLPRAQVHQAHLELARDYISAGL 121

Query: 143 YEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            +   ++L  L   S    + +   L        + Q+A  I  EL 
Sbjct: 122 LDRAERLLLDLVAESPIQRRDSQLHLLDIYQSEREWQQAIDIAVELL 168


>gi|284040468|ref|YP_003390398.1| hypothetical protein Slin_5634 [Spirosoma linguale DSM 74]
 gi|283819761|gb|ADB41599.1| Tetratricopeptide TPR_2 repeat protein [Spirosoma linguale DSM 74]
          Length = 231

 Score = 51.5 bits (121), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 24/188 (12%), Positives = 57/188 (30%), Gaps = 12/188 (6%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
                     K I   ++  I+ L + F+ +      +          +L    ++ L  
Sbjct: 22  EDVGDYFQQNKNIVLGILGGIVLLVVGFFGYRYYISTQDETAQVEMFPSLYQLEADSLKK 81

Query: 72  A-------RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           A               +  +     L+  Y    L+ +G    A +          + L 
Sbjct: 82  ALNGDGRNPGLLAVADNYGSTPGGNLAEFYAGLGLLKEGKYDEAIDHLKSF---SSSDLL 138

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF--ANEILGISALKFGKVQKAK 182
           V+  A        ++  S++E +   +K ++              LG++  +  +  KA 
Sbjct: 139 VQARAYALTGDAYMEKKSFDEAADYYRKAADYKPNKFFSPGYLLKLGVAYEQAKQNDKAI 198

Query: 183 TIFEELAK 190
             + E+ +
Sbjct: 199 AAYNEIIE 206


>gi|317492357|ref|ZP_07950786.1| TPR repeat-containing protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919696|gb|EFV41026.1| TPR repeat-containing protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 389

 Score = 51.2 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 26/162 (16%), Positives = 57/162 (35%), Gaps = 6/162 (3%)

Query: 32  ILSLAIWFYLFDGSHEKKKNIVGEN---FAQALELFNSNKLDDARSSFEKILSQDNKLYN 88
           + +   W+     + + K+         +   +    SN+ D A   F  +L +D+    
Sbjct: 11  VAAAYGWYMGRRSAQQDKQQEASRLSREYVAGVNFLLSNQQDKAVDLFLDMLKEDSNTVE 70

Query: 89  PLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISK 148
              ++ + ++  ++G+   A  I   +          R  A  Q     +    Y+   +
Sbjct: 71  A--HLTLGNLFRSRGEVDRAIRIHQALMESASLTFDQRLLAVQQLGRDYMAAGLYDRAEE 128

Query: 149 ILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
           +  +L +  +     A + L I        QKA  + E+L K
Sbjct: 129 MFNQLVDEQD-FKVSALQQLLIIYQATSDWQKAIDVAEKLVK 169


>gi|311113427|ref|YP_003984649.1| hypothetical protein HMPREF0733_11758 [Rothia dentocariosa ATCC
           17931]
 gi|310944921|gb|ADP41215.1| conserved hypothetical protein [Rothia dentocariosa ATCC 17931]
          Length = 792

 Score = 51.2 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 43/125 (34%), Gaps = 3/125 (2%)

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +  KLD+A +++  I   D+      + + + +    +G    A   +  +         
Sbjct: 97  DQGKLDEAITTWSNIHHNDDPQAYAWAQLGLGNAYKDQGKLDEAITTWSNI--HHNDDPQ 154

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF-ANEILGISALKFGKVQKAKT 183
              +A L   +   D    +E       +    NP     A   LG +    GK+ +A  
Sbjct: 155 AYASAQLGLGNAYHDQGKLDEAITTWSNIHHNDNPQAYAGAQRNLGNAYHDQGKLDEAIA 214

Query: 184 IFEEL 188
            + ++
Sbjct: 215 AWSKV 219



 Score = 49.2 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/150 (13%), Positives = 46/150 (30%), Gaps = 4/150 (2%)

Query: 41  LFDGSHEKKKNI-VGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASIL 99
             +  H        G          +  KLD+A +++ K+   D+      + + + +  
Sbjct: 180 WSNIHHNDNPQAYAGAQRNLGNAYHDQGKLDEAIAAWSKVRHSDDPQAYASAQLGLGNAY 239

Query: 100 VAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNP 159
             +G    A   +  +             A L       D    E+      K+    +P
Sbjct: 240 KDQGKLDEAITTWSNI--HHNDNPQAYAWAQLGLGVAYHDQGEPEQAIAAWSKVRHSDDP 297

Query: 160 MHQFA-NEILGISALKFGKVQKAKTIFEEL 188
                    LG++    G+ ++A   + ++
Sbjct: 298 KAYAWAQYSLGVAYHDQGEPEQAIAAWSKV 327



 Score = 48.8 bits (114), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/125 (15%), Positives = 44/125 (35%), Gaps = 3/125 (2%)

Query: 65  NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLA 124
           +  KLD+A +++  I   D+      + + + +    +G    A   +  +         
Sbjct: 133 DQGKLDEAITTWSNIHHNDDPQAYASAQLGLGNAYHDQGKLDEAITTWSNI--HHNDNPQ 190

Query: 125 VRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEI-LGISALKFGKVQKAKT 183
               A     +   D    +E      K+    +P    + ++ LG +    GK+ +A T
Sbjct: 191 AYAGAQRNLGNAYHDQGKLDEAIAAWSKVRHSDDPQAYASAQLGLGNAYKDQGKLDEAIT 250

Query: 184 IFEEL 188
            +  +
Sbjct: 251 TWSNI 255



 Score = 35.0 bits (78), Expect = 7.7,   Method: Composition-based stats.
 Identities = 12/87 (13%), Positives = 27/87 (31%), Gaps = 1/87 (1%)

Query: 103 GDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQ 162
            + K +  I +               A L            +++     K+    +P   
Sbjct: 25  NEGKISEAIEVWSNITRDDNPKAYAWAQLNLGLAYESPGELDQVIAAWSKVRHSDDPKAY 84

Query: 163 FANEI-LGISALKFGKVQKAKTIFEEL 188
              ++ LG +    GK+ +A T +  +
Sbjct: 85  AWAQLGLGNAYKDQGKLDEAITTWSNI 111


>gi|68171273|ref|ZP_00544675.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999320|gb|EAM85967.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
          Length = 200

 Score = 51.2 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 68/188 (36%), Gaps = 4/188 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           KWI  +++++++  A      +  HEK    +G+    AL    S    +       +  
Sbjct: 13  KWICGIIVVLLVVFAGMVSWVNNRHEKLSQRMGDMMYDALMGEVSEH--EMIKILNDVAK 70

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            D   Y  L+   +A +     +   A  I+  +A D      +R  A       L+   
Sbjct: 71  VDGSNYQYLAKFKLAGMYGE-NEVAKAQSIYADLAADKRLMPELRELAEYLEIIALLKGE 129

Query: 142 SYEEISKILQK-LSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
             + +   +QK LS  S        E + +  LK   +  A  + +E+  + +S   +  
Sbjct: 130 DLDLLKSKVQKFLSTKSEVYKSSIKEAIAVYMLKNNNIDGAIEVIKEIVGNADSELMVYK 189

Query: 201 RSQMILAN 208
            +  +L  
Sbjct: 190 HAMDLLQI 197


>gi|89256992|ref|YP_514354.1| hypothetical protein FTL_1723 [Francisella tularensis subsp.
           holarctica LVS]
 gi|115315352|ref|YP_764075.1| hypothetical protein FTH_1662 [Francisella tularensis subsp.
           holarctica OSU18]
 gi|156503192|ref|YP_001429257.1| hypothetical protein FTA_1826 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167009373|ref|ZP_02274304.1| tetratricopeptide repeat domain [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254368247|ref|ZP_04984267.1| hypothetical protein FTHG_01602 [Francisella tularensis subsp.
           holarctica 257]
 gi|254369842|ref|ZP_04985852.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|290954487|ref|ZP_06559108.1| hypothetical protein FtulhU_09911 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312092|ref|ZP_06802905.1| hypothetical protein FtulhU_09898 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89144823|emb|CAJ80162.1| conserved hypothetical membrane protein [Francisella tularensis
           subsp. holarctica LVS]
 gi|115130251|gb|ABI83438.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134254057|gb|EBA53151.1| hypothetical protein FTHG_01602 [Francisella tularensis subsp.
           holarctica 257]
 gi|156253795|gb|ABU62301.1| hypothetical protein FTA_1826 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|157122801|gb|EDO66930.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 212

 Score = 51.2 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/185 (11%), Positives = 63/185 (34%), Gaps = 16/185 (8%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEK---ILSQDNKLYNPLSNMY 94
           +   ++ S++KK       + +AL    + K        +    +    N  +   ++  
Sbjct: 28  FLQFYNSSNDKKMLEASTIYQKALIANENPKSSVETKIAKFEQVVNDYPNTSFGIFASWQ 87

Query: 95  IASILVAKGDTKNAAEI-----------FLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
           +A +        +                L+ + ++    ++   + ++ A + +     
Sbjct: 88  LADLYTTPTKLDSKNFNVNITNLPKAIAILQQSIENNPKDSLSDISKVRLARLYIVAKQP 147

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           ++  K LQ +    +  + +   +LG +  +     KA   +++  +D NS         
Sbjct: 148 DQAIKTLQGIKSFKD--NAYPLMLLGQAYSEKKDKVKAIESWQKALQDPNSSDQFKQIIS 205

Query: 204 MILAN 208
            ++ N
Sbjct: 206 QLINN 210


>gi|118498115|ref|YP_899165.1| hypothetical protein FTN_1547 [Francisella tularensis subsp.
           novicida U112]
 gi|194323342|ref|ZP_03057126.1| tetratricopeptide repeat domain protein [Francisella tularensis
           subsp. novicida FTE]
 gi|208779472|ref|ZP_03246817.1| tetratricopeptide repeat domain protein [Francisella novicida FTG]
 gi|254373466|ref|ZP_04988954.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254374927|ref|ZP_04990408.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|118424021|gb|ABK90411.1| conserved protein of unknown function [Francisella novicida U112]
 gi|151571192|gb|EDN36846.1| conserved hypothetical protein [Francisella novicida GA99-3549]
 gi|151572646|gb|EDN38300.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|194322706|gb|EDX20186.1| tetratricopeptide repeat domain protein [Francisella tularensis
           subsp. novicida FTE]
 gi|208744433|gb|EDZ90732.1| tetratricopeptide repeat domain protein [Francisella novicida FTG]
          Length = 212

 Score = 51.2 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/185 (11%), Positives = 63/185 (34%), Gaps = 16/185 (8%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEK---ILSQDNKLYNPLSNMY 94
           +   ++ S++KK       + +AL    + K        +    +    N  +   ++  
Sbjct: 28  FLQFYNSSNDKKMLEASTIYQKALIANENPKSSVETKIAKFEQVVNDYPNTSFGIFASWQ 87

Query: 95  IASILVAKGDTKNAAEI-----------FLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
           +A +        +                L+ + ++    ++   + ++ A + +     
Sbjct: 88  LADLYTTPTKLDSKNFNVNITNLPKAIAILQQSIENNPKDSLSDISKVRLARLYIVAKQP 147

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQ 203
           ++  K LQ +    +  + +   +LG +  +     KA   +++  +D NS         
Sbjct: 148 DQAIKTLQDIKSFKD--NAYPLMLLGQAYSEKKDKVKAIESWQKALQDPNSSDQFKQIIS 205

Query: 204 MILAN 208
            ++ N
Sbjct: 206 QLINN 210


>gi|158523123|ref|YP_001530993.1| TPR repeat-containing protein [Desulfococcus oleovorans Hxd3]
 gi|158511949|gb|ABW68916.1| Tetratricopeptide TPR_2 repeat protein [Desulfococcus oleovorans
           Hxd3]
          Length = 610

 Score = 50.8 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/202 (9%), Positives = 56/202 (27%), Gaps = 15/202 (7%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSF 76
                +   P+++++I    +       +  +        +  A                
Sbjct: 409 FFSNVRIRLPVMVVLIPFAVLGLGWLVSALRQGSFKTAGAYIAA---------ATFFFVL 459

Query: 77  EKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASI 136
             +    +K +    N++ +++       +                      A L  A  
Sbjct: 460 AFVPVPGDKDFTAYLNVHASNLASKDRQAEALVF----WERSAALCQPYSAFANLALAGY 515

Query: 137 LVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPF 196
             D   +E+   +       ++       E LG   L+ G+V +A   +++    N    
Sbjct: 516 YADHGDFEKA-AVYIDKVPDTSLAAAQKYEALGDLLLRQGRVDEAIDAYKKSLDINYGQR 574

Query: 197 GISTRSQMILANIIASDQRNKK 218
            +  +   +  +I      +++
Sbjct: 575 QLRMKLFRLYWDID-RGLADRE 595


>gi|56707336|ref|YP_169232.1| hypothetical protein FTT_0166c [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110669806|ref|YP_666363.1| hypothetical protein FTF0166c [Francisella tularensis subsp.
           tularensis FSC198]
 gi|224456399|ref|ZP_03664872.1| hypothetical protein FtultM_00898 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254370013|ref|ZP_04986020.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874171|ref|ZP_05246881.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|56603828|emb|CAG44799.1| conserved hypothetical membrane protein [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320139|emb|CAL08182.1| conserved hypothetical membrane protein [Francisella tularensis
           subsp. tularensis FSC198]
 gi|151568258|gb|EDN33912.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254840170|gb|EET18606.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|282158461|gb|ADA77852.1| hypothetical protein NE061598_00940 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 218

 Score = 50.8 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/189 (11%), Positives = 62/189 (32%), Gaps = 18/189 (9%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEK---ILSQDNKLYNPLSNMY 94
           +   ++ S++KK       + +AL    + K        +    +    N  +   ++  
Sbjct: 28  FLQFYNSSNDKKMLEASTIYQKALIANENPKSSVETKIAKFEQVVNDYPNTSFGIFASWQ 87

Query: 95  IASILVAKGDTKNAAEI-----------FLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
           +A +        +                L+ + ++    ++   + ++ A + +     
Sbjct: 88  LADLYTTPTKPDSKNFNVNITNLPKAIAILQQSIENNPKDSLSDISKVRLARLYIVAKQP 147

Query: 144 EEISKILQKLSEPSNP----MHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIS 199
           ++  K LQ +           + +   +LG +  +     KA   +++  +D NS     
Sbjct: 148 DQAIKTLQAIKTLQGIKSFKDNAYPLMLLGQAYSEKKDKVKAIESWQKALQDPNSSDQFK 207

Query: 200 TRSQMILAN 208
                ++ N
Sbjct: 208 QIISQLINN 216


>gi|332305586|ref|YP_004433437.1| hypothetical protein Glaag_1208 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172915|gb|AEE22169.1| Protein of unknown function DUF2133 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 207

 Score = 50.8 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/180 (14%), Positives = 51/180 (28%), Gaps = 4/180 (2%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME            K           +  ++ L     +  ++      K      F   
Sbjct: 1   MEHYETEEQQVEAIKRFWKENGTAIIVGAVLGLGGLWGWRYYNDEQIAAKEQASAAFESQ 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                +    +   + + I    +  Y  L    +A   + + D    AE  L+ A  + 
Sbjct: 61  TAALLAED-ANFGQAKQYIDENSDTGYALLMAFQLAQQAIDRKDLSE-AEKQLEFAAANS 118

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              AV   A L+ A + +     E+     + ++  +        EI G   +K     K
Sbjct: 119 QNEAVNALANLRLARVQLALEQPEKALASAENIT--TAAFSAQQQEIKGDIYVKQEMFDK 176


>gi|78189313|ref|YP_379651.1| TPR repeat-containing protein [Chlorobium chlorochromatii CaD3]
 gi|78171512|gb|ABB28608.1| TPR repeat [Chlorobium chlorochromatii CaD3]
          Length = 221

 Score = 50.4 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/193 (9%), Positives = 50/193 (25%), Gaps = 28/193 (14%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME      S + +       YK      +++I++L    +      E+++       ++ 
Sbjct: 1   MEQTA-KPSAEEQLLYIVIKYKKALIGALVVIVTLGAGAFFGTRYQEQREQEAALQLSRV 59

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
                                               ++ +         +      +   
Sbjct: 60  SPALEQGN---------------------------FTLAINGTKQTAGLQKIANEYSGRF 92

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                   A L  A+       YE   +   +++     +   A    G   L   K+++
Sbjct: 93  IGTPSGNMAKLLLANAWYSFGKYETALQHFNEVTIAHEDLAAAALAGSGDCYLNLNKLKE 152

Query: 181 AKTIFEELAKDNN 193
           A   +++ A   +
Sbjct: 153 AAEAYQKAANKTD 165


>gi|298368462|ref|ZP_06979780.1| tetratricopeptide repeat protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282465|gb|EFI23952.1| tetratricopeptide repeat protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 209

 Score = 50.4 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 61/196 (31%), Gaps = 5/196 (2%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K     +      L++      + + ++      +     E  AQ ++   S       +
Sbjct: 15  KYFWKNWGRWLFALLIAAALGYLGYIIYKDHKISQNREAAEVLAQMVDKAQSKADSKQIN 74

Query: 75  S--FEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQ 132
           +   +      N +    + M +A+     G    AA     V ++  AP  ++  A  +
Sbjct: 75  ADLLKLQQDYSNTVPAAQATMMVAATEFDAGRYDTAAGHLNWVLSNQKAP-LIQALAAQR 133

Query: 133 AASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
            A +L+    Y+    +L    E          E  G       K ++A   +++  +  
Sbjct: 134 LAVVLLQQKKYDAAITVLNTKVEAD--FEPLLLEAKGDVYAAQNKTKEATQSYQQALEKL 191

Query: 193 NSPFGISTRSQMILAN 208
                     QM L +
Sbjct: 192 PKDAIERELLQMKLDS 207


>gi|300716934|ref|YP_003741737.1| hypothetical protein [Erwinia billingiae Eb661]
 gi|299062770|emb|CAX59890.1| Conserved uncharacterized protein [Erwinia billingiae Eb661]
          Length = 389

 Score = 50.0 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 59/176 (33%), Gaps = 10/176 (5%)

Query: 32  ILSLAIWFYLFDGSHEKKKNIVGEN---FAQALELFNSNKLDDARSSFEKILSQDNKLYN 88
           + +   W+     + + K+         +   +    SN+ D A   F  +L +D+    
Sbjct: 11  VAAAYGWYMGRRSAQQDKQQEASRLSRDYVAGVNFLLSNQQDKAVDLFLDMLKEDSGTVE 70

Query: 89  PLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISK 148
              ++ + ++  ++G+   A  I   +          R  A  Q     +    Y+   +
Sbjct: 71  A--HLTLGNLFRSRGEVDRAIRIHQALMESASLTYDQRLLAVQQLGRDYMAAGFYDRAEE 128

Query: 149 ILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
           +  +L + ++     A + L I         KA  + E L K          R ++
Sbjct: 129 MFSQLVDETD-FRVGALQQLLIIHQATSDWPKAIEVAERLVKLGKD----KQRMEI 179


>gi|240013744|ref|ZP_04720657.1| Gc protein [Neisseria gonorrhoeae DGI18]
 gi|240016182|ref|ZP_04722722.1| Gc protein [Neisseria gonorrhoeae FA6140]
 gi|240112537|ref|ZP_04727027.1| Gc protein [Neisseria gonorrhoeae MS11]
 gi|240120814|ref|ZP_04733776.1| Gc protein [Neisseria gonorrhoeae PID24-1]
 gi|254493338|ref|ZP_05106509.1| membrane protein [Neisseria gonorrhoeae 1291]
 gi|268598605|ref|ZP_06132772.1| membrane protein [Neisseria gonorrhoeae MS11]
 gi|226512378|gb|EEH61723.1| membrane protein [Neisseria gonorrhoeae 1291]
 gi|268582736|gb|EEZ47412.1| membrane protein [Neisseria gonorrhoeae MS11]
          Length = 209

 Score = 50.0 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/173 (12%), Positives = 47/173 (27%), Gaps = 3/173 (1%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLD-DARSSFEKILSQDNKLYNPLSNMYIA 96
            + ++      +        A  +E   +     +  +   K+        +      +A
Sbjct: 38  GYTVYQNRAASQNQEAAAVLANIVEKTQNKAPQSEINAELSKLQQSYPHSISAAQATLMA 97

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
           +         + AE  LK    +     ++  A  +   +L+    Y+     L    E 
Sbjct: 98  AATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEA 157

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
                    E  G       K Q+A   + +  +            QM L ++
Sbjct: 158 D--FAPLLMETKGDVYAAQEKSQEALKNYGQALEKMPQDSVGRELLQMKLDSL 208


>gi|88658346|ref|YP_507649.1| hypothetical protein ECH_0854 [Ehrlichia chaffeensis str. Arkansas]
 gi|88599803|gb|ABD45272.1| conserved hypothetical protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 189

 Score = 50.0 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 68/188 (36%), Gaps = 4/188 (2%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           KWI  +++++++  A      +  HEK    +G+    AL    S    +       +  
Sbjct: 2   KWICGIIVVLLVVFAGMVSWVNNRHEKLSQRMGDMMYDALMGEVSEH--EMIKILNDVAK 59

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
            D   Y  L+   +A +     +   A  I+  +A D      +R  A       L+   
Sbjct: 60  VDGSNYQYLAKFKLAGMYGE-NEVAKAQSIYADLAADKRLMPELRELAEYLEIIALLKGE 118

Query: 142 SYEEISKILQK-LSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
             + +   +QK LS  S        E + +  LK   +  A  + +E+  + +S   +  
Sbjct: 119 DLDLLKSKVQKFLSTKSEVYKSSIKEAIAVYMLKNNNIDGAIEVIKEIVGNADSELMVYK 178

Query: 201 RSQMILAN 208
            +  +L  
Sbjct: 179 HAMDLLQI 186


>gi|299137946|ref|ZP_07031126.1| hypothetical protein AciX8DRAFT_2431 [Acidobacterium sp. MP5ACTX8]
 gi|298599876|gb|EFI56034.1| hypothetical protein AciX8DRAFT_2431 [Acidobacterium sp. MP5ACTX8]
          Length = 338

 Score = 49.6 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/178 (15%), Positives = 49/178 (27%), Gaps = 19/178 (10%)

Query: 26  PLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE----------------LFNSNKL 69
              +++IL++   + LF           GE                          S + 
Sbjct: 129 VAAVVVILAIVGGYVLFQHHSTAAATAFGEAMQTYQTPVAMPGQPLPPGTKSYASISERA 188

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
             A + F+ +        +    +Y + +   +      AE   K          +   A
Sbjct: 189 AAANTQFQSVAQHYGLTESGKLALYFSGLTYMEEGQNGPAEDTFKKVA-GSWNHDLAALA 247

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPM--HQFANEILGISALKFGKVQKAKTIF 185
            +  A I   T+   +   +  +LS           A   L       GK  KAK I+
Sbjct: 248 KMSLAQIYEQTNRDAQAVDLYNELSNGKASTVPPGLAQIQLAELYSAEGKADKAKEIY 305


>gi|21674626|ref|NP_662691.1| hypothetical protein CT1812 [Chlorobium tepidum TLS]
 gi|21647827|gb|AAM73033.1| hypothetical protein CT1812 [Chlorobium tepidum TLS]
          Length = 247

 Score = 49.6 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/207 (11%), Positives = 60/207 (28%), Gaps = 8/207 (3%)

Query: 9   SYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNK 68
           ++  +       YK     L+++I   A     +    +  +       A+         
Sbjct: 32  TFSDRMLEIGIKYKKQLTALVVVICLAAGGTLFWMQKTKVDEVQASLALAKITPWIEMGD 91

Query: 69  LDDARSS------FEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           ++ A +          I+       +  +     + ++      + A    K  + D   
Sbjct: 92  VNKAVNGEGSIKGLNSIIKTWGGTPSGKTARLYMAYILLNSGKPDDALSIYKGFSSDNKD 151

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
           L     A   A  +     +           +  +  +          S    G+  KA 
Sbjct: 152 LQASALAGAAACHVQKKAFAEAAPEYEKASETAENETLKSMYLTKAAESYSAAGQADKAA 211

Query: 183 TIFEELAKD--NNSPFGISTRSQMILA 207
            +++++ K     S  G++ R+ + LA
Sbjct: 212 KLYDQVIKTWPATSSAGMAQRALLRLA 238


>gi|190571453|ref|YP_001975811.1| hypothetical protein WPa_1067 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190357725|emb|CAQ55175.1| hypothetical protein WP1067 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 205

 Score = 49.6 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 38/186 (20%), Positives = 71/186 (38%), Gaps = 11/186 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L +  +L     + L +  + K+    G+ F + L L   NK          +L 
Sbjct: 25  KYIFLLTLAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLFLKKDNKS---------LLE 75

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEI-FLKVANDDLAPLAVRYAATLQAASILVDT 140
           + +  +  L+N   A   ++     + A I +  +A+D  AP  +R  A       L+ +
Sbjct: 76  EIDSHWEYLANFERAFNHISDSMPTDTASIIYNDLADDKDAPDVLRELAQYLEVMSLLHS 135

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
           S  +     +  L E +      + E + I  +    ++ A  I   L  D   P  I  
Sbjct: 136 SGEKTNRDKISNL-ESNAVYPYSSQEAIAIVKIHSNDIKGAIEILHSLLNDRECPTLIKA 194

Query: 201 RSQMIL 206
            +Q +L
Sbjct: 195 NAQELL 200


>gi|59800868|ref|YP_207580.1| hypothetical protein NGO0425 [Neisseria gonorrhoeae FA 1090]
 gi|194098170|ref|YP_002001218.1| Gc protein [Neisseria gonorrhoeae NCCP11945]
 gi|239998621|ref|ZP_04718545.1| Gc protein [Neisseria gonorrhoeae 35/02]
 gi|240080326|ref|ZP_04724869.1| Gc protein [Neisseria gonorrhoeae FA19]
 gi|240115277|ref|ZP_04729339.1| Gc protein [Neisseria gonorrhoeae PID18]
 gi|240117564|ref|ZP_04731626.1| Gc protein [Neisseria gonorrhoeae PID1]
 gi|240123119|ref|ZP_04736075.1| Gc protein [Neisseria gonorrhoeae PID332]
 gi|240125370|ref|ZP_04738256.1| Gc protein [Neisseria gonorrhoeae SK-92-679]
 gi|240127822|ref|ZP_04740483.1| Gc protein [Neisseria gonorrhoeae SK-93-1035]
 gi|260440906|ref|ZP_05794722.1| Gc protein [Neisseria gonorrhoeae DGI2]
 gi|268594477|ref|ZP_06128644.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268596472|ref|ZP_06130639.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268600958|ref|ZP_06135125.1| membrane protein [Neisseria gonorrhoeae PID18]
 gi|268603265|ref|ZP_06137432.1| membrane protein [Neisseria gonorrhoeae PID1]
 gi|268681745|ref|ZP_06148607.1| membrane protein [Neisseria gonorrhoeae PID332]
 gi|268683972|ref|ZP_06150834.1| membrane protein [Neisseria gonorrhoeae SK-92-679]
 gi|268686217|ref|ZP_06153079.1| membrane protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291044230|ref|ZP_06569939.1| Gc protein [Neisseria gonorrhoeae DGI2]
 gi|293399429|ref|ZP_06643582.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
 gi|4033385|sp|O87406|Y425_NEIG1 RecName: Full=UPF0070 protein NGO0425; AltName: Full=ORF2
 gi|3722225|gb|AAC63507.1| Gc protein [Neisseria gonorrhoeae]
 gi|59717763|gb|AAW89168.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193933460|gb|ACF29284.1| Gc protein [Neisseria gonorrhoeae NCCP11945]
 gi|268547866|gb|EEZ43284.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268550260|gb|EEZ45279.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268585089|gb|EEZ49765.1| membrane protein [Neisseria gonorrhoeae PID18]
 gi|268587396|gb|EEZ52072.1| membrane protein [Neisseria gonorrhoeae PID1]
 gi|268622029|gb|EEZ54429.1| membrane protein [Neisseria gonorrhoeae PID332]
 gi|268624256|gb|EEZ56656.1| membrane protein [Neisseria gonorrhoeae SK-92-679]
 gi|268626501|gb|EEZ58901.1| membrane protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291011124|gb|EFE03120.1| Gc protein [Neisseria gonorrhoeae DGI2]
 gi|291609998|gb|EFF39120.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
 gi|317163894|gb|ADV07435.1| hypothetical protein NGTW08_0463 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 209

 Score = 49.6 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/173 (12%), Positives = 47/173 (27%), Gaps = 3/173 (1%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLD-DARSSFEKILSQDNKLYNPLSNMYIA 96
            + ++      +        A  +E   +     +  +   K+        +      +A
Sbjct: 38  GYTVYQNRAASQNQEAAAVLANIVEKAQNKAPQSEINAELSKLQQSYPHSISAAQATLMA 97

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
           +         + AE  LK    +     ++  A  +   +L+    Y+     L    E 
Sbjct: 98  AATEFDAQRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEA 157

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
                    E  G       K Q+A   + +  +            QM L ++
Sbjct: 158 D--FAPLLMETKGDVYAAQEKSQEALKNYGQALEKMPQDSVGRELLQMKLDSL 208


>gi|297691491|ref|XP_002823118.1| PREDICTED: transmembrane and TPR repeat-containing protein 1-like
           isoform 2 [Pongo abelii]
          Length = 882

 Score = 49.2 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 51/167 (30%), Gaps = 9/167 (5%)

Query: 52  IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              + ++  A  L    +  +A   ++  +       +  +N  +   LV  G  + A  
Sbjct: 580 EFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVF--LVDTGLPEKAVA 637

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
            + +            + A +    +           +  ++  +            LG 
Sbjct: 638 HYQQAIKL----SPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQV--AHKAEILSPLGA 691

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
                G+ ++A  I++E A    S   +      +LA +  + +  K
Sbjct: 692 LYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAMMGQTKEAEK 738



 Score = 41.9 bits (96), Expect = 0.067,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 61/218 (27%), Gaps = 21/218 (9%)

Query: 16  MGKCCYKWIAPLL----ILMILSLAIWFYL-----FDGSHEKKKNIVGEN---FAQALEL 63
           M +  YK    +     IL  L    +             E       +     A A  L
Sbjct: 668 MAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVL 727

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
               +  +A      I+S++           +++I   + +   A +   K         
Sbjct: 728 AMMGQTKEAEKMTNHIVSEETGCLE--CYRLLSAIYSKQENHDKALDAIDKALQLKPKDP 785

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            V         + L + +  ++  +   +++   NP    A   +G      GK   A+ 
Sbjct: 786 KVISELFFTKGNQLREQNLLDKAFESY-RVAVQLNPDQAQAWMNMGGIQHIKGKYVSARA 844

Query: 184 IFEELAKDNNSPFGIST------RSQMILANIIASDQR 215
            +E   +       +        R +  L  +   DQ 
Sbjct: 845 YYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT 882


>gi|297691489|ref|XP_002823117.1| PREDICTED: transmembrane and TPR repeat-containing protein 1-like
           isoform 1 [Pongo abelii]
          Length = 944

 Score = 49.2 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 51/167 (30%), Gaps = 9/167 (5%)

Query: 52  IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              + ++  A  L    +  +A   ++  +       +  +N  +   LV  G  + A  
Sbjct: 642 EFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVF--LVDTGLPEKAVA 699

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
            + +            + A +    +           +  ++  +            LG 
Sbjct: 700 HYQQAIKL----SPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQV--AHKAEILSPLGA 753

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
                G+ ++A  I++E A    S   +      +LA +  + +  K
Sbjct: 754 LYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAMMGQTKEAEK 800



 Score = 41.9 bits (96), Expect = 0.067,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 61/218 (27%), Gaps = 21/218 (9%)

Query: 16  MGKCCYKWIAPLL----ILMILSLAIWFYL-----FDGSHEKKKNIVGEN---FAQALEL 63
           M +  YK    +     IL  L    +             E       +     A A  L
Sbjct: 730 MAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVL 789

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
               +  +A      I+S++           +++I   + +   A +   K         
Sbjct: 790 AMMGQTKEAEKMTNHIVSEETGCLE--CYRLLSAIYSKQENHDKALDAIDKALQLKPKDP 847

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            V         + L + +  ++  +   +++   NP    A   +G      GK   A+ 
Sbjct: 848 KVISELFFTKGNQLREQNLLDKAFESY-RVAVQLNPDQAQAWMNMGGIQHIKGKYVSARA 906

Query: 184 IFEELAKDNNSPFGIST------RSQMILANIIASDQR 215
            +E   +       +        R +  L  +   DQ 
Sbjct: 907 YYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT 944


>gi|225851488|ref|YP_002731722.1| tetratricopeptide repeat domain protein [Persephonella marina
           EX-H1]
 gi|225645952|gb|ACO04138.1| tetratricopeptide repeat domain protein [Persephonella marina
           EX-H1]
          Length = 934

 Score = 49.2 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/166 (16%), Positives = 57/166 (34%), Gaps = 13/166 (7%)

Query: 36  AIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYI 95
             WF+    +++K      + + +A+  FN+  LD A S  +    + ++       M  
Sbjct: 481 LGWFFFKKRNYQKAYEAFTDEYMKAVSAFNAGDLDKAYSLVKGKKDRKSRFLLAYIFMRK 540

Query: 96  ASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSE 155
             I  A+   +                  +   A    A        Y E  K  +  +E
Sbjct: 541 GDIDKARDILREL----------SKGDDKIAQQAGYLYAYSYFSEGKYIEAIKAFRDYAE 590

Query: 156 --PSNPMHQFANEILGISALKFGKVQKAKTIFEE-LAKDNNSPFGI 198
                 +   A   +  S    G+ +KA+ I+++ + +  N+P  I
Sbjct: 591 KYRGTELGNLAVLRMADSYYNAGQKEKARKIYQQFIEEHANTPEAI 636



 Score = 41.1 bits (94), Expect = 0.12,   Method: Composition-based stats.
 Identities = 21/152 (13%), Positives = 51/152 (33%), Gaps = 5/152 (3%)

Query: 39  FYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASI 98
           +  F   H      +   +   +     +  D A    + I       +  L  + +  +
Sbjct: 622 YQQFIEEHANTPEAIDAAYQLTVLEMEESGADVASQIEKFIEKYPQYPFVSLLKLQLGDL 681

Query: 99  LVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS- 157
              K +   A +I+ ++     A +     A  +   +   +   ++  KIL +  +   
Sbjct: 682 YTEKQEYDKAEKIYRELIE---ADIKESEYALYKLGYLKYISGDKDQAVKILTRYIKIYP 738

Query: 158 -NPMHQFANEILGISALKFGKVQKAKTIFEEL 188
               +  A E+L     + G + KA  + ++L
Sbjct: 739 RGEFNVQAKELLAKIFEEQGDLDKAIAVMKKL 770



 Score = 37.3 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 47/147 (31%), Gaps = 3/147 (2%)

Query: 47  EKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLY-NPLSNMYIASILVAKGDT 105
           +K     G  +  A   F+  K  +A  +F     +        L+ + +A      G  
Sbjct: 558 DKIAQQAG--YLYAYSYFSEGKYIEAIKAFRDYAEKYRGTELGNLAVLRMADSYYNAGQK 615

Query: 106 KNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFAN 165
           + A +I+ +   +         AA       + ++ +             P  P      
Sbjct: 616 EKARKIYQQFIEEHANTPEAIDAAYQLTVLEMEESGADVASQIEKFIEKYPQYPFVSLLK 675

Query: 166 EILGISALKFGKVQKAKTIFEELAKDN 192
             LG    +  +  KA+ I+ EL + +
Sbjct: 676 LQLGDLYTEKQEYDKAEKIYRELIEAD 702



 Score = 36.1 bits (81), Expect = 3.0,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 50/159 (31%), Gaps = 4/159 (2%)

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           A   +N+ + + AR  +++ + +       +   Y  ++L  +    + A    K     
Sbjct: 606 ADSYYNAGQKEKARKIYQQFIEEHANTPEAIDAAYQLTVLEMEESGADVASQIEKFIEKY 665

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
                      LQ   +  +   Y++  KI ++L E      ++A   LG      G   
Sbjct: 666 PQ-YPFVSLLKLQLGDLYTEKQEYDKAEKIYRELIEADIKESEYALYKLGYLKYISGDKD 724

Query: 180 KAKTI---FEELAKDNNSPFGISTRSQMILANIIASDQR 215
           +A  I   + ++                I       D+ 
Sbjct: 725 QAVKILTRYIKIYPRGEFNVQAKELLAKIFEEQGDLDKA 763


>gi|297262050|ref|XP_001101625.2| PREDICTED: transmembrane and TPR repeat-containing protein 1-like
           [Macaca mulatta]
          Length = 882

 Score = 49.2 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 51/167 (30%), Gaps = 9/167 (5%)

Query: 52  IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              + ++  A  L    +  +A   ++  +       +  +N  +   LV  G  + A  
Sbjct: 580 EFADAYSSLASLLAEQERFKEAEEIYQAGIKNCPDSSDLHNNYGVF--LVDTGLPEKAVA 637

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
            + +            + A +    +           +  ++  +            LG 
Sbjct: 638 HYQQAIKL----SPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQV--AHKAEILSPLGA 691

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
                G+ ++A  I++E A    S   +      +LA +  + +  K
Sbjct: 692 LYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEK 738



 Score = 40.8 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 62/218 (28%), Gaps = 21/218 (9%)

Query: 16  MGKCCYKWIAPLL----ILMILSLAIWFYL-----FDGSHEKKKNIVGEN---FAQALEL 63
           M +  YK    +     IL  L    +             E       +     A A  L
Sbjct: 668 MAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVL 727

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
               +  +A      I+S++           +++I   + +   A ++  K         
Sbjct: 728 AVMGQTKEAEKMTNHIVSEETGCLE--CYRLLSAIYSKQENHDKALDVIEKALQLKPKDP 785

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            V         + L + +  ++  +   +++   NP    A   +G      GK   A+ 
Sbjct: 786 KVISELFFTKGNQLREQNLLDKAFESY-RVAVQLNPDQAQAWMNMGGIQHIKGKYVSARA 844

Query: 184 IFEELAKDNNSPFGIST------RSQMILANIIASDQR 215
            +E   +       +        R +  L  +   DQ 
Sbjct: 845 YYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT 882


>gi|260773383|ref|ZP_05882299.1| membrane protein [Vibrio metschnikovii CIP 69.14]
 gi|260612522|gb|EEX37725.1| membrane protein [Vibrio metschnikovii CIP 69.14]
          Length = 204

 Score = 49.2 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 62/202 (30%), Gaps = 3/202 (1%)

Query: 1   MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ME  +         K           L  ++ L     +  +  S    +    E +++A
Sbjct: 1   MELYDTEEQQVEAIKDWWKENGKAVLLGAVLGLGGLFGWRYYQHSTTTGQETTSETYSKA 60

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +  F++            I +     Y  L+ M +A      G    A    L+ A    
Sbjct: 61  IANFSAKGAQAESDLQHFIDNHQKSEYAVLAAMQLAKAQADAGQLDEAL-AQLEWAKKST 119

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
              A+      + A +  +   ++     L  ++E          E+ G  AL+ G    
Sbjct: 120 KDAALTPVIAFRIARLQAEQQQFDAALAELTTITE--ASWAARVAELRGDIALRKGDKDA 177

Query: 181 AKTIFEELAKDNNSPFGISTRS 202
           A   + +  + +N+   +  + 
Sbjct: 178 AYAAYSQAQQSSNASQTLQLKL 199


>gi|303236371|ref|ZP_07322961.1| tetratricopeptide repeat protein [Prevotella disiens FB035-09AN]
 gi|302483429|gb|EFL46434.1| tetratricopeptide repeat protein [Prevotella disiens FB035-09AN]
          Length = 224

 Score = 49.2 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 70/207 (33%), Gaps = 12/207 (5%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGS-HEKKKNIVGENFAQALELFNSNKLD 70
            K +     Y   A + I+ IL +    +L+     E ++       A+A +LF + + D
Sbjct: 15  NKSEAFFAKYGKTALIAIVAILIVVAGIFLYKNYVSEPREAEASTELAKAQQLFQTQQFD 74

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA- 129
            A   F+K+ S  +            ++  A     +  +    +     +   +   A 
Sbjct: 75  QALKGFQKVQSDYSSTDAGNLANLYVALCYAHQQKPDWKKALDNIQKFSTSDDQIISPAS 134

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNP---------MHQFANEILGISALKFGKVQK 180
            +    I  + +  ++  +  +K +E ++          +   A    GI     G   +
Sbjct: 135 QMALGDIYANNNQNDKAIESFKKAAEMADSKGFEGINLSIAPLALRKAGIILESQGNKAE 194

Query: 181 AKTIFEELAKDNNSPFGISTRSQMILA 207
           A  I++++ K       +S      + 
Sbjct: 195 ALKIYQDI-KKKYVNSPMSQDIDKYIQ 220


>gi|187251318|ref|YP_001875800.1| hypothetical protein Emin_0908 [Elusimicrobium minutum Pei191]
 gi|186971478|gb|ACC98463.1| hypothetical protein Emin_0908 [Elusimicrobium minutum Pei191]
          Length = 209

 Score = 49.2 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 27/200 (13%), Positives = 67/200 (33%), Gaps = 11/200 (5%)

Query: 13  KCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDA 72
           +       ++ I    +L+I+     F+ ++    K K    +++ +        + ++ 
Sbjct: 18  RLIKFFQAHRTIIIAGVLIIVIFIGGFFAYEYRQSKIKE---DSWKELTMAILFGEPENL 74

Query: 73  RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQ 132
            +  EK    +  LY      Y+      +G+   A  ++ KVA        + + A + 
Sbjct: 75  TAVTEKYPKTNAALYAA---YYMGDYNYEQGNYPEAVSLYKKVAE--GKNKELAHVAQIS 129

Query: 133 AASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL--GISALKFGKVQKAKTIFEELAK 190
            A+       YE      +     +   +  A   L   +S    GK + A   + ++ +
Sbjct: 130 LAAAYQANKDYEASILTAEDFINKNPQHYAIAQVYLTKALSQELAGKKEAAAADY-KIIE 188

Query: 191 DNNSPFGISTRSQMILANII 210
                   +  ++  L  + 
Sbjct: 189 SRFPNTYFAAFAKNKLKELN 208


>gi|73997220|ref|XP_543747.2| PREDICTED: similar to ARG99 protein isoform 2 [Canis familiaris]
          Length = 865

 Score = 48.8 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 50/167 (29%), Gaps = 9/167 (5%)

Query: 52  IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              + ++  A  L    +  +A   ++  +       +  +N  +   LV  G  + A  
Sbjct: 563 EFADAYSSLASLLAEQERFKEAEEIYQAGIKNCPDSSDLHNNYGVF--LVDTGSPEKAVA 620

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
            + +            + A +    +           +  ++  +            LG 
Sbjct: 621 HYQQAIAL----SPSHHVAMVNLGRLYRSLGDNSAAEEWYKRALQV--ARKAEILSPLGA 674

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
                G+ ++A  I+ E A    S   +      +LA +  + +  K
Sbjct: 675 LYYNTGRYEEALQIYREAAALQPSQRELRLALAQVLAVMGQTKEAEK 721



 Score = 38.8 bits (88), Expect = 0.55,   Method: Composition-based stats.
 Identities = 24/182 (13%), Positives = 50/182 (27%), Gaps = 12/182 (6%)

Query: 43  DGSHEKKKNIVGEN---FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASIL 99
               E       +     A A  L    +  +A      I+S++           +++I 
Sbjct: 687 QIYREAAALQPSQRELRLALAQVLAVMGQTKEAEKMTNHIVSEETGCLE--CYRLLSAIY 744

Query: 100 VAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNP 159
             +     A ++  K          V         + L + +  ++  +  +   E  NP
Sbjct: 745 SKQEHHDKALDVIDKALQLKPKDPKVVSELFFTKGNQLREQNLLDKAFESYKAAVEL-NP 803

Query: 160 MHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST------RSQMILANIIASD 213
               A   +G      G    A+  +E   +       +        R +  L  +   D
Sbjct: 804 DQAQAWMNMGGIQHIKGNYVSARAYYERALQLVPDSKLLQENLAKLDRLEKRLQEVREKD 863

Query: 214 QR 215
           Q 
Sbjct: 864 QT 865



 Score = 35.0 bits (78), Expect = 6.7,   Method: Composition-based stats.
 Identities = 21/159 (13%), Positives = 48/159 (30%), Gaps = 10/159 (6%)

Query: 57  FAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVA 116
           +  A  L +  +  +A S +   L    +  + L+           G     A       
Sbjct: 470 YNYANFLKDQGRNREAISHYRTALRLYPRHASALN---------NLGTLTRDAAEAKMYY 520

Query: 117 NDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFG 176
              L        A     ++L      EE   +L+   +   P    A   L     +  
Sbjct: 521 QRALQLNPQHNRALFNLGNLLKSQEKKEEAITLLKDSIQYG-PEFADAYSSLASLLAEQE 579

Query: 177 KVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
           + ++A+ I++   K+      +     + L +  + ++ 
Sbjct: 580 RFKEAEEIYQAGIKNCPDSSDLHNNYGVFLVDTGSPEKA 618


>gi|301167240|emb|CBW26822.1| putative membrane protein [Bacteriovorax marinus SJ]
          Length = 222

 Score = 48.8 bits (114), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 22/182 (12%), Positives = 54/182 (29%), Gaps = 6/182 (3%)

Query: 16  MGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSS 75
                 K      + +I+     +  +      K + +     +       N      + 
Sbjct: 22  SFIAKNKTSVIGFVALIILGVFAWGGYSMYKGSKNDELSSVVFEFKNKNLENLTKKTMTG 81

Query: 76  FEKILSQDNKLYNPLSNMYIASILVAKGDT-----KNAAEIFLKVANDDLAPLAVRYAAT 130
            +   +      +    + +  + +A  D           + +     D +   ++Y   
Sbjct: 82  ADYTAAYLEMAKSMSGFVGLTPLALASSDVLTSQGDLENSLKVLATVKDQSQSYIKYFVY 141

Query: 131 LQAASILVDTSSYEEISKILQKLSEPS-NPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            + A    D +  +     L+ + + +   M       LG   LK G  +KAKT F+ + 
Sbjct: 142 SRMAVNHEDLNQVDNAIADLEVIVKANIKVMESKTYLDLGRLYLKKGDKEKAKTNFQYVI 201

Query: 190 KD 191
            +
Sbjct: 202 DN 203


>gi|322420095|ref|YP_004199318.1| TPR repeat-containing protein [Geobacter sp. M18]
 gi|320126482|gb|ADW14042.1| Tetratricopeptide TPR_1 repeat-containing protein [Geobacter sp.
           M18]
          Length = 665

 Score = 48.8 bits (114), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/182 (10%), Positives = 49/182 (26%), Gaps = 23/182 (12%)

Query: 25  APLLILMILSLAIWFYLFDGS--------------HEKKKNIVGENFAQALELFNSNKLD 70
             + I  +  +                            K+   +++  AL      +  
Sbjct: 436 ITVGIAALALVFGGVTWQRNKVWESPVSLWGDVVSKSPAKSRANDHYGVALSGV--GRTG 493

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT 130
           +A    +  L  + +    L    +  +     +   A   +  V +           A 
Sbjct: 494 EAIEFLKTALQINPRNEYAL--YNLGRLFDETNNIDAAIGCYEAVIDL----KPDLDLAY 547

Query: 131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
              A   +     +   +    ++    P    A+  LG +  + GKV +A   +    +
Sbjct: 548 NNLAVDYLLKGDDDRAIQYYN-IALKHKPQFAEAHNNLGFALQRKGKVDEAIEHYRAAIR 606

Query: 191 DN 192
           +N
Sbjct: 607 EN 608


>gi|260436698|ref|ZP_05790668.1| TPR repeat-containing protein [Synechococcus sp. WH 8109]
 gi|260414572|gb|EEX07868.1| TPR repeat-containing protein [Synechococcus sp. WH 8109]
          Length = 400

 Score = 48.8 bits (114), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 57/176 (32%), Gaps = 7/176 (3%)

Query: 43  DGSHEKKKNIVGENFAQALE---LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASIL 99
                  +   G+ +A A     L +  K +DA    E  L Q          + +   L
Sbjct: 187 QAMEADLQERPGDPYASAKLGGLLISEGKNEDAIPLLENGLKQCGSAGAERYELLLHLGL 246

Query: 100 VAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNP 159
                  + A    + A +      V   A L  A+ L+D  + EE   + Q  +    P
Sbjct: 247 ALTPSDPDKAVNCYRQALEIPLNTRVSLGARLNLAARLMDQGNLEEAISLTQT-AAHRAP 305

Query: 160 MHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR---SQMILANIIAS 212
               A   LG+   + G +  A   +      + +          +Q++  NI A+
Sbjct: 306 EVALAWYNLGLMQRRRGDLAAALEAYGRALALDPNNAECHQNNAVAQLLGGNIDAA 361


>gi|332232577|ref|XP_003265482.1| PREDICTED: transmembrane and TPR repeat-containing protein 1-like
           [Nomascus leucogenys]
          Length = 898

 Score = 48.8 bits (114), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 51/167 (30%), Gaps = 9/167 (5%)

Query: 52  IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              + ++  A  L    +  +A   ++  +       +  +N  +   LV  G  + A  
Sbjct: 596 EFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVF--LVDTGLPEKAVA 653

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
            + +            + A +    +           +  ++  +            LG 
Sbjct: 654 HYQQAIKL----SPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQV--AHKAEILSPLGA 707

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
                G+ ++A  I++E A    S   +      +LA +  + +  K
Sbjct: 708 LYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEK 754



 Score = 40.4 bits (92), Expect = 0.16,   Method: Composition-based stats.
 Identities = 29/218 (13%), Positives = 60/218 (27%), Gaps = 21/218 (9%)

Query: 16  MGKCCYKWIAPLL----ILMILSLAIWFYL-----FDGSHEKKKNIVGEN---FAQALEL 63
           M +  YK    +     IL  L    +             E       +     A A  L
Sbjct: 684 MAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVL 743

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
               +  +A      I+ ++           +++I   + +   A +   K         
Sbjct: 744 AVMGQTKEAEKMTNHIVLEETGCLE--CYRLLSAIYSKQENHDKALDAIDKALQLKPKDP 801

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            V         + L + +  ++  +   +++   NP    A   +G      GK   A+ 
Sbjct: 802 KVISELFFTKGNQLREQNLLDKAFESY-RVAVQLNPDQAQAWMNMGGIQHIKGKYVSARA 860

Query: 184 IFEELAKDNNSPFGIST------RSQMILANIIASDQR 215
            +E   +       +        R +  L  +   DQ 
Sbjct: 861 YYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT 898


>gi|301336134|ref|NP_001180380.1| transmembrane and TPR repeat-containing protein 1 isoform 1 [Homo
           sapiens]
          Length = 882

 Score = 48.8 bits (114), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 51/167 (30%), Gaps = 9/167 (5%)

Query: 52  IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              + ++  A  L    +  +A   ++  +       +  +N  +   LV  G  + A  
Sbjct: 580 EFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVF--LVDTGLPEKAVA 637

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
            + +            + A +    +           +  ++  +            LG 
Sbjct: 638 HYQQAIKL----SPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQV--AHKAEILSPLGA 691

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
                G+ ++A  I++E A    S   +      +LA +  + +  K
Sbjct: 692 LYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEK 738



 Score = 41.1 bits (94), Expect = 0.093,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 61/218 (27%), Gaps = 21/218 (9%)

Query: 16  MGKCCYKWIAPLL----ILMILSLAIWFYL-----FDGSHEKKKNIVGEN---FAQALEL 63
           M +  YK    +     IL  L    +             E       +     A A  L
Sbjct: 668 MAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVL 727

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
               +  +A      I+S++           +++I   + +   A +   K         
Sbjct: 728 AVMGQTKEAEKMTNHIVSEETGCLE--CYRLLSAIYSKQENHDKALDAIDKALQLKPKDP 785

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            V         + L + +  ++  +   +++   NP    A   +G      GK   A+ 
Sbjct: 786 KVISELFFTKGNQLREQNLLDKAFESY-RVAVQLNPDQAQAWMNMGGIQHIKGKYVSARA 844

Query: 184 IFEELAKDNNSPFGIST------RSQMILANIIASDQR 215
            +E   +       +        R +  L  +   DQ 
Sbjct: 845 YYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT 882


>gi|260060544|gb|ACX30004.1| transmembrane and tetratricopeptide repeat containing 1A [Homo
           sapiens]
          Length = 882

 Score = 48.8 bits (114), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 51/167 (30%), Gaps = 9/167 (5%)

Query: 52  IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              + ++  A  L    +  +A   ++  +       +  +N  +   LV  G  + A  
Sbjct: 580 EFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVF--LVDTGLPEKAVA 637

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
            + +            + A +    +           +  ++  +            LG 
Sbjct: 638 HYQQAIKL----SPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQV--AHKAEILSPLGA 691

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
                G+ ++A  I++E A    S   +      +LA +  + +  K
Sbjct: 692 LYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEK 738



 Score = 41.1 bits (94), Expect = 0.093,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 61/218 (27%), Gaps = 21/218 (9%)

Query: 16  MGKCCYKWIAPLL----ILMILSLAIWFYL-----FDGSHEKKKNIVGEN---FAQALEL 63
           M +  YK    +     IL  L    +             E       +     A A  L
Sbjct: 668 MAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVL 727

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
               +  +A      I+S++           +++I   + +   A +   K         
Sbjct: 728 AVMGQTKEAEKMTNHIVSEETGCLE--CYRLLSAIYSKQENHDKALDAIDKALQLKPKDP 785

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            V         + L + +  ++  +   +++   NP    A   +G      GK   A+ 
Sbjct: 786 KVISELFFTKGNQLREQNLLDKAFESY-RVAVQLNPDQAQAWMNMGGIQHIKGKYVSARA 844

Query: 184 IFEELAKDNNSPFGIST------RSQMILANIIASDQR 215
            +E   +       +        R +  L  +   DQ 
Sbjct: 845 YYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT 882


>gi|114645545|ref|XP_520818.2| PREDICTED: transmembrane and TPR repeat-containing protein 1
           isoform 2 [Pan troglodytes]
          Length = 882

 Score = 48.8 bits (114), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 51/167 (30%), Gaps = 9/167 (5%)

Query: 52  IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              + ++  A  L    +  +A   ++  +       +  +N  +   LV  G  + A  
Sbjct: 580 EFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVF--LVDTGLPEKAVA 637

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
            + +            + A +    +           +  ++  +            LG 
Sbjct: 638 HYQQAIKL----SPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQV--AHKAEILSPLGA 691

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
                G+ ++A  I++E A    S   +      +LA +  + +  K
Sbjct: 692 LYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEK 738



 Score = 41.1 bits (94), Expect = 0.093,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 61/218 (27%), Gaps = 21/218 (9%)

Query: 16  MGKCCYKWIAPLL----ILMILSLAIWFYL-----FDGSHEKKKNIVGEN---FAQALEL 63
           M +  YK    +     IL  L    +             E       +     A A  L
Sbjct: 668 MAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVL 727

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
               +  +A      I+S++           +++I   + +   A +   K         
Sbjct: 728 AVMGQTKEAEKMTNHIVSEETGCLE--CYRLLSAIYSKQENHDKALDAIDKALQLKPKDP 785

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            V         + L + +  ++  +   +++   NP    A   +G      GK   A+ 
Sbjct: 786 KVISELFFTKGNQLREQNLLDKAFESY-RVAVQLNPDQAQAWMNMGGIQHIKGKYVSARA 844

Query: 184 IFEELAKDNNSPFGIST------RSQMILANIIASDQR 215
            +E   +       +        R +  L  +   DQ 
Sbjct: 845 YYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT 882


>gi|291301009|ref|YP_003512287.1| NB-ARC domain-containing protein [Stackebrandtia nassauensis DSM
           44728]
 gi|290570229|gb|ADD43194.1| NB-ARC domain protein [Stackebrandtia nassauensis DSM 44728]
          Length = 827

 Score = 48.8 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 44/155 (28%), Gaps = 10/155 (6%)

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           A    +       R +    L   N+     +   +    +A  D   A + F +     
Sbjct: 660 ARTGDHEAATTSCRRALSICLDIGNRRGAVRAWRGLGEAALAHDDADTARDAFTQAREIG 719

Query: 120 LA--PLAVRYAATLQAASILVDTSSYEEISKILQKLSE-----PSNPMHQFANEILGISA 172
            A    A    AT   A +        E   ++            +P    A ++ G  A
Sbjct: 720 SAIGDRAGEAHATFGLAEVARLNGDDREALALVADAQPVFQDLDDDPCTVLALDLRGDMA 779

Query: 173 LKFGKVQKAKTIFEELAKDN---NSPFGISTRSQM 204
           +  G    A+  +EE          P     R+++
Sbjct: 780 VAQGDRDAARAHWEEALVLATRHALPQTARLRAKL 814


>gi|218131863|ref|ZP_03460667.1| hypothetical protein BACEGG_03485 [Bacteroides eggerthii DSM 20697]
 gi|317474523|ref|ZP_07933797.1| TPR domain-containing protein [Bacteroides eggerthii 1_2_48FAA]
 gi|217986166|gb|EEC52505.1| hypothetical protein BACEGG_03485 [Bacteroides eggerthii DSM 20697]
 gi|316909204|gb|EFV30884.1| TPR domain-containing protein [Bacteroides eggerthii 1_2_48FAA]
          Length = 587

 Score = 48.8 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 50/159 (31%), Gaps = 4/159 (2%)

Query: 47  EKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           E KK +V + ++   + +++  L+    +        N       N Y   + V + +  
Sbjct: 427 ESKKEVVSDFYSILGDAYHTKDLNTEAYAAYDSALVYNPSNIGALNNYAYYLSVERRNLD 486

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANE 166
            A E+  K    +              A IL +  +Y E    +    +          E
Sbjct: 487 KAEEMSYKTVKAEPDNATYLD----TYAWILFEKGNYAEARLYIDDAMKNDGGKSDVIVE 542

Query: 167 ILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
             G      G V KA   +++  +  +    +  + +  
Sbjct: 543 HCGDIYYMTGDVDKALEYWKQALEIGSKSKTLKQKIRQK 581


>gi|213018854|ref|ZP_03334662.1| hypothetical protein C1A_627 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995805|gb|EEB56445.1| hypothetical protein C1A_627 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 183

 Score = 48.8 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 38/186 (20%), Positives = 71/186 (38%), Gaps = 11/186 (5%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILS 81
           K+I  L +  +L     + L +  + K+    G+ F + L L   NK          +L 
Sbjct: 3   KYIFLLTLAPMLVGITLYLLRNIDNTKQSITAGDKFYEVLFLKKDNKS---------LLE 53

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEI-FLKVANDDLAPLAVRYAATLQAASILVDT 140
           + +  +  L+N   A   ++     + A I +  +A+D  AP  +R  A       L+ +
Sbjct: 54  EIDSHWEYLANFERAFNHISDSMPTDTASIIYNDLADDKDAPDVLRELAQYLEVMSLLHS 113

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
           S  +     +  L E +      + E + I  +    ++ A  I   L  D   P  I  
Sbjct: 114 SGEKTNRDKISNL-ESNAVYPYSSQEAIAIVKIHSNDIKGAIEILHSLLNDRECPTLIKA 172

Query: 201 RSQMIL 206
            +Q +L
Sbjct: 173 NAQELL 178


>gi|88798070|ref|ZP_01113657.1| protein containing tetratricopeptide repeat [Reinekea sp. MED297]
 gi|88779267|gb|EAR10455.1| protein containing tetratricopeptide repeat [Reinekea sp. MED297]
          Length = 647

 Score = 48.5 bits (113), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 49/147 (33%), Gaps = 5/147 (3%)

Query: 71  DARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAAT 130
           +  +      +        L +     I +       AA +      +    L      T
Sbjct: 207 EVPAVLPLAAATPANTDAALPDPMTTLIALVNEQQWQAARVVADELQERFEGLPRYDLYT 266

Query: 131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
                I +   +Y+E     +++     P    A   LG +    G   +A+   +++  
Sbjct: 267 ---GLIQMQEGAYDEAIFSFERVLIF-EPNQHRARLELGRAYYLTGNFYRAREALQQVLA 322

Query: 191 DNNSPFGISTRSQMILANIIASDQRNK 217
             + P G+  R Q+IL  I  +++R +
Sbjct: 323 -VDPPQGVRQRVQLILNRIDQAERRQQ 348


>gi|169608656|ref|XP_001797747.1| hypothetical protein SNOG_07413 [Phaeosphaeria nodorum SN15]
 gi|160701690|gb|EAT84879.2| hypothetical protein SNOG_07413 [Phaeosphaeria nodorum SN15]
          Length = 818

 Score = 48.5 bits (113), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 20/182 (10%), Positives = 50/182 (27%), Gaps = 9/182 (4%)

Query: 37  IWFY-LFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYI 95
           IWF        +K+       + + LE   ++     +  +       N      +  Y+
Sbjct: 213 IWFQVGHVYEQQKEFEAAKGAYRRVLERDPNHAKVLQQLGWLHHQQSTNYTSQEQAIEYL 272

Query: 96  ASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSE 155
                ++   K        V  D   P             +    + Y +      +   
Sbjct: 273 EK---SQKYPKAYEAYQQAVYRDGRNPTFWCSI-----GVLYYQINQYRDALDAYSRAIR 324

Query: 156 PSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQR 215
            +  + +   ++  +      +   A   ++  A  + S   I  R Q++     ++   
Sbjct: 325 LNPNISEVWYDLGTLYESCNNQTADALDAYQRAADLDPSNVHIKARLQLLQNGQSSAAAP 384

Query: 216 NK 217
           N 
Sbjct: 385 NG 386


>gi|303327039|ref|ZP_07357481.1| TPR domain protein [Desulfovibrio sp. 3_1_syn3]
 gi|302863027|gb|EFL85959.1| TPR domain protein [Desulfovibrio sp. 3_1_syn3]
          Length = 579

 Score = 48.5 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 51/151 (33%), Gaps = 6/151 (3%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
            F     L  +    +A +  E IL+     Y  L+  Y+   L  +      A   L  
Sbjct: 434 AFLLGSLLDETGDKKNAFTVMEGILTNHPDNYQALN--YVGYTLAEENRDLERAVKLLVR 491

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
           A++     +         A  L  +   EE  K +++  +  + +     E  G  AL+ 
Sbjct: 492 ADELSPNQSY---IVDSLAWALFKSGRQEEALKEIRRAVKLGDQVDSSIWEHYGDIALRS 548

Query: 176 GKVQKAKTIFEELAKDNNSPFG-ISTRSQMI 205
           G   +A+  +++      +    +  R   +
Sbjct: 549 GLKDEARKAYQKALDLKPANAEALRQRLSTL 579


>gi|33866741|ref|NP_898300.1| TPR repeat-containing glycosyl transferase [Synechococcus sp. WH
           8102]
 gi|33639342|emb|CAE08724.1| Possible glycosyltransferase 2 fused to TPR-repeat domain
           [Synechococcus sp. WH 8102]
          Length = 400

 Score = 48.5 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 50/157 (31%), Gaps = 5/157 (3%)

Query: 54  GENFAQALE---LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
           G+ +A A     + +  + D A     + L Q          + +   L         A 
Sbjct: 198 GDPYASAKLGGLMISEGQHDQAIPLLRRGLDQATGDSTERYELLLHLGLALSPSDPIGAV 257

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
              + A +      +   A L  A+ L++    +E   + Q  +    P        LG+
Sbjct: 258 ACYRQALEIPLDARISLGARLNLAARLMEQGELDEAIALTQT-ATQRAPEVALGWYNLGL 316

Query: 171 SALKFGKVQKAKTIFEELAK-DNNSPFGISTRSQMIL 206
              + G +  A   +    + D N+      R+  +L
Sbjct: 317 MLRRRGDIAAALEAYSRAVELDPNNAACHQNRAVALL 353


>gi|116749119|ref|YP_845806.1| hypothetical protein Sfum_1684 [Syntrophobacter fumaroxidans MPOB]
 gi|116698183|gb|ABK17371.1| hypothetical protein Sfum_1684 [Syntrophobacter fumaroxidans MPOB]
          Length = 248

 Score = 48.5 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/195 (10%), Positives = 55/195 (28%), Gaps = 10/195 (5%)

Query: 9   SYKGKCKMGKCCY-KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL------ 61
           S   +  +      +++   ++L +++LA   +      E  +      +   L      
Sbjct: 21  SLSERWDLWFEKNARYLIGGVVL-LVALAGAVWGVTAYRESLEARARTEYVALLGKLPVV 79

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLS-NMYIASILVAKGDTKNAAEIFLKVANDDL 120
           +  +S + +      +  +         ++    +       G  ++A      +  +  
Sbjct: 80  DGESSGEWEKRIPELDAFIQAHPGTKIVINARADLLQAFTKVGRYEDAVRQGNLMLKEID 139

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANE-ILGISALKFGKVQ 179
               +R  A  Q A         ++  +   ++       +       L     K G   
Sbjct: 140 PRHPLRPIAREQLAIAYDAGGRIDDALQQWNEMKREGFESYSRVISWNLARLYGKKGDFA 199

Query: 180 KAKTIFEELAKDNNS 194
           +A   FE   K   +
Sbjct: 200 RAAQEFEAALKTEGA 214


>gi|302342895|ref|YP_003807424.1| hypothetical protein Deba_1462 [Desulfarculus baarsii DSM 2075]
 gi|301639508|gb|ADK84830.1| hypothetical protein Deba_1462 [Desulfarculus baarsii DSM 2075]
          Length = 392

 Score = 48.5 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/179 (11%), Positives = 55/179 (30%), Gaps = 7/179 (3%)

Query: 46  HEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDT 105
           ++ +     +   +  +    +  +  R     I    +  + P +   +A +       
Sbjct: 36  NDAQDRRAAQLLLELGQTPPQDYANQRRLLEAIIEQCPDSTHAPEAYWRLAEVYKRYLGL 95

Query: 106 KNAAEIFLKVANDDLAPLAVRY--AATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF 163
            +   I L                 A  Q       T  +E ++    K   P + +   
Sbjct: 96  PDYTAIALLFEKYLARYPRAADAPMARRQLIEAYEKTGQWEPVAAYFAKDLGPMDQLPDS 155

Query: 164 ANEILGISALKF----GKVQKAKTIFEELAK-DNNSPFGISTRSQMILANIIASDQRNK 217
                G+S  +     G+  +AK  ++++   D  +    + +++  LA +    + + 
Sbjct: 156 RLFQDGLSYAQALEHTGRTAQAKAWYQKIVARDGGANSPAAAKARQRLAALGDEPRPST 214


>gi|15218484|ref|NP_172498.1| GRP23 (GLUTAMINE-RICH PROTEIN23); binding [Arabidopsis thaliana]
 gi|75213379|sp|Q9SY69|PPR29_ARATH RecName: Full=Pentatricopeptide repeat-containing protein
           At1g10270; AltName: Full=Protein GLUTAMINE-RICH PROTEIN
           23
 gi|4914329|gb|AAD32877.1|AC005489_15 F14N23.15 [Arabidopsis thaliana]
 gi|332190439|gb|AEE28560.1| glutamine-rich protein 23 [Arabidopsis thaliana]
          Length = 913

 Score = 48.1 bits (112), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/137 (12%), Positives = 44/137 (32%), Gaps = 4/137 (2%)

Query: 57  FAQALELF-NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
           + Q +    +   +D+A   +  IL+      + ++  ++   LV  G   +AA +  ++
Sbjct: 219 YNQIINAHCDEGNVDEALEVYRHILANAPFAPSSVTYRHLTKGLVQAGRIGDAASLLREM 278

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
            +      A             +D   +++  +   +L           N        + 
Sbjct: 279 LSKG---QAADSTVYNNLIRGYLDLGDFDKAVEFFDELKSKCTVYDGIVNATFMEYWFEK 335

Query: 176 GKVQKAKTIFEELAKDN 192
           G  ++A   +  L    
Sbjct: 336 GNDKEAMESYRSLLDKK 352



 Score = 40.8 bits (93), Expect = 0.12,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 44/126 (34%), Gaps = 2/126 (1%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           ++ + +  ++ S F+    Q N + N +S   I +    +G+   A E++  +  +    
Sbjct: 190 MYRAKRYSESISLFQYFFKQSNIVPNVVSYNQIINAHCDEGNVDEALEVYRHILANAPFA 249

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
                         LV      + + +L+++              L    L  G   KA 
Sbjct: 250 P--SSVTYRHLTKGLVQAGRIGDAASLLREMLSKGQAADSTVYNNLIRGYLDLGDFDKAV 307

Query: 183 TIFEEL 188
             F+EL
Sbjct: 308 EFFDEL 313


>gi|225848981|ref|YP_002729145.1| Spc97 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644153|gb|ACN99203.1| putative Spc97 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 210

 Score = 48.1 bits (112), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 26/175 (14%), Positives = 67/175 (38%), Gaps = 4/175 (2%)

Query: 19  CCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEK 78
             Y  I    ++++L  ++ +YL+    +++        ++   L + +K ++AR   ++
Sbjct: 28  KKYLKIILAFVVILLIGSLGYYLYTKKKQEENEKASVYVSKIANLLSEDKKEEARKLIDE 87

Query: 79  ILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV 138
              +            I S  +     +   +  L  A  +     +        A + +
Sbjct: 88  FEKKYKDTNFYKV---ILSYKIMMAKDEGKEDEKLANALKEKLNTQILEGVKEYTAYLKL 144

Query: 139 DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
             ++  +  +IL+ + +     +  A   LG+   K G  Q+A+ IF E+ +  +
Sbjct: 145 KQNNTNQAKEILKSI-DKDKYNYISAQATLGLIYKKEGNYQEAEKIFNEIKEKKD 198


>gi|121997361|ref|YP_001002148.1| hypothetical protein Hhal_0560 [Halorhodospira halophila SL1]
 gi|121588766|gb|ABM61346.1| Tetratricopeptide TPR_2 repeat protein [Halorhodospira halophila
           SL1]
          Length = 389

 Score = 48.1 bits (112), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 63/185 (34%), Gaps = 9/185 (4%)

Query: 25  APLLILMILSLAIWFYL----FDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKIL 80
              L+L + +L+ W+       D  H+     + + + Q L    + + D A   F +++
Sbjct: 4   LLWLLLPVAALSGWWIGRRGGSDEHHDAFSPQISDAYFQGLNYLLNEERDKALEVFTRMV 63

Query: 81  SQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDT 140
             D+      +++ + S+   +G+   A  I   +          R  A L      +  
Sbjct: 64  EVDSDT--AETHLALGSVFRRRGEVDRAIRIHQNLIARPSLTRRQRTYALLALGEDYMKA 121

Query: 141 SSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST 200
             ++   K+ Q++ E    + Q    +L        +  +A    E L +          
Sbjct: 122 GVFDRAEKLFQEVVEQDAHVEQALRRLLT-IYEHEREWDRAIETAERLEQVGE--GDYRV 178

Query: 201 RSQMI 205
           R   +
Sbjct: 179 RIGQL 183


>gi|261856776|ref|YP_003264059.1| hypothetical protein Hneap_2196 [Halothiobacillus neapolitanus c2]
 gi|261837245|gb|ACX97012.1| Protein of unknown function DUF2133 [Halothiobacillus neapolitanus
           c2]
          Length = 221

 Score = 48.1 bits (112), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 66/201 (32%), Gaps = 4/201 (1%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
            K +     Y       I++ L+    +  +     K +      F Q  +L  +N+ + 
Sbjct: 10  DKLREFWTQYGKTIIAGIILGLAALAAWAGWQSWQAKNQTAAAIAFHQIEQLSAANQPNQ 69

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
           A  +  K+   D         + I +      +    A I+L  A       ++   A L
Sbjct: 70  AMEAARKLAESDQGSVYATLALMIGAHEAMSQNDPAKAAIYLNDAMQHAKQPSLAALAQL 129

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
           + A +    +  E+    L+  +           E+ G           A+  +E++   
Sbjct: 130 RLARVQWAQNKPEQALTTLKAKTP-PKAYESMFTELTGDIQASQKNWAAARAAYEQVLAA 188

Query: 192 NNSPFGISTRSQMILANIIAS 212
            +S   +    Q+ L N+ A+
Sbjct: 189 PDSANTM---VQIKLDNLPAA 206


>gi|213863162|ref|ZP_03386417.1| hypothetical protein SentesT_30830 [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
          Length = 69

 Score = 48.1 bits (112), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 5/64 (7%), Positives = 18/64 (28%)

Query: 12 GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDD 71
             K           + +++ +   I +  ++             +  A+   +  K D 
Sbjct: 4  EAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNAVTAVSEGKPDS 63

Query: 72 ARSS 75
            ++
Sbjct: 64 IPAA 67


>gi|83415184|ref|NP_787057.2| transmembrane and TPR repeat-containing protein 1 isoform 2 [Homo
           sapiens]
 gi|269849473|sp|Q8IUR5|TMTC1_HUMAN RecName: Full=Transmembrane and TPR repeat-containing protein 1
 gi|119617007|gb|EAW96601.1| hCG2009560, isoform CRA_d [Homo sapiens]
          Length = 774

 Score = 48.1 bits (112), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 51/167 (30%), Gaps = 9/167 (5%)

Query: 52  IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              + ++  A  L    +  +A   ++  +       +  +N  +   LV  G  + A  
Sbjct: 472 EFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVF--LVDTGLPEKAVA 529

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
            + +            + A +    +           +  ++  +            LG 
Sbjct: 530 HYQQAIKL----SPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQV--AHKAEILSPLGA 583

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
                G+ ++A  I++E A    S   +      +LA +  + +  K
Sbjct: 584 LYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEK 630



 Score = 40.4 bits (92), Expect = 0.16,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 61/218 (27%), Gaps = 21/218 (9%)

Query: 16  MGKCCYKWIAPLL----ILMILSLAIWFYL-----FDGSHEKKKNIVGEN---FAQALEL 63
           M +  YK    +     IL  L    +             E       +     A A  L
Sbjct: 560 MAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVL 619

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
               +  +A      I+S++           +++I   + +   A +   K         
Sbjct: 620 AVMGQTKEAEKMTNHIVSEETGCLE--CYRLLSAIYSKQENHDKALDAIDKALQLKPKDP 677

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            V         + L + +  ++  +   +++   NP    A   +G      GK   A+ 
Sbjct: 678 KVISELFFTKGNQLREQNLLDKAFESY-RVAVQLNPDQAQAWMNMGGIQHIKGKYVSARA 736

Query: 184 IFEELAKDNNSPFGIST------RSQMILANIIASDQR 215
            +E   +       +        R +  L  +   DQ 
Sbjct: 737 YYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT 774


>gi|317484819|ref|ZP_07943714.1| hypothetical protein HMPREF0179_01066 [Bilophila wadsworthia 3_1_6]
 gi|316923926|gb|EFV45117.1| hypothetical protein HMPREF0179_01066 [Bilophila wadsworthia 3_1_6]
          Length = 228

 Score = 48.1 bits (112), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 27/191 (14%), Positives = 57/191 (29%), Gaps = 5/191 (2%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E  ++                 I    I++++ +      +     + +        +  
Sbjct: 19  EIQSEVAVEATPLLSFVLRNSRIIVTCIVLLVLVIAGVGGWQWHQTRVEREA---HLELG 75

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
            +  S +  +  ++ E  L            + IA+  +       AA+ +  VA  D  
Sbjct: 76  RILVSTQGPERIAALETFLPAAPSAMKSGVQLEIATTALGLEQYGKAADAYAAVAAADPK 135

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKL-SEPSNPMHQFANEILGISALKFGKVQK 180
                  A +  A +L     Y E   +   L       +     E   +SA   GK+ +
Sbjct: 136 GSIGM-MAAINQADLLQRQGKYAEALAVFDSLEKSAPESLRPAILEGQAMSAELAGKLDR 194

Query: 181 AKTIFEELAKD 191
           A   +E +A  
Sbjct: 195 ALAAYESIATS 205


>gi|27469599|gb|AAH42083.1| Transmembrane and tetratricopeptide repeat containing 1 [Homo
           sapiens]
          Length = 774

 Score = 48.1 bits (112), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 51/167 (30%), Gaps = 9/167 (5%)

Query: 52  IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              + ++  A  L    +  +A   ++  +       +  +N  +   LV  G  + A  
Sbjct: 472 EFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVF--LVDTGLPEKAVA 529

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
            + +            + A +    +           +  ++  +            LG 
Sbjct: 530 HYQQAIKL----SPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQV--AHKAEILSPLGA 583

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
                G+ ++A  I++E A    S   +      +LA +  + +  K
Sbjct: 584 LYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEK 630



 Score = 41.1 bits (94), Expect = 0.10,   Method: Composition-based stats.
 Identities = 31/218 (14%), Positives = 61/218 (27%), Gaps = 21/218 (9%)

Query: 16  MGKCCYKWIAPLL----ILMILSLAIWFYL-----FDGSHEKKKNIVGEN---FAQALEL 63
           M +  YK    +     IL  L    +             E       +     A A  L
Sbjct: 560 MAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVL 619

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
               +  +A      I+S++           +++I   + +   A +   K         
Sbjct: 620 AVMGQTKEAEKMTNHIVSEETGCLE--CYRLLSAIYSKQENHDKALDAIDKALQLKPKDP 677

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            V         + L + +  ++  +   +L+   NP    A   +G      GK   A+ 
Sbjct: 678 KVISELFFTKGNQLREQNLLDKAFESY-RLAVQLNPDQAQAWMNMGGIQHIKGKYVSARA 736

Query: 184 IFEELAKDNNSPFGIST------RSQMILANIIASDQR 215
            +E   +       +        R +  L  +   DQ 
Sbjct: 737 YYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT 774


>gi|213421022|ref|ZP_03354088.1| hypothetical protein Salmonentericaenterica_26052 [Salmonella
          enterica subsp. enterica serovar Typhi str. E01-6750]
          Length = 70

 Score = 48.1 bits (112), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 6/70 (8%), Positives = 22/70 (31%)

Query: 1  MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
          ME   + +      K           + +++ +   + +  +     +        +  A
Sbjct: 1  MEIYENEHDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWSSHQTESARAASLAYQNA 60

Query: 61 LELFNSNKLD 70
          +   +++K D
Sbjct: 61 VTAVSADKPD 70


>gi|182412500|ref|YP_001817566.1| hypothetical protein Oter_0677 [Opitutus terrae PB90-1]
 gi|177839714|gb|ACB73966.1| hypothetical protein Oter_0677 [Opitutus terrae PB90-1]
          Length = 242

 Score = 48.1 bits (112), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 23/203 (11%), Positives = 53/203 (26%), Gaps = 14/203 (6%)

Query: 9   SYKGKCKMGKCCYKWIAPLLILMI---LSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           S++ + ++       +    ++++   +     +       +++       +A A     
Sbjct: 30  SFEERLRVFWQQNSKLVTGALVVVLLAILGKGGWEYLQAEKDREVRRA---YAAATTPAQ 86

Query: 66  SNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
                    +F     +          M   +    K             A D     + 
Sbjct: 87  -------LKTFTAAHPEHPLAGAAYLRMADDAYADRKFTDAVGLYEQAIQALDAPVLESR 139

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
                  A       +  E   K     ++        A   L +SAL  GK +     +
Sbjct: 140 ARLGIAIAKLQGGRAAEGETALKAFANEAKEVKAFRVEALYHLAVSALTNGKPED-VKSY 198

Query: 186 EELAKDNNSPFGISTRSQMILAN 208
            E     +     + R+ M+ AN
Sbjct: 199 SEQLMQLDPTSPWTQRAMMLRAN 221


>gi|300741345|ref|ZP_07071366.1| putative UDP-N-acetylglucosamine-peptide-n-
           acetylglucosaminyltransferase [Rothia dentocariosa M567]
 gi|300380530|gb|EFJ77092.1| putative UDP-N-acetylglucosamine-peptide-n-
           acetylglucosaminyltransferase [Rothia dentocariosa M567]
          Length = 718

 Score = 48.1 bits (112), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 56/153 (36%), Gaps = 7/153 (4%)

Query: 48  KKKNIVGENFAQALELFNS-----NKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAK 102
           +++    E +AQAL    +      KL  A  ++ K+   D+      + + +      +
Sbjct: 40  RREEAAPEIYAQALLGIGAAYQALGKLKKAIKAWSKVRHGDDPKAYAGAQLGLGLAYYTR 99

Query: 103 GDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQ 162
           G   +A   +  +  + +AP      A L       D    ++       +    NP   
Sbjct: 100 GKLDDAIAAWSNIHREKIAPETYAK-AQLNLGVAYKDQGKLDDAIAAWSNIHREDNPETY 158

Query: 163 FANEI-LGISALKFGKVQKAKTIFEELAKDNNS 194
              ++ LG++    GK+  A   +  + +D+N 
Sbjct: 159 AKAQLGLGLAYRTQGKLDDAIAAWSNIHRDDNP 191



 Score = 41.5 bits (95), Expect = 0.091,   Method: Composition-based stats.
 Identities = 19/156 (12%), Positives = 43/156 (27%), Gaps = 5/156 (3%)

Query: 34  SLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNM 93
           ++A W  +     +  +             +          ++  I   DN      + +
Sbjct: 178 AIAAWSNI--HRDDNPETYAQAQLGLGAAYYAQEDWKQTIKTWSNIHRDDNPETYAQAQL 235

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
            +       G    A E +  +  DD      +        +   D    ++       +
Sbjct: 236 NLGITYYTWGMLYKAIEAWSNIHRDDNPETYAK--VQFIIGNAYEDQVKLDDAITAWSNI 293

Query: 154 SEPSNPMHQFANEI-LGISALKFGKVQKAKTIFEEL 188
               NP      ++ LG++    G + KAK  +   
Sbjct: 294 HRDDNPETYAGAQLNLGVAYEDQGNLDKAKEAYRNA 329



 Score = 36.5 bits (82), Expect = 2.3,   Method: Composition-based stats.
 Identities = 19/157 (12%), Positives = 43/157 (27%), Gaps = 3/157 (1%)

Query: 53  VGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIF 112
             E        +N +K D+A  +   I  +        +   +      +   K    I 
Sbjct: 13  AQERLDLGRSYYNEDKFDEAIKALSSIRRE-EAAPEIYAQALLGIGAAYQALGKLKKAIK 71

Query: 113 LKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLS--EPSNPMHQFANEILGI 170
                           A L            ++       +   + +   +  A   LG+
Sbjct: 72  AWSKVRHGDDPKAYAGAQLGLGLAYYTRGKLDDAIAAWSNIHREKIAPETYAKAQLNLGV 131

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
           +    GK+  A   +  + +++N       +  + LA
Sbjct: 132 AYKDQGKLDDAIAAWSNIHREDNPETYAKAQLGLGLA 168


>gi|110640085|ref|YP_680295.1| TPR domain-containing protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110282766|gb|ABG60952.1| TPR domain protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 213

 Score = 48.1 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/187 (11%), Positives = 58/187 (31%), Gaps = 8/187 (4%)

Query: 20  CYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA--------LELFNSNKLDD 71
            YK  A + + +I++L   F  +  +  +   +  E   +A        LEL        
Sbjct: 9   KYKNPAIIGLGVIVALIAAFVFYKYNQSENNTVAQEEMYKAVFYFEQDSLELALKGDEAK 68

Query: 72  ARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATL 131
                +++  + +         +   I+  K      +  +L+  + +   L  R  A +
Sbjct: 69  GIRGLQEVADEYSGTKAGKLAAFYTGIIYLKQAKFQESIDYLEKFSSNEGILQARSWAAM 128

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
             A   ++               + +  +       LG++       + A   ++++  D
Sbjct: 129 GDAYSELNDLENAIKYYKKAADHKGNEQITPTYLMKLGLAYELNNNWKDASDAYDKIITD 188

Query: 192 NNSPFGI 198
                 +
Sbjct: 189 YPKSQDV 195


>gi|51245796|ref|YP_065680.1| hypothetical protein DP1944 [Desulfotalea psychrophila LSv54]
 gi|50876833|emb|CAG36673.1| unknown protein [Desulfotalea psychrophila LSv54]
          Length = 256

 Score = 48.1 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/188 (13%), Positives = 58/188 (30%), Gaps = 5/188 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
             L +  ++ + + F L+    +K           ALE     + +  R   E     ++
Sbjct: 71  IQLALAFVIIMVVAFSLYASYSKKHTAEASSALGLALEEPADKRANYLRKVVEDYSGTNS 130

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
             +  +    +A   +A+     A   +  + +       +        A  L     Y 
Sbjct: 131 ATWATI---ELAHGYMAEKAYAKAYSSYSIILDKITDTDPLHPLIIFGQAESLEAQKKYV 187

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE-LAKDNNSPFGISTRSQ 203
           E  ++ Q L   S          +  +    G ++KA   + + L    +S     +  +
Sbjct: 188 EAYEMYQHLKIFSGYNDLAYLG-MARTWEARGDIEKAILTYNDYLLTLESSRPQAKSYIE 246

Query: 204 MILANIIA 211
             +  + A
Sbjct: 247 SKIVRLQA 254


>gi|149280280|ref|ZP_01886402.1| TPR domain protein [Pedobacter sp. BAL39]
 gi|149228969|gb|EDM34366.1| TPR domain protein [Pedobacter sp. BAL39]
          Length = 223

 Score = 48.1 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 64/177 (36%), Gaps = 12/177 (6%)

Query: 22  KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSN-------KLDDARS 74
           K +  + + ++  + I+F+  +   + +         +A +   ++         D    
Sbjct: 24  KSLLFIGVAIVALIGIYFWYQNVYLKNRALEASAKMYRAEQFLTADSLANKAINGDGGYP 83

Query: 75  SFEKILSQDNKLYNP-LSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
             EKI  + +   +  L+N+Y+  I + KGD + A +   K +            A    
Sbjct: 84  GLEKIAEEYDNTKSANLANLYLGGIYLRKGDYRKAVDALGKYSETGS--PVADPLALGLL 141

Query: 134 ASILVDTSSYEEISKILQKLSEPSNP--MHQFANEILGISALKFGKVQKAKTIFEEL 188
                +   +++ +   +K ++ S+         + LG+        + A+  + ++
Sbjct: 142 GDAYSELKDFKQAATYYKKAADKSSNKFTSPLFLKKLGLVYENLKDYKSAEEAYTKI 198


>gi|189500706|ref|YP_001960176.1| Tetratricopeptide domain-containing protein [Chlorobium
           phaeobacteroides BS1]
 gi|189496147|gb|ACE04695.1| Tetratricopeptide domain protein [Chlorobium phaeobacteroides BS1]
          Length = 228

 Score = 48.1 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/185 (9%), Positives = 49/185 (26%), Gaps = 6/185 (3%)

Query: 12  GKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKL-- 69
            +       +K +   + ++++++A             +N      + A           
Sbjct: 17  DRLLEFFILHKNLIIAVTIVVIAIAGSLVYMKQQSLSAENKANSLVSSASASAQIGNWQL 76

Query: 70  ----DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAV 125
               D +     +I+ +     +      +           ++A    +  +  +  LA 
Sbjct: 77  AIDGDASFKGLREIVKEYGSTPSGNFAKILLGDSYLALGEIDSALESYRSYSGKIPDLAA 136

Query: 126 RYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIF 185
              A                        +  +  +          + L  G++ KA T +
Sbjct: 137 SAHAGAALCLSRKKELPEAAQLYEKASETATNQALKALYLSDAADTWLSLGELDKAVTRY 196

Query: 186 EELAK 190
           +E+ K
Sbjct: 197 KEVIK 201


>gi|332839885|ref|XP_003313873.1| PREDICTED: transmembrane and TPR repeat-containing protein 1
           isoform 1 [Pan troglodytes]
          Length = 774

 Score = 47.7 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 51/167 (30%), Gaps = 9/167 (5%)

Query: 52  IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              + ++  A  L    +  +A   ++  +       +  +N  +   LV  G  + A  
Sbjct: 472 EFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVF--LVDTGLPEKAVA 529

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
            + +            + A +    +           +  ++  +            LG 
Sbjct: 530 HYQQAIKL----SPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQV--AHKAEILSPLGA 583

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
                G+ ++A  I++E A    S   +      +LA +  + +  K
Sbjct: 584 LYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEK 630



 Score = 40.4 bits (92), Expect = 0.18,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 61/218 (27%), Gaps = 21/218 (9%)

Query: 16  MGKCCYKWIAPLL----ILMILSLAIWFYL-----FDGSHEKKKNIVGEN---FAQALEL 63
           M +  YK    +     IL  L    +             E       +     A A  L
Sbjct: 560 MAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVL 619

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
               +  +A      I+S++           +++I   + +   A +   K         
Sbjct: 620 AVMGQTKEAEKMTNHIVSEETGCLE--CYRLLSAIYSKQENHDKALDAIDKALQLKPKDP 677

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
            V         + L + +  ++  +   +++   NP    A   +G      GK   A+ 
Sbjct: 678 KVISELFFTKGNQLREQNLLDKAFESY-RVAVQLNPDQAQAWMNMGGIQHIKGKYVSARA 736

Query: 184 IFEELAKDNNSPFGIST------RSQMILANIIASDQR 215
            +E   +       +        R +  L  +   DQ 
Sbjct: 737 YYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT 774


>gi|258404961|ref|YP_003197703.1| hypothetical protein Dret_0834 [Desulfohalobium retbaense DSM 5692]
 gi|257797188|gb|ACV68125.1| conserved hypothetical protein [Desulfohalobium retbaense DSM 5692]
          Length = 224

 Score = 47.7 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/194 (13%), Positives = 60/194 (30%), Gaps = 8/194 (4%)

Query: 2   ESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL 61
           E + D +    K          +   ++L+    + +              +     +  
Sbjct: 17  EVSEDIHPLLRKITDNLKTIGIVIGAVVLIAAGYSGFTLYQQRQ-------IASAQNELG 69

Query: 62  ELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLA 121
           ++ +      A  + +   S+          + +A + +     + A+  +  +     A
Sbjct: 70  QILSMQDPAQAAQALDTFASKAPSSMQQGVRLEMARLAMEAEKYEQASTAWEALVQTTPA 129

Query: 122 PLAVRYAATLQAASILVDTSSYEEISKILQKLSEP-SNPMHQFANEILGISALKFGKVQK 180
             A+   A    A  L  + + E+   ILQ L E  + P  QF    L  +A        
Sbjct: 130 DAALHTVAQFGQAKALRLSGNTEQALDILQSLRETIAEPYRQFFLTELAATAEAAQNWDT 189

Query: 181 AKTIFEELAKDNNS 194
           A + ++EL      
Sbjct: 190 ALSAYQELRTSQEP 203


>gi|145630028|ref|ZP_01785810.1| cytochrome C-type biogenesis protein [Haemophilus influenzae R3021]
 gi|144984309|gb|EDJ91732.1| cytochrome C-type biogenesis protein [Haemophilus influenzae R3021]
          Length = 385

 Score = 47.7 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/205 (10%), Positives = 61/205 (29%), Gaps = 3/205 (1%)

Query: 2   ESNNDANSYKGKCKMG-KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ES++D    + K     K  +K    +  L++     +++  D     ++          
Sbjct: 168 ESHSDPKQKEQKTYFFGKSNHKLSFVIFFLLMAIPTAYYFSLDRFSRVQQGEQSMIEQHN 227

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
             +  +++  +     +          N  + + +    V   +  +A   +        
Sbjct: 228 QNVEMNDEHKNENVIEKLQNKLRTDPNNAETWLQLGEAYVQNNEFDSALVAYSNAEKLSG 287

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           +   +   A              +   + L   +   +     +  +L   AL+  + Q+
Sbjct: 288 SKPNILGLAATALYYQAGQQMPPK--VEQLLNEALAKDKNEVSSLSLLATIALENRQYQQ 345

Query: 181 AKTIFEELAKDNNSPFGISTRSQMI 205
           A    ++L    N+     +  Q +
Sbjct: 346 AGMYLQQLLDSGNAAVDRRSVIQRM 370


>gi|75675934|ref|YP_318355.1| hypothetical protein Nwi_1742 [Nitrobacter winogradskyi Nb-255]
 gi|74420804|gb|ABA05003.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 451

 Score = 47.7 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 34/82 (41%), Gaps = 1/82 (1%)

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEEL 188
           A+ + A   V    YE     L+++    NP        LG+   K G  + A++ F+E 
Sbjct: 63  ASFKFAEQAVKRGDYEAAIGALERML-FFNPNLPRVKLELGVLYFKLGSYELARSYFQEA 121

Query: 189 AKDNNSPFGISTRSQMILANII 210
            K  ++P  I  + +  L  I 
Sbjct: 122 IKGADAPDDIRAQVRAYLTEID 143


>gi|300789932|ref|YP_003770223.1| SARP family transcriptional regulator fused with ATPase domain
           [Amycolatopsis mediterranei U32]
 gi|299799446|gb|ADJ49821.1| SARP family transcriptional regulator fused with ATPase domain
           [Amycolatopsis mediterranei U32]
          Length = 1077

 Score = 47.7 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/146 (10%), Positives = 31/146 (21%), Gaps = 2/146 (1%)

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
           +          +Q +         +I ++                              A
Sbjct: 630 ERVAEQLAAAPAQVDPWVTGWLLEHIGTVATETPRVAVDLLRHAVTQGTLPPDARETLTA 689

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
           T   A +L       E            +        IL     + G   +A    +   
Sbjct: 690 T--LARLLFWLGREPEAEARSVVARTSDSRRAAEMRWILAYVYYRRGDFAEATAELKRTL 747

Query: 190 KDNNSPFGISTRSQMILANIIASDQR 215
            D + P     R + +LA +      
Sbjct: 748 DDTDVPEMWRGRHEALLATLEKLGDE 773


>gi|255065192|ref|ZP_05317047.1| tetratricopeptide repeat protein [Neisseria sicca ATCC 29256]
 gi|255050613|gb|EET46077.1| tetratricopeptide repeat protein [Neisseria sicca ATCC 29256]
          Length = 209

 Score = 47.7 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/175 (10%), Positives = 47/175 (26%), Gaps = 3/175 (1%)

Query: 35  LAIWFYLFDGSHEKKKNIVGENFAQALELFNSN-KLDDARSSFEKILSQDNKLYNPLSNM 93
             + + ++      +     E  A+ ++   +     +  +    +              
Sbjct: 35  GYLGYTMYKSHKASQSQEAAEVLAKIVDKMQAKASQAEVNADLTNLQQNYPDSIAAAQAT 94

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
            +A+         + AE  L     +     V+  A  +   +L+    Y+     L   
Sbjct: 95  LMAAATEYDARRYDVAEGHLNWVLKNQKAPLVQALAAQRLGIVLLQQKKYDAAIAALNTK 154

Query: 154 SEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILAN 208
            E          E  G       K ++A   +++  +            QM L +
Sbjct: 155 VEAD--FEPLLLEAKGDVYAAQNKTKEAAQSYQQALEKLPKDAIERELLQMKLDS 207


>gi|1679748|gb|AAB62979.1| Tgl protein [Myxococcus xanthus]
          Length = 241

 Score = 47.7 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 51/144 (35%), Gaps = 6/144 (4%)

Query: 47  EKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           EK+K     ++  AL+   + +L DA    +  L  D    +  + M I   L  +   +
Sbjct: 26  EKEKRSAEIHYDLALQAQQAGELQDALRELQVSLKNDPDYPDANNAMGILLHLAFRRPDE 85

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQK-LSEPSNPMHQFAN 165
                   +             A    A++ +D   Y++  K+ +  L++   P    A 
Sbjct: 86  AVKHYTKALEVRPDFSE-----ARTNLANVHLDQGRYDDAIKLYELVLNDMLYPTPFIAQ 140

Query: 166 EILGISALKFGKVQKAKTIFEELA 189
             LG +  K G+  +A    +   
Sbjct: 141 GNLGWAYYKKGEPDRAVESIKAAV 164



 Score = 35.7 bits (80), Expect = 4.7,   Method: Composition-based stats.
 Identities = 13/96 (13%), Positives = 25/96 (26%), Gaps = 1/96 (1%)

Query: 96  ASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSE 155
             + +         +   ++            A       + +     +E  K   K  E
Sbjct: 36  YDLALQAQQAGELQDALRELQVSLKNDPDYPDANNAMGILLHLAFRRPDEAVKHYTKALE 95

Query: 156 PSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
              P    A   L    L  G+   A  ++E +  D
Sbjct: 96  VR-PDFSEARTNLANVHLDQGRYDDAIKLYELVLND 130


>gi|260581768|ref|ZP_05849565.1| cytochrome C-type biogenesis protein [Haemophilus influenzae NT127]
 gi|260095361|gb|EEW79252.1| cytochrome C-type biogenesis protein [Haemophilus influenzae NT127]
          Length = 385

 Score = 47.7 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/205 (10%), Positives = 62/205 (30%), Gaps = 3/205 (1%)

Query: 2   ESNNDANSYKGKCKMG-KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ES++D    + K     K  +K    +  L++     +++  D     ++          
Sbjct: 168 ESHSDPKQKEQKTYFFGKSNHKLSFVIFFLLMAIPTAYYFSLDRFSRVQQGEQSMIEQHN 227

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
             +  +++  +     +          N  + + +    V   +  +A   +        
Sbjct: 228 QNVEMNDEHKNENVIEKLQNKLRTDPNNAETWLQLGEAYVQNNEFDSALVAYSNAEKLSG 287

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           +   +   A            + +   + L   +   +     +  +L   AL+  + Q+
Sbjct: 288 SKPNILGLAATALYYQAGQQMTPK--VEQLLNEALAKDKNEVSSLSLLATIALENRQYQQ 345

Query: 181 AKTIFEELAKDNNSPFGISTRSQMI 205
           A    ++L    N+     +  Q +
Sbjct: 346 AGMYLQQLLDSGNAAVDRRSVIQRM 370


>gi|289806826|ref|ZP_06537455.1| hypothetical protein Salmonellaentericaenterica_21337 [Salmonella
          enterica subsp. enterica serovar Typhi str. AG3]
          Length = 83

 Score = 47.7 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 6/83 (7%), Positives = 25/83 (30%)

Query: 1  MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
          ME   + +      K           + +++ +   + +  +     +        +  A
Sbjct: 1  MEIYENEHDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWSSHQTESARAASLAYQNA 60

Query: 61 LELFNSNKLDDARSSFEKILSQD 83
          +   +++K D   ++ +      
Sbjct: 61 VTAVSADKPDSIPAAEKFAAENK 83


>gi|149713893|ref|XP_001503021.1| PREDICTED: similar to Transmembrane and TPR repeat-containing
           protein 1 [Equus caballus]
          Length = 774

 Score = 47.7 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 50/167 (29%), Gaps = 9/167 (5%)

Query: 52  IVGENFAQ-ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
              + ++  A  L    +  +A   ++  +       +  +N  +   LV  G  + A  
Sbjct: 472 EFADAYSSLASLLAEQERFKEAEDIYQAGIKNCPDSSDLHNNYGVF--LVDTGSPEKAVA 529

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
            + +            + A +    +           +  ++  +            LG 
Sbjct: 530 HYQQAIKL----SPSHHVAMVNLGRLYRSLGDNSVAEEWYKRALQV--ARKAEILSPLGA 583

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNK 217
                G+ ++A  I+ E A    S   +      +LA +  + +  K
Sbjct: 584 LYYNTGRYEEALQIYREAAALQPSQRELRLALAQVLAVMGQTKEAEK 630



 Score = 37.7 bits (85), Expect = 1.3,   Method: Composition-based stats.
 Identities = 19/185 (10%), Positives = 48/185 (25%), Gaps = 20/185 (10%)

Query: 44  GSHEKKKNIVGENFAQALELFNSNKL-----DDARSSFEKILSQDNKLYNPL-------- 90
             +  +     + + +A  L  S +          +   +    +    + +        
Sbjct: 585 YYNTGRYEEALQIYREAAALQPSQRELRLALAQVLAVMGQTKEAEKMTIHIVSEEAGCLE 644

Query: 91  SNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKIL 150
               +++I   +     A +   K          V         + L + +  ++  +  
Sbjct: 645 CYRLLSAIYSKQELHDKALDAIDKALRLKPKDPKVISELFFTKGNQLREQNLLDKAFESY 704

Query: 151 QKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGIST------RSQM 204
           +   E  NP    A   +G      G    A+  +E   +       +        R + 
Sbjct: 705 KAAVEL-NPDQAQAWMNMGGIQHIKGNYVSARAYYERALQLVPDSKLLQENLAKLDRLEK 763

Query: 205 ILANI 209
            L  I
Sbjct: 764 RLQEI 768


>gi|81299019|ref|YP_399227.1| TPR repeat-containing protein [Synechococcus elongatus PCC 7942]
 gi|81167900|gb|ABB56240.1| TPR repeat [Synechococcus elongatus PCC 7942]
          Length = 923

 Score = 47.7 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/149 (12%), Positives = 44/149 (29%), Gaps = 7/149 (4%)

Query: 51  NIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
                ++ QA+  + + + + A +  +++L         L    +          +    
Sbjct: 5   AAAQHDYQQAIAAYQAGEFEAAIAQLDRLLGDVPDWAAALGLQGL--CYYCCDQKETGIT 62

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
           +  +    D               ++L       E  + L +     +P H  A     I
Sbjct: 63  LLRRAIALDPTDPTHFN----NLGNLLQRQGHLTEALERLTQALAI-DPTHVAARFNRAI 117

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGIS 199
           +  K G    A   +++L + +     I 
Sbjct: 118 TLQKLGDPATALQDYQQLLEADPDNPEIR 146


>gi|302327666|gb|ADL26867.1| hypothetical protein FSU_2684 [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 242

 Score = 47.3 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 77/228 (33%), Gaps = 21/228 (9%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
             N++N+ + + K     +     +  +++ ++      +  + +       E     L 
Sbjct: 15  MANESNNNQSELKAFFVQHGTKIAVAFVILFAIIAGIVQYKEARKVAAAEQSELIGMGLT 74

Query: 63  LFNSNKLDDARSSFEKILSQD--NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
              + + D A   FE  ++      L    +++  A+I   K D   AA +F    ++  
Sbjct: 75  YLYAGEKDSALVEFENKIASGKLEGLALAKASLLAANIKYEKRDYDGAALLFQNSLDNAG 134

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN-------------------PMH 161
           +   VR AA    A++ ++   +   +  L+K                         PM 
Sbjct: 135 SVALVRSAAMHGLAAVKMEKGDFSAAANFLEKYIAEFGKRTGDKEDRYQKDEPADEVPMV 194

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
             A   L +   + G   KAK   E L          + +++  LA +
Sbjct: 195 ADAMWKLTLVYQQLGASDKAKATAERLLHIYGDNRAFADKARKFLAAL 242


>gi|330928044|ref|XP_003302103.1| hypothetical protein PTT_13802 [Pyrenophora teres f. teres 0-1]
 gi|311322715|gb|EFQ89794.1| hypothetical protein PTT_13802 [Pyrenophora teres f. teres 0-1]
          Length = 877

 Score = 47.3 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/199 (10%), Positives = 52/199 (26%), Gaps = 22/199 (11%)

Query: 37  IWFY-LFDGSHEKKKNIVGENFAQALE----------------LFNSNKLDDARSSFEKI 79
           IWF        +K+       + + LE                   S        + E +
Sbjct: 229 IWFQIGHVYEQQKEFEAAKSAYRRVLERDPNHAKVLQQLGWLHHQQSTNYASQEQAIEYL 288

Query: 80  LSQDNKLYN-PLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV 138
               N       S   +    +++     A E + +    D                +  
Sbjct: 289 EKSVNSDQTDAQSWYLLGRCYMSQQKYPKAYEAYQQAVYRDGRNPTFWC----SIGVLYY 344

Query: 139 DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
             + Y +      +    +  + +   ++  +      +   A   ++  A  + S   I
Sbjct: 345 QINQYRDALDAYSRAIRLNPNISEVWYDLGTLYESCNNQTADALDAYQRAADLDPSNIHI 404

Query: 199 STRSQMILANIIASDQRNK 217
             R Q++     ++   N+
Sbjct: 405 KARLQLLQNGQTSAGAPNQ 423


>gi|189200310|ref|XP_001936492.1| TPR repeat-containing protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187983591|gb|EDU49079.1| TPR repeat-containing protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 870

 Score = 47.3 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/199 (10%), Positives = 52/199 (26%), Gaps = 22/199 (11%)

Query: 37  IWFY-LFDGSHEKKKNIVGENFAQALE----------------LFNSNKLDDARSSFEKI 79
           IWF        +K+       + + LE                   S        + E +
Sbjct: 229 IWFQIGHVYEQQKEFEAAKSAYRRVLERDPNHAKVLQQLGWLHHQQSTNYASQEQAIEYL 288

Query: 80  LSQDNKLYN-PLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILV 138
               N       S   +    +++     A E + +    D                +  
Sbjct: 289 EKSVNSDQTDAQSWYLLGRCYMSQQKYPKAYEAYQQAVYRDGRNPTFWC----SIGVLYY 344

Query: 139 DTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGI 198
             + Y +      +    +  + +   ++  +      +   A   ++  A  + S   I
Sbjct: 345 QINQYRDALDAYSRAIRLNPNISEVWYDLGTLYESCNNQTADALDAYQRAADLDPSNIHI 404

Query: 199 STRSQMILANIIASDQRNK 217
             R Q++     ++   N+
Sbjct: 405 KARLQLLQNGQTSAGAPNQ 423


>gi|297843834|ref|XP_002889798.1| glutamine-rich protein23 [Arabidopsis lyrata subsp. lyrata]
 gi|297335640|gb|EFH66057.1| glutamine-rich protein23 [Arabidopsis lyrata subsp. lyrata]
          Length = 913

 Score = 47.3 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/137 (12%), Positives = 44/137 (32%), Gaps = 4/137 (2%)

Query: 57  FAQALELF-NSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
           + Q +    +   +D+A   +  IL+      + ++  ++   LV  G   +AA +  ++
Sbjct: 219 YNQIINAHCDEGNVDEALEVYRHILANAPFAPSSVTYRHLTKGLVQAGRIGDAASLLREM 278

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
            +      A             +D   +++  +   +L           N        + 
Sbjct: 279 LSKG---QAADSTVYNNLIRGYLDLGDFDKAIEFFDELKSKCTVYDGIVNATFMEHWFEK 335

Query: 176 GKVQKAKTIFEELAKDN 192
           G  ++A   +  L    
Sbjct: 336 GNDKEAMESYRSLLDKK 352



 Score = 41.5 bits (95), Expect = 0.074,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 44/126 (34%), Gaps = 2/126 (1%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
           ++ + +  ++ S F+    Q N + N +S   I +    +G+   A E++  +  +    
Sbjct: 190 MYRAKRYSESISLFQYFFKQSNIVPNVVSYNQIINAHCDEGNVDEALEVYRHILANAPFA 249

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
                         LV      + + +L+++              L    L  G   KA 
Sbjct: 250 P--SSVTYRHLTKGLVQAGRIGDAASLLREMLSKGQAADSTVYNNLIRGYLDLGDFDKAI 307

Query: 183 TIFEEL 188
             F+EL
Sbjct: 308 EFFDEL 313


>gi|91203625|emb|CAJ71278.1| putative tpr repeat protein [Candidatus Kuenenia stuttgartiensis]
          Length = 647

 Score = 47.3 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/168 (14%), Positives = 48/168 (28%), Gaps = 14/168 (8%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
            ++ ++     K     E   QA+        +    +   +    +K    L       
Sbjct: 435 GYFYYNNGLIDKAIQAFEGSIQAMPTHPKAHSN--LGAAYSLKGMQDKAIEELQFAVRLR 492

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYA--------ATLQAASILVDTSSYEEISKI 149
               +           K   D      V           A     S+ +DT  YEE    
Sbjct: 493 EQYPEAHNNLGLLYKRKGMPDMAINEYVAALKTNPYYADAHNNLGSVYIDTGRYEEALSE 552

Query: 150 LQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFG 197
           L+K  +  +     A+  + +   K G+V+ A   + +L +      G
Sbjct: 553 LEKALKIRSNF-ALAHYNMAVIYFKKGQVEDA---YNKLLEAYKLDPG 596


>gi|242279006|ref|YP_002991135.1| hypothetical protein Desal_1534 [Desulfovibrio salexigens DSM 2638]
 gi|242121900|gb|ACS79596.1| conserved hypothetical protein [Desulfovibrio salexigens DSM 2638]
          Length = 216

 Score = 47.3 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 59/179 (32%), Gaps = 5/179 (2%)

Query: 14  CKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDAR 73
                     +    +  I+ +A     F   +++K           L  ++  K  +  
Sbjct: 25  ILDYIIKNGKMIAAGVAAIILIAGGVSGFKYMNQQKLIKAQSEMGTILIKYSGAKQAEEL 84

Query: 74  SSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQA 133
           S+FEK          P   + +A   +  G   +A  ++  +A        V      + 
Sbjct: 85  SAFEK---DVPASMKPAVQLALAKAWMDAGSYADAKAVWAAIAKTSPEMAPVAALGQAK- 140

Query: 134 ASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDN 192
             ++++  + E ++ + +             N +LG +A K G  Q A   ++ L   +
Sbjct: 141 -CLMLENKAGEAVTVLQKMKESAGASYASSINRLLGEAAEKAGNAQVAIQAYQALLTSS 198


>gi|260063477|ref|YP_003196557.1| hypothetical protein RB2501_01675 [Robiginitalea biformata
           HTCC2501]
 gi|88782921|gb|EAR14095.1| hypothetical protein RB2501_01675 [Robiginitalea biformata
           HTCC2501]
          Length = 255

 Score = 47.3 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/169 (10%), Positives = 49/169 (28%), Gaps = 24/169 (14%)

Query: 23  WIAPLLILMILSLAIWFYLFDGSHEKKKNIVG-ENFAQALELFNSNKLDDARSSFEKILS 81
           +I  ++ ++ + +  +        + ++     E F        + + D A  S   +  
Sbjct: 51  YILGVIGVIAVGVLGYLGYQQFIQQPREEAASNELFYPLQYFRQAQQTDTAADSLYTLAL 110

Query: 82  QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTS 141
                   L +                         D+ +       A   A    +   
Sbjct: 111 NGADGKYGLVD-----------------------IIDEYSGTEAANLARYAAGVSYLQLD 147

Query: 142 SYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
            YE+    L+  +     +   +   +G + L+ G+  +A + +E+   
Sbjct: 148 QYEQAISYLEGYTSEDAILGAVSLGSIGDAFLELGQSGEALSYYEKALA 196


>gi|312130767|ref|YP_003998107.1| hypothetical protein Lbys_2058 [Leadbetterella byssophila DSM
           17132]
 gi|311907313|gb|ADQ17754.1| Protein of unknown function DUF2133 [Leadbetterella byssophila DSM
           17132]
          Length = 232

 Score = 47.3 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/184 (10%), Positives = 53/184 (28%), Gaps = 6/184 (3%)

Query: 13  KCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDA 72
           K +      +       + IL++   F  ++  ++ ++         A+  F ++    A
Sbjct: 24  KVENFFEKNQKGMIAAGVAILAVVGGFLGYNYWNKNQEKEAQAALYDAVYSFEADSTAQA 83

Query: 73  RSSFEKILS--QDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD--LAPLAVRYA 128
                           Y+      +A++       K           D        ++  
Sbjct: 84  LKGQGGNEGLLSVADNYSTTKAGNLANLYAGIALMKEGKYTEAIERLDKFSANDDVLQPR 143

Query: 129 ATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF--ANEILGISALKFGKVQKAKTIFE 186
           A        ++    E+  K  +K ++     +        L ++  +  K  +A  ++ 
Sbjct: 144 AYTLIGDSYLELGKAEDAIKYYKKAADYKPNKYATPGYMMKLALAYQEAKKTSEAVQVYS 203

Query: 187 ELAK 190
            L +
Sbjct: 204 SLIE 207


>gi|145628132|ref|ZP_01783933.1| cytochrome C-type biogenesis protein [Haemophilus influenzae
           22.1-21]
 gi|144979907|gb|EDJ89566.1| cytochrome C-type biogenesis protein [Haemophilus influenzae
           22.1-21]
          Length = 385

 Score = 47.3 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/205 (10%), Positives = 62/205 (30%), Gaps = 3/205 (1%)

Query: 2   ESNNDANSYKGKCKMG-KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ES++D    + K     K  +K    +  L++     +++  D     ++          
Sbjct: 168 ESHSDPKQKEQKTYFFGKSNHKLSFVIFFLLMAIPTAYYFSLDRFSRVQQGEQSMIEQHN 227

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
             +  +++  +     +          N  + + +    V   +  +A   +        
Sbjct: 228 QNVEMNDEHKNENVIEKLQNKLRTDPNNAETWLQLGEAYVQNNEFDSALVAYSNAEKLSG 287

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           +   +   A            + +   + L   +   +     +  +L   AL+  + Q+
Sbjct: 288 SKPNILGLAATALYYQAGQQMTPK--VEQLLNEALAKDKNEVSSLSLLATIALENRQYQQ 345

Query: 181 AKTIFEELAKDNNSPFGISTRSQMI 205
           A    ++L    N+     +  Q +
Sbjct: 346 AGMYLQQLLDSGNTAVDRRSVIQRM 370


>gi|56751313|ref|YP_172014.1| hypothetical protein syc1304_c [Synechococcus elongatus PCC 6301]
 gi|56686272|dbj|BAD79494.1| hypothetical protein [Synechococcus elongatus PCC 6301]
          Length = 923

 Score = 47.3 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/149 (12%), Positives = 44/149 (29%), Gaps = 7/149 (4%)

Query: 51  NIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAE 110
                ++ QA+  + + + + A +  +++L         L    +          +    
Sbjct: 5   AAAQHDYQQAIAAYQAGEFEAAIAQLDRLLGDVPDWAAALGLQGL--CYYCCDQRETGIT 62

Query: 111 IFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGI 170
           +  +    D               ++L       E  + L +     +P H  A     I
Sbjct: 63  LLRRAIALDPTDPTHFN----NLGNLLQRQGHLTEALERLTQALAI-DPTHVAARFNRAI 117

Query: 171 SALKFGKVQKAKTIFEELAKDNNSPFGIS 199
           +  K G    A   +++L + +     I 
Sbjct: 118 TLQKLGDPATALQDYQQLLEADPDNPEIR 146


>gi|228474051|ref|ZP_04058792.1| TPR repeat protein [Capnocytophaga gingivalis ATCC 33624]
 gi|228274565|gb|EEK13406.1| TPR repeat protein [Capnocytophaga gingivalis ATCC 33624]
          Length = 996

 Score = 47.3 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/176 (15%), Positives = 66/176 (37%), Gaps = 5/176 (2%)

Query: 35  LAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLY-NPLSNM 93
            A W             I    F  A  L+  NK  +A+ + EK L    K      +  
Sbjct: 700 YAAWAKALGYVKVSDSEIDSAAFDAAERLYVQNKKQEAKVALEKYLKDYPKGTGASQAEF 759

Query: 94  YIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKL 153
           Y+A I   +     A  ++ KV        + +    ++ ++I ++    +++  +L+++
Sbjct: 760 YLAQIYFDENQKDKALPLYEKVLAQGRNEYSEQVL--VRLSNIYLEKEDTDKVLPLLEEI 817

Query: 154 SEPSNPMHQFA--NEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
            + S+           L  +  K  +  KA    +++  +  +   +   +++I+A
Sbjct: 818 EKTSSVAQNLIFARSNLMKAFYKKKEHAKAIVYAKKILAEKGADNRLKNDARVIMA 873



 Score = 38.8 bits (88), Expect = 0.50,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 44/156 (28%), Gaps = 3/156 (1%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
                    + K+      +      ++++    A   F+++  +     N   + Y A 
Sbjct: 158 AQQYLSQVKDSKEYGKKAAYYLGYIAYDADDYQQANQFFQQVEQEKELSKN--LSYYQAD 215

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
           +   +G+ + A E  L        P                +   Y +    L+     +
Sbjct: 216 MNFKQGNFQKALEEGLHQLEKTNNPQYRSEI-NKIIGESYFNLKQYTKAIPYLEAYKGKN 274

Query: 158 NPMHQFANEILGISALKFGKVQKAKTIFEELAKDNN 193
                     LG +  + G  QKA   F  +    N
Sbjct: 275 GTYTDTDLYYLGFAYYQQGDYQKAIGQFNRIINGKN 310


>gi|78213860|ref|YP_382639.1| hypothetical protein Syncc9605_2352 [Synechococcus sp. CC9605]
 gi|78198319|gb|ABB36084.1| hypothetical protein Syncc9605_2352 [Synechococcus sp. CC9605]
          Length = 400

 Score = 47.3 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 56/176 (31%), Gaps = 7/176 (3%)

Query: 43  DGSHEKKKNIVGENFAQALE---LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASIL 99
                  +   G+ +A A     L +  K D A    +  L Q  K       + +   L
Sbjct: 187 QAMEADLQERPGDPYASAKLGGLLISEGKTDQAIPLLQSGLKQCGKADAERYELLLHLGL 246

Query: 100 VAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNP 159
                    A    + A +      V   A L  A+ L++  + EE   + Q  +    P
Sbjct: 247 ALAPSDPVQAVSCYRQALEIPLDTRVSLGARLNLAARLMEQGNLEEAISLTQT-AAQRAP 305

Query: 160 MHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTR---SQMILANIIAS 212
               A   LG+   + G +  A   +      + +          +Q++  NI A+
Sbjct: 306 EVALAWYNLGLMQRRRGDLAAALEAYGRALALDPNNAECHQNNAVAQLLGGNIDAA 361


>gi|145638244|ref|ZP_01793854.1| cytochrome C-type biogenesis protein [Haemophilus influenzae
           PittII]
 gi|145272573|gb|EDK12480.1| cytochrome C-type biogenesis protein [Haemophilus influenzae
           PittII]
 gi|309751399|gb|ADO81383.1| Putative cytochrome C-type biogenesis protein [Haemophilus
           influenzae R2866]
          Length = 385

 Score = 47.3 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/205 (10%), Positives = 62/205 (30%), Gaps = 3/205 (1%)

Query: 2   ESNNDANSYKGKCKMG-KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ES++D    + K     K  +K    +  L++     +++  D     ++          
Sbjct: 168 ESHSDPKQKEQKTYFFGKSNHKLSFVIFFLLMAIPTAYYFSLDRFSRVQQGEQSMIEQHN 227

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
             +  +++  +     +          N  + + +    V   +  +A   +        
Sbjct: 228 QNVEMNDEHKNENVIEKLQNKLRTDPNNAETWLQLGEAYVQNNEFDSALVAYSNAEKLSG 287

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           +   +   A            + +   + L   +   +     +  +L   AL+  + Q+
Sbjct: 288 SKPNILGLAATALYYQAGQQMTPK--VEQLLNEALAKDKNEVSSLSLLATIALENRQYQQ 345

Query: 181 AKTIFEELAKDNNSPFGISTRSQMI 205
           A    ++L    N+     +  Q +
Sbjct: 346 AGMYLQQLLDSGNAAVDRRSVIQRM 370


>gi|58040396|ref|YP_192360.1| hypothetical protein GOX1968 [Gluconobacter oxydans 621H]
 gi|58002810|gb|AAW61704.1| Hypothetical protein GOX1968 [Gluconobacter oxydans 621H]
          Length = 106

 Score = 47.3 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 43/102 (42%), Gaps = 4/102 (3%)

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
           A+D+ A  A+R  A   + +    T+  + +    + L++        A E L    L+ 
Sbjct: 5   ADDNAADPALRDMARYMSLNARTATADPKTLRPGYEALAQGGGAWAPLAQEGLAALDLRP 64

Query: 176 G----KVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASD 213
           G    + ++A+ I  ++    N+  G+  R+Q +L     + 
Sbjct: 65  GATADQQKEARRILTQIVGSENATEGVRARAQALLETFGDAG 106


>gi|218779809|ref|YP_002431127.1| hypothetical protein Dalk_1963 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218761193|gb|ACL03659.1| TPR repeat-containing protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 233

 Score = 46.9 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/194 (12%), Positives = 61/194 (31%), Gaps = 9/194 (4%)

Query: 23  WIAPLLILMILSLAIWFYLFDGSHEKKKN----IVGENFAQALELFNSNKLDDA--RSSF 76
           + A +++ +++ +   + +F    E K +         +A  +   +  K         F
Sbjct: 38  YTAGVIVALLVVIISGWTVFSARTESKASTMFSAAQAKYAGIMTTSSDVKQAAVAVNEDF 97

Query: 77  EKILSQDNKLYNP-LSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAAS 135
           + +  + +      L+ + +       G+   A E + K              A L    
Sbjct: 98  KNVAQEYSGTDAGKLATLMVGQTAYDAGNYDEAIEWWNKSLKALSGDPIESSRALLGLGY 157

Query: 136 ILVDTSSYEEISKILQKLSE-PSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
               T+ Y++  ++  K+         + A   +       G   K+   +E+ A D   
Sbjct: 158 AYEQTADYDKALEMYNKVLGVKMGLGKEEAALAVARIYEVKGDADKSVQAYEKFAAD-YP 216

Query: 195 PFGISTRSQMILAN 208
               +   +  LA 
Sbjct: 217 GSAYAQMVKEKLAA 230


>gi|228470581|ref|ZP_04055438.1| TPR domain protein [Porphyromonas uenonis 60-3]
 gi|228307708|gb|EEK16684.1| TPR domain protein [Porphyromonas uenonis 60-3]
          Length = 229

 Score = 46.9 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/211 (13%), Positives = 62/211 (29%), Gaps = 15/211 (7%)

Query: 7   ANSYKGKCKMGKCCY-KWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFN 65
           +     + +     Y K I   ++ +I+     +   D   + + +        A E F 
Sbjct: 14  SEEIVSRSERFIEKYSKTIIWCVLGVIVLGVGIWLYIDKVVKPRGDKAAAELYLAEEQFM 73

Query: 66  SNKLDDA--------RSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVAN 117
           +     A                   +     L++ Y   I   +G  + A     +   
Sbjct: 74  AGADSAALNAPAAGAMGLLAIADKYSSTDAGKLAHAYAGIIYYDEGKYEEAIRELKEFKA 133

Query: 118 DDLAPLAVRYAATLQAASILVDTSSYEEISKILQ--KLSEPSNPMHQFANEILGISALKF 175
                  V  + T       V+   Y+E +K       +  +  +        G    + 
Sbjct: 134 K---EKMVAPSITRLIGDCYVELGKYDEAAKYFMDAAKAADNPVISPSCLIKAGHVYEEL 190

Query: 176 GKVQKAKTIFEELAKDNN-SPFGISTRSQMI 205
           G+  KA   ++E+ +    +P   S  + +I
Sbjct: 191 GQYDKALKAYKEIQEKYYTAPESESIEASII 221


>gi|319897575|ref|YP_004135772.1| cytochrome c-type biogenesis protein [Haemophilus influenzae F3031]
 gi|317433081|emb|CBY81455.1| Cytochrome C-type biogenesis protein [Haemophilus influenzae F3031]
          Length = 385

 Score = 46.9 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/205 (10%), Positives = 62/205 (30%), Gaps = 3/205 (1%)

Query: 2   ESNNDANSYKGKCKMG-KCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQA 60
           ES++D    + K     K  +K    +  L++     +++  D     ++          
Sbjct: 168 ESHSDPKQKEQKTYFFGKSNHKLSFVIFFLLMAIPTAYYFSLDRFSRVQQGEQSMIEQHN 227

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
             +  +++  +     +          N  + + +    V   +  +A   +        
Sbjct: 228 QNVEMNDEHKNENVIEKLQNKLRTDPNNAETWLQLGEAYVQNNEFDSALVAYSNAEKLSG 287

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
           +   +   A            +  +  + L   +   +     +  +L   AL+  + Q+
Sbjct: 288 SKPNILGLAATALYYQAGQQMT--QKVEQLLNEALAKDKNEVSSLSLLATIALENRQYQQ 345

Query: 181 AKTIFEELAKDNNSPFGISTRSQMI 205
           A    ++L    N+     +  Q +
Sbjct: 346 ASAYLQQLLDSGNAAVDRRSVIQRM 370


>gi|193215137|ref|YP_001996336.1| tetratricopeptide domain-containing protein [Chloroherpeton
           thalassium ATCC 35110]
 gi|193088614|gb|ACF13889.1| Tetratricopeptide TPR_2 repeat protein [Chloroherpeton thalassium
           ATCC 35110]
          Length = 640

 Score = 46.9 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/167 (13%), Positives = 51/167 (30%), Gaps = 5/167 (2%)

Query: 24  IAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQD 83
           I  +L+L I   ++     +   + K                  K   +++  E   + +
Sbjct: 72  IVFILLLFISVGSLSAKSRNHQQQSKDRERESMLHFVNGALFEAKQQYSQAILEYEDALE 131

Query: 84  NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSY 143
                P     IA       +  +A     K    D                +  DT  +
Sbjct: 132 YSPKEPAIFFSIAKAYKNLDNQASAITYAKKATELDSTNKWYSDL----LGQLYFDTREF 187

Query: 144 EEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
           E+ ++   +++   +P    A  +L  S     + QKA  ++ ++  
Sbjct: 188 EKAAEQYLRITNK-DPNDISALYMLANSYNAANQAQKAIEVYNKIID 233



 Score = 36.1 bits (81), Expect = 3.5,   Method: Composition-based stats.
 Identities = 17/148 (11%), Positives = 43/148 (29%), Gaps = 5/148 (3%)

Query: 55  ENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLK 114
           + F+     ++  K      +  +   + +     + N    ++       +   ++   
Sbjct: 491 QAFSTLGIAYDRLKRYKESINSYEEAIKLDPNNALVLNNLAYTLAERGEQLERCLDMARI 550

Query: 115 VANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALK 174
              ++    A           I      YEE  K+  + +           E LG   LK
Sbjct: 551 AVENEPDNGAYLD----TMGWIYFKMGKYEEA-KVWIEKAVTLGRAGAVVQEHLGDVYLK 605

Query: 175 FGKVQKAKTIFEELAKDNNSPFGISTRS 202
            G  +KA   + +  + +     +  + 
Sbjct: 606 LGNKEKAMEYWTKALEQDRQSISLQQKV 633


>gi|92117696|ref|YP_577425.1| tetratricopeptide TPR_2 [Nitrobacter hamburgensis X14]
 gi|91800590|gb|ABE62965.1| Tetratricopeptide TPR_2 [Nitrobacter hamburgensis X14]
          Length = 446

 Score = 46.5 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 32/80 (40%), Gaps = 1/80 (1%)

Query: 131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
            + A   V    YE     L+++    NP        LG+   K G  + A++ F+E  K
Sbjct: 60  FKFAEQAVKRGDYEAAIGALERML-FFNPNLPRVKLELGVLYFKLGSYELARSYFQEAIK 118

Query: 191 DNNSPFGISTRSQMILANII 210
             ++P  I  + +  L  I 
Sbjct: 119 AADAPDDIRAQVRAYLTEID 138


>gi|330995528|ref|ZP_08319431.1| tetratricopeptide repeat protein [Paraprevotella xylaniphila YIT
           11841]
 gi|332882414|ref|ZP_08450042.1| tetratricopeptide repeat protein [Capnocytophaga sp. oral taxon 329
           str. F0087]
 gi|329575308|gb|EGG56853.1| tetratricopeptide repeat protein [Paraprevotella xylaniphila YIT
           11841]
 gi|332679798|gb|EGJ52767.1| tetratricopeptide repeat protein [Capnocytophaga sp. oral taxon 329
           str. F0087]
          Length = 225

 Score = 46.5 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/185 (12%), Positives = 50/185 (27%), Gaps = 17/185 (9%)

Query: 17  GKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNI-------------VGENFAQALEL 63
               YK     + + I+ L   ++L+     + +                 +N+ +AL  
Sbjct: 23  FIDKYKKPIMYVFIAIVVLVGGYFLYRSFVSEPREAKANELMFKGQQYFASDNYEKAL-- 80

Query: 64  FNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPL 123
             +          +      +     L+ +Y        G  + A        N   A +
Sbjct: 81  --NGDGQGFPGFLKIANDYGSTKAGNLAQLYAGLSYAKLGKYQEAVTRLEDFKNCGDAMV 138

Query: 124 AVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKT 183
           +      L      +D       + +       +N +        G      GK  KA  
Sbjct: 139 SPAAIGALGNCYAELDQLDKATSTLLEAAKKADNNSLSPLYLIQAGEIFESQGKKDKALE 198

Query: 184 IFEEL 188
            ++E+
Sbjct: 199 CYKEI 203


>gi|108762653|ref|YP_631287.1| social gliding motility protein Tgl [Myxococcus xanthus DK 1622]
 gi|108466533|gb|ABF91718.1| social gliding motility protein Tgl [Myxococcus xanthus DK 1622]
          Length = 253

 Score = 46.5 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 51/144 (35%), Gaps = 6/144 (4%)

Query: 47  EKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           EK+K     ++  AL+   + +L DA    +  L  D    +  + M I   L  +   +
Sbjct: 26  EKEKRSAEIHYDLALQAQQAGELQDALRELQVSLKNDPDYPDANNAMGILLHLAFRRPDE 85

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQK-LSEPSNPMHQFAN 165
                   +             A    A++ +D   Y++  K+ +  L++   P    A 
Sbjct: 86  AVKHYTKALEVRPDFSE-----ARTNLANVHLDQGRYDDAIKLYELVLNDMLYPTPFIAQ 140

Query: 166 EILGISALKFGKVQKAKTIFEELA 189
             LG +  K G+  +A    +   
Sbjct: 141 GNLGWAYYKKGEPDRAVESIKAAV 164



 Score = 35.0 bits (78), Expect = 7.6,   Method: Composition-based stats.
 Identities = 13/96 (13%), Positives = 25/96 (26%), Gaps = 1/96 (1%)

Query: 96  ASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSE 155
             + +         +   ++            A       + +     +E  K   K  E
Sbjct: 36  YDLALQAQQAGELQDALRELQVSLKNDPDYPDANNAMGILLHLAFRRPDEAVKHYTKALE 95

Query: 156 PSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
              P    A   L    L  G+   A  ++E +  D
Sbjct: 96  VR-PDFSEARTNLANVHLDQGRYDDAIKLYELVLND 130


>gi|116749963|ref|YP_846650.1| TPR repeat-containing serine/threonin protein kinase
           [Syntrophobacter fumaroxidans MPOB]
 gi|116699027|gb|ABK18215.1| serine/threonine protein kinase with TPR repeats [Syntrophobacter
           fumaroxidans MPOB]
          Length = 850

 Score = 46.5 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/169 (12%), Positives = 46/169 (27%), Gaps = 12/169 (7%)

Query: 48  KKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKN 107
           ++     +      +    +    A+   E  +  D   ++ +  +     L        
Sbjct: 687 EQAGQSADALVLEAKDQMQSDPARAQKLLEDAVGMDPNHFDAIFQLARLLTLKKDYAAAA 746

Query: 108 AAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEI 167
              +     N   A +            I ++   Y++     +     S          
Sbjct: 747 QYYLAALRINQKSAEVF------FNLGYIYLNQGDYDQAQANYESCLALSPAYKDEILTN 800

Query: 168 LGISALKFGKVQKAKTIFEELAKDNNSPFGISTR-SQMILANIIASDQR 215
           LGI  LK     +A+++F      N        R +Q  L N+     +
Sbjct: 801 LGIVHLKKDNPAEARSMFRRALDANP-----RNRLAQNHLNNLTKQAAK 844



 Score = 40.8 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/163 (11%), Positives = 36/163 (22%), Gaps = 2/163 (1%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
                L+++ +   F   D +   +        AQ        +     ++     +   
Sbjct: 442 VGAAALLLVVVGFVFMSRDSARPPQAAGPSAKTAQNAAPAAKTQPQKVPAAKPAPEAAPI 501

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
                        +        N       +             A L  A ++     Y 
Sbjct: 502 DGRETRMKADTLVLQARNVWQANPVGAQKILEEAIGLDPNNFE-AYLHLARLMTQKKDYA 560

Query: 145 EISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEE 187
              +  Q     +N         +G   L  G    A T +E 
Sbjct: 561 NALQHYQNALRINNR-AAEVYFNMGFIFLMQGDYDAAMTHYEA 602


>gi|296273606|ref|YP_003656237.1| tetratricopeptide repeat-containing protein [Arcobacter
           nitrofigilis DSM 7299]
 gi|296097780|gb|ADG93730.1| Tetratricopeptide TPR_2 repeat protein [Arcobacter nitrofigilis DSM
           7299]
          Length = 483

 Score = 46.5 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 49/143 (34%), Gaps = 5/143 (3%)

Query: 63  LFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAP 122
             +      +    E+I   + KL     +      L  +   + A   F K        
Sbjct: 334 EQSKENYMISPEDCEQIKMPETKLEQAAPHFEKGIDLFNENKKEEAIIYFKKALEIQS-- 391

Query: 123 LAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
                 AT   A  L D   Y+E  +IL  + + ++     + E LG    K G  +KA+
Sbjct: 392 --DYLPATFNMAIALGDLGRYDEAEEILYNVIK-NDASILQSYESLGFIYYKKGDFKKAE 448

Query: 183 TIFEELAKDNNSPFGISTRSQMI 205
             F+++ + +          +++
Sbjct: 449 KNFKKILELDPDNKKAKNSLEIL 471


>gi|196228972|ref|ZP_03127838.1| TPR repeat-containing protein [Chthoniobacter flavus Ellin428]
 gi|196227253|gb|EDY21757.1| TPR repeat-containing protein [Chthoniobacter flavus Ellin428]
          Length = 555

 Score = 46.5 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/145 (13%), Positives = 42/145 (28%), Gaps = 7/145 (4%)

Query: 56  NFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKV 115
            F  AL    + +L DA +   +I++      +      +  +++  G    A ++  + 
Sbjct: 9   AFQLALGHRQAGRLPDAEALLRQIVAVQPNHTSA--WHQLGLVVLQLGRPAEAVDLIRQA 66

Query: 116 ANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKF 175
                   A+                  EE     +       P     +  LG + L  
Sbjct: 67  VALQPGNAALHS----DLGVAYRMRGDLEEAITSFRNALRLH-PGAGHTHRNLGDALLAA 121

Query: 176 GKVQKAKTIFEELAKDNNSPFGIST 200
           G+ ++A   +        +  G   
Sbjct: 122 GQSEEAIASYRSAIAAQPTDAGAHN 146


>gi|134101976|ref|YP_001107637.1| LuxR family transcriptional regulator [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291008994|ref|ZP_06566967.1| LuxR family transcriptional regulator [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133914599|emb|CAM04712.1| transcriptional regulator, LuxR family [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 943

 Score = 46.5 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/151 (11%), Positives = 40/151 (26%), Gaps = 6/151 (3%)

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRY-- 127
           D    +   +    +      +N Y+A  L  +   + A  +  +               
Sbjct: 445 DAQELAERILADTRDPATTAEANWYLARSLSGRRMDEQARTVVERAIAAPDVDSRWAARL 504

Query: 128 ---AATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTI 184
               A    +   VD +  E    +              A    G+ + + G    A   
Sbjct: 505 RGLLAATSLSLGQVDAAETEASEALAAARRVGDRIALGVAMHATGLLSARRGDPAGAAAD 564

Query: 185 FEELAKDNNSPFGISTRSQM-ILANIIASDQ 214
           F+    +  S   +  R     +  + A+ +
Sbjct: 565 FDLALTELGSDPDMRLRVSADRIMALSAAGK 595


>gi|85716150|ref|ZP_01047125.1| hypothetical protein NB311A_05590 [Nitrobacter sp. Nb-311A]
 gi|85696983|gb|EAQ34866.1| hypothetical protein NB311A_05590 [Nitrobacter sp. Nb-311A]
          Length = 447

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 32/80 (40%), Gaps = 1/80 (1%)

Query: 131 LQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAK 190
            + A   V    YE     L+++    NP        LG+   K G  + A++ F+E  K
Sbjct: 61  FKFAEQAVKRGDYEAAIGALERML-FFNPNLPRVKLELGVLYFKLGSYELARSYFQEAIK 119

Query: 191 DNNSPFGISTRSQMILANII 210
             ++P  I  + +  L  I 
Sbjct: 120 AADAPDDIRAQVRAYLTEID 139


>gi|1143443|emb|CAA63368.1| penicillin-binding protein 5 [Enterococcus faecium]
          Length = 678

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 62

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 63  KAAEMTSKKAANKSALSEKEILDKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKM 122

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 123 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|293559703|ref|ZP_06676231.1| low affinity penicillin-binding protein 5 [Enterococcus faecium
           E1162]
 gi|314938621|ref|ZP_07845901.1| penicillin binding protein transpeptidase domain protein
           [Enterococcus faecium TX0133a04]
 gi|314944063|ref|ZP_07850727.1| penicillin binding protein transpeptidase domain protein
           [Enterococcus faecium TX0133C]
 gi|314950301|ref|ZP_07853583.1| penicillin binding protein transpeptidase domain protein
           [Enterococcus faecium TX0082]
 gi|314992339|ref|ZP_07857773.1| penicillin binding protein transpeptidase domain protein
           [Enterococcus faecium TX0133B]
 gi|314996877|ref|ZP_07861881.1| penicillin binding protein transpeptidase domain protein
           [Enterococcus faecium TX0133a01]
 gi|291606378|gb|EFF35784.1| low affinity penicillin-binding protein 5 [Enterococcus faecium
           E1162]
 gi|313588984|gb|EFR67829.1| penicillin binding protein transpeptidase domain protein
           [Enterococcus faecium TX0133a01]
 gi|313593155|gb|EFR72000.1| penicillin binding protein transpeptidase domain protein
           [Enterococcus faecium TX0133B]
 gi|313597338|gb|EFR76183.1| penicillin binding protein transpeptidase domain protein
           [Enterococcus faecium TX0133C]
 gi|313642009|gb|EFS06589.1| penicillin binding protein transpeptidase domain protein
           [Enterococcus faecium TX0133a04]
 gi|313643365|gb|EFS07945.1| penicillin binding protein transpeptidase domain protein
           [Enterococcus faecium TX0082]
          Length = 678

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 62

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 63  KAAEMTSKKAANKSALSEKEILDKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKM 122

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 123 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|790433|emb|CAA59289.1| low affinity penicillin-binding protein 5 (PBP5) [Enterococcus
           faecium]
          Length = 674

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 1   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 57

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 58  KAAEMTSKKAANKSALSEKEILDKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKM 117

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 118 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 168


>gi|294619993|ref|ZP_06699358.1| low affinity penicillin-binding protein 5 [Enterococcus faecium
           E1679]
 gi|291593715|gb|EFF25224.1| low affinity penicillin-binding protein 5 [Enterococcus faecium
           E1679]
          Length = 678

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 62

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 63  KAAEMTSKKAANKSALSEKEILDKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKM 122

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 123 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|257880895|ref|ZP_05660548.1| penicillin-binding protein PbP5 [Enterococcus faecium 1,231,502]
 gi|294622435|ref|ZP_06701459.1| low affinity penicillin-binding protein 5 [Enterococcus faecium
           U0317]
 gi|257816553|gb|EEV43881.1| penicillin-binding protein PbP5 [Enterococcus faecium 1,231,502]
 gi|291598079|gb|EFF29187.1| low affinity penicillin-binding protein 5 [Enterococcus faecium
           U0317]
          Length = 679

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 62

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 63  KAAEMTSKKAANKSALSEKEILDKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKM 122

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 123 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|319900345|ref|YP_004160073.1| Tetratricopeptide TPR_1 repeat-containing protein [Bacteroides
           helcogenes P 36-108]
 gi|319415376|gb|ADV42487.1| Tetratricopeptide TPR_1 repeat-containing protein [Bacteroides
           helcogenes P 36-108]
          Length = 617

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 48/159 (30%), Gaps = 4/159 (2%)

Query: 47  EKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           + KK +V + +A   + +++ K +    +        N       N Y   + V + D  
Sbjct: 451 DSKKEVVSDFYAFIGDSYHTKKQNKEAYAAYDSALVYNPSNIGALNNYAYYLSVERRDLD 510

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANE 166
            A E+  K    +              A IL +  +Y E    +    +          E
Sbjct: 511 RAEEMSYKTVKAEPGNSTYLD----TYAWILFEKENYAEARLYIDDAMKSDGAKSDVIVE 566

Query: 167 ILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
             G      G V  A   +++  +  +    +  +    
Sbjct: 567 HCGDIYYMTGDVDGALKYWKQALEMGSKSNTLKQKIAKK 605


>gi|257892583|ref|ZP_05672236.1| penicillin-binding protein PbP5 [Enterococcus faecium 1,231,408]
 gi|257828962|gb|EEV55569.1| penicillin-binding protein PbP5 [Enterococcus faecium 1,231,408]
          Length = 679

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 62

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 63  KAAEMTSKKAANKSALSEKEILDKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKM 122

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 123 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|257889475|ref|ZP_05669128.1| penicillin-binding protein PbP5 [Enterococcus faecium 1,231,410]
 gi|257825835|gb|EEV52461.1| penicillin-binding protein PbP5 [Enterococcus faecium 1,231,410]
          Length = 679

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 62

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 63  KAAEMTSKKAANKSALSEKEILDKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKM 122

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 123 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|4633282|gb|AAD26697.1|AF117609_3 low affinity penicillin-binding protein PbP5 [Enterococcus faecium]
          Length = 679

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 62

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 63  KAAEMTSKKAANKSALSEKEILDKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKM 122

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 123 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|69246521|ref|ZP_00603984.1| Penicillin-binding protein, transpeptidase:Penicillin-binding
           protein, dimerisation domain:NTF2-like N-terminal
           transpeptidase [Enterococcus faecium DO]
 gi|258616153|ref|ZP_05713923.1| penicillin-binding protein 4 [Enterococcus faecium DO]
 gi|68195251|gb|EAN09705.1| Penicillin-binding protein, transpeptidase:Penicillin-binding
           protein, dimerisation domain:NTF2-like N-terminal
           transpeptidase [Enterococcus faecium DO]
          Length = 678

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 62

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 63  KAAEMTSKKAANKSALSEKEILDKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKM 122

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 123 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|790437|emb|CAA59288.1| low affinity penicillin-binding protein 5 (PBP5) [Enterococcus
           faecium]
          Length = 673

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 1   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 57

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 58  KAAEMTSKKAANKSALSEKEILDKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKM 117

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 118 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 168


>gi|260559911|ref|ZP_05832090.1| penicillin-binding protein PbP5 [Enterococcus faecium C68]
 gi|260074135|gb|EEW62458.1| penicillin-binding protein PbP5 [Enterococcus faecium C68]
          Length = 679

 Score = 46.5 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 62

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 63  KAAEMTSKKAANKSALSEKEILDKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKM 122

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 123 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|257878325|ref|ZP_05657978.1| penicillin-binding protein [Enterococcus faecium 1,230,933]
 gi|257812553|gb|EEV41311.1| penicillin-binding protein [Enterococcus faecium 1,230,933]
          Length = 678

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 62

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 63  KAAEMTSKKAANKSALSEKEILDKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKM 122

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 123 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|261416533|ref|YP_003250216.1| hypothetical protein Fisuc_2147 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261372989|gb|ACX75734.1| hypothetical protein Fisuc_2147 [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 228

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 77/228 (33%), Gaps = 21/228 (9%)

Query: 3   SNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALE 62
             N++N+ + + K     +     +  +++ ++      +  + +       E     L 
Sbjct: 1   MANESNNNQSELKAFFVQHGTKIAVAFVILFAIIAGIVQYKEARKVAAAEQSELIGMGLT 60

Query: 63  LFNSNKLDDARSSFEKILSQD--NKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
              + + D A   FE  ++      L    +++  A+I   K D   AA +F    ++  
Sbjct: 61  YLYAGEKDSALVEFENKIASGKLEGLALAKASLLAANIKYEKRDYDGAALLFQNSLDNAG 120

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSN-------------------PMH 161
           +   VR AA    A++ ++   +   +  L+K                         PM 
Sbjct: 121 SVALVRSAAMHGLAAVKMEKGDFSAAANFLEKYIAEFGKRTGDKEDRYQKDEPADEVPMV 180

Query: 162 QFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANI 209
             A   L +   + G   KAK   E L          + +++  LA +
Sbjct: 181 ADAMWKLTLVYQQLGASDKAKATAERLLHIYGDNRAFADKARKFLAAL 228


>gi|193213294|ref|YP_001999247.1| hypothetical protein Cpar_1652 [Chlorobaculum parvum NCIB 8327]
 gi|193086771|gb|ACF12047.1| conserved hypothetical protein [Chlorobaculum parvum NCIB 8327]
          Length = 229

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/177 (9%), Positives = 46/177 (25%), Gaps = 6/177 (3%)

Query: 21  YKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQAL------ELFNSNKLDDARS 74
           +K    +L+ +IL  A   + +       +       ++ +                  S
Sbjct: 26  HKNKIIILVSVILLAAGGSFYWLQKSRVDEQQASAALSKLIPAIEVASETGDTDNAKLVS 85

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
           + + I+ +     +        + L       + A    +    D   L     A   A 
Sbjct: 86  NMQTIIKRWGYTPSGNKTRLYLATLWYNNGKTSEALALYEKVKSDNKDLQAAAIAGAAAC 145

Query: 135 SILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
            +     +    +      +  +  +          S +   +  +A    E++ K 
Sbjct: 146 HVQDKQFTKAATAYAKASETAENEALKAMYLNKAADSYVLDEQPAEAVKQLEKVIKS 202


>gi|790429|emb|CAA59286.1| low affinity penicillin-binding protein 5 (PBP5) [Enterococcus
           faecium]
          Length = 673

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/168 (11%), Positives = 50/168 (29%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE   +      +    +  +
Sbjct: 1   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEKTVEQFVQALNKGDYNKAA 60

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
                 + +    +    +     +    D K      LKV   D +  +  Y A +  +
Sbjct: 61  EMASKKAANKSALSEKEILEKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKMNTS 120

Query: 135 SILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 121 LGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 168


>gi|13786078|gb|AAK39559.1|AF362954_2 penicillin-binding protein 5 [Enterococcus faecium]
          Length = 678

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 6/171 (3%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE     +E F         +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEK---TVEQFVQALNKGDYN 62

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYA---ATL 131
              ++ S+     + LS   I           +   + +     D    +       A +
Sbjct: 63  KAAEMTSKKAANKSALSEKEILDKYQNIYGATDVKGLQISNLKVDKKDDSTYSFSYKAKM 122

Query: 132 QAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
             +   +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 123 NTSLGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|294615234|ref|ZP_06695115.1| low affinity penicillin-binding protein 5 [Enterococcus faecium
           E1636]
 gi|291591958|gb|EFF23586.1| low affinity penicillin-binding protein 5 [Enterococcus faecium
           E1636]
          Length = 678

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/168 (11%), Positives = 50/168 (29%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE   +      +    +  +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEKTVEQFVQALNKGDYNKAA 65

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
                 + +    +    +     +    D K      LKV   D +  +  Y A +  +
Sbjct: 66  EMASKKAANKSALSEKEILEKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKMNTS 125

Query: 135 SILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 126 LGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|326336387|ref|ZP_08202558.1| TPR-domain containing protein [Capnocytophaga sp. oral taxon 338
           str. F0234]
 gi|325691561|gb|EGD33529.1| TPR-domain containing protein [Capnocytophaga sp. oral taxon 338
           str. F0234]
          Length = 995

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 57/182 (31%), Gaps = 1/182 (0%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKL-YNPLSNMYIA 96
           W             +    F  A   +  NK  +A+ + EK L +  K      +  Y+A
Sbjct: 702 WAKSLGYVEVSDNELDNAAFEAAERQYIQNKKQEAKGALEKYLKEFPKGVNTAQARFYLA 761

Query: 97  SILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEP 156
            +       + A  ++ KV  +     + +    L    +  +            + +  
Sbjct: 762 QLYFEANQKEKALPLYEKVLEEGRNEYSEQVLVRLSNIYLEKEEIDKVIPLLKEIEKTSS 821

Query: 157 SNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRN 216
                 FA   L     +     +A    +++  + N+   +   +++I+A    +    
Sbjct: 822 VAQNLIFARSNLMKGFYRQKDYPQAIEYAKKILAEKNADNRLKNDARVIMARAYMATGAE 881

Query: 217 KK 218
           ++
Sbjct: 882 EE 883


>gi|295086300|emb|CBK67823.1| Tetratricopeptide repeat. [Bacteroides xylanisolvens XB1A]
          Length = 590

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/159 (12%), Positives = 50/159 (31%), Gaps = 4/159 (2%)

Query: 47  EKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTK 106
           + +K ++ + ++   +++++ K      +        N       N Y   + V + D  
Sbjct: 431 DTRKEVISDFYSIMGDIYHTKKQMAEAYAAYDSSLVYNPSNIGALNNYAYYLSVERHDLD 490

Query: 107 NAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANE 166
            A E+  K    +              A IL +  +Y E    +    +          E
Sbjct: 491 KAEEMSYKTVKAEPNNSTYLD----TYAWILFEKGNYAEARIYIDNAMKNDGEKSDVIVE 546

Query: 167 ILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMI 205
             G      G V+ A   +++  +  +    +  + +  
Sbjct: 547 HCGDIYFMTGDVEGALKYWKKALEMGSESKTLKQKIEKK 585


>gi|293552775|ref|ZP_06673436.1| penicillin-binding protein 3 [Enterococcus faecium E1039]
 gi|291603084|gb|EFF33275.1| penicillin-binding protein 3 [Enterococcus faecium E1039]
          Length = 678

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/168 (11%), Positives = 50/168 (29%)

Query: 15  KMGKCCYKWIAPLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARS 74
           K GK          +++I +    ++ +    E +    GE   +      +    +  +
Sbjct: 6   KHGKNRTGAYIAGAVILIAAAGGGYFYYQHYQETQAVEAGEKTVEQFVQALNKGDYNKAA 65

Query: 75  SFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAA 134
                 + +    +    +     +    D K      LKV   D +  +  Y A +  +
Sbjct: 66  EMASKKAANKSALSEKEILEKYQNIYGAADVKGLQISNLKVDKKDDSTYSFSYKAKMNTS 125

Query: 135 SILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAK 182
              +   SY+         +  +   +    E+ G   +     + A+
Sbjct: 126 LGELKDLSYKGTLDRNDGQTTINWQPNLVFPEMEGNDKVSLTTQEAAR 173


>gi|158522865|ref|YP_001530735.1| TPR repeat-containing protein [Desulfococcus oleovorans Hxd3]
 gi|158511691|gb|ABW68658.1| Tetratricopeptide TPR_2 repeat protein [Desulfococcus oleovorans
           Hxd3]
          Length = 222

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/168 (10%), Positives = 53/168 (31%), Gaps = 4/168 (2%)

Query: 25  APLLILMILSLAIWFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDN 84
              L++ +  +    +      E K + +  +     +   +   D+ R+ +E       
Sbjct: 42  IIGLVIAVAVVTGGVFYLGARAEVKASDMLASATARADAAGAGSTDEYRAVYETYPRTVA 101

Query: 85  KLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYE 144
                L     A  L   G+   A +++ K+         + + A              +
Sbjct: 102 GQIAGLRY---AEQLYRSGEAAAAVDVYTKLVKSVAGKPTLHHLALNGLGYAHEAAGDLK 158

Query: 145 EISKILQKLSEPS-NPMHQFANEILGISALKFGKVQKAKTIFEELAKD 191
             +   + ++    +   + A   L     + G+ +K++  F ++  +
Sbjct: 159 AAADCFETIAATPVSAHKETALFNLARLYEQVGETEKSQKAFAQIVSE 206


>gi|256822849|ref|YP_003146812.1| peptidase M48 Ste24p [Kangiella koreensis DSM 16069]
 gi|256796388|gb|ACV27044.1| peptidase M48 Ste24p [Kangiella koreensis DSM 16069]
          Length = 503

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 51/186 (27%), Gaps = 16/186 (8%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIAS 97
           +  L      ++ N + E +  A  L  + K  +A    + + +     +  L    +A 
Sbjct: 302 FRVLQRKHQAQQLNSIEERYLYAELLKKNGKTQEAIEVLQSLYNIYPDNH--LLLFSLAE 359

Query: 98  ILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPS 157
              A            K          +   AT Q           E++      ++  +
Sbjct: 360 THRANNSGAAVLPELQKQLEKTPGSTKLI-LATAQVYLDNKQAEDAEKLLLRYADVNRYN 418

Query: 158 NPMHQF-------------ANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQM 204
                               +E  G   L  G ++ AK  FE      +      TR Q 
Sbjct: 419 PNYLYLLAETQAQAGHTPEMHETTGQYLLLLGDLRTAKKHFELALNGTSEDPYAQTRIQA 478

Query: 205 ILANII 210
            L ++ 
Sbjct: 479 RLDDVN 484


>gi|86159982|ref|YP_466767.1| hypothetical protein Adeh_3564 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85776493|gb|ABC83330.1| conserved hypothetical protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 433

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 54/131 (41%), Gaps = 7/131 (5%)

Query: 61  LELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDL 120
            EL      D AR++ E+ L    K    L+   +      +G   +AA  + ++ +++ 
Sbjct: 23  TELLAQGDADRARAALERALELGPKDAKVLA--LLGQACYRQGQFDDAAIAWQRLVDENP 80

Query: 121 APLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQK 180
                  AA +      +    +EE  + L+ ++   NP H+ A   LG++ L+ G    
Sbjct: 81  VEP----AARVNLGLAFLKAKHHEEARRQLE-IALDLNPDHRKAMGYLGLALLESGDPAA 135

Query: 181 AKTIFEELAKD 191
           A+  F +   D
Sbjct: 136 AREWFRKAGSD 146


>gi|116624565|ref|YP_826721.1| peptidase M56, BlaR1 [Candidatus Solibacter usitatus Ellin6076]
 gi|116227727|gb|ABJ86436.1| peptidase M56, BlaR1 [Candidatus Solibacter usitatus Ellin6076]
          Length = 733

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/169 (13%), Positives = 59/169 (34%), Gaps = 16/169 (9%)

Query: 60  ALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDD 119
           A  L +   +  A +  +++L +      P+++  +    +A+GD   A     +     
Sbjct: 405 ATILLDQGNVAAAIAQLQQVLERAPDN--PVAHFDLGRAYIAQGDLMAARREIEEAIA-L 461

Query: 120 LAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQ 179
                    A  + +      ++ +E++++  +      P      + LG +A++ GK  
Sbjct: 462 RPDFTRARQALERLSPGAGGDANEDELARLQSE--SAKAPERLDLLQSLGTAAVRAGKFD 519

Query: 180 KAKTIFEELAKDNNSPFGISTRSQMIL-----------ANIIASDQRNK 217
            A   +++L      P  +     + L           A + A  +  +
Sbjct: 520 LAIYAYQKLLDRTREPSELRGELYLKLGDAYVRKGDSAAALDAMQKARE 568


>gi|292488377|ref|YP_003531259.1| hypothetical protein EAMY_1901 [Erwinia amylovora CFBP1430]
 gi|292899572|ref|YP_003538941.1| hypothetical protein EAM_1862 [Erwinia amylovora ATCC 49946]
 gi|291199420|emb|CBJ46537.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946]
 gi|291553806|emb|CBA20851.1| Uncharacterized protein yciM precursor [Erwinia amylovora CFBP1430]
 gi|312172520|emb|CBX80776.1| Uncharacterized protein yciM precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 389

 Score = 46.1 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 62/179 (34%), Gaps = 12/179 (6%)

Query: 32  ILSLAIWFYLFDGSHEKKKNIVGEN---FAQALELFNSNKLDDARSSFEKILSQDNKLYN 88
           + +   W+     + + K++        +   +    SN+ D A   F  +L +D+    
Sbjct: 11  VAAAYGWYMGRRSAQQDKQHEASRLSRDYVTGVNFLLSNQQDKAVDLFLDMLKEDSGTVE 70

Query: 89  PLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISK 148
              ++ + ++  ++G+   A  I   +   D      R  A  Q     +    Y+   +
Sbjct: 71  A--HLTLGNLFRSRGEVDRAIRIHQALMESDSLTYDQRLLAIQQLGRDYMAAGFYDRAEQ 128

Query: 149 ILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILA 207
           +  +L + ++     A + L I          A    E L K         +R +M +A
Sbjct: 129 MFGQLVDETD-FRVGALQQLLIIHQATSDWLNAIDAAERLVKLG------KSRLKMEIA 180


>gi|301060387|ref|ZP_07201250.1| tetratricopeptide repeat protein [delta proteobacterium NaphS2]
 gi|300445583|gb|EFK09485.1| tetratricopeptide repeat protein [delta proteobacterium NaphS2]
          Length = 785

 Score = 46.1 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 56/160 (35%), Gaps = 7/160 (4%)

Query: 49  KKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNA 108
            +      +  A   F + + DDA + + K L       +   +  + +  +  G+ + A
Sbjct: 517 NRENANARYNLANTFFRAGRTDDAIAQYRKALDIRPNDPS--IHYNLGNAYMRNGNFEQA 574

Query: 109 AEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEIL 168
              + +              A +   + L  + +  +     +K    S P H  A+  L
Sbjct: 575 VSQYSEALRY----QPDFVNARVNLGNALARSGNPRKAILQYEKALA-SQPDHPGAHYNL 629

Query: 169 GISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILAN 208
             +    GK QKA   ++E+ +          +  +IL+N
Sbjct: 630 AGAFAASGKTQKAVVHYKEVLRLQPEDATARFQLGLILSN 669



 Score = 41.5 bits (95), Expect = 0.075,   Method: Composition-based stats.
 Identities = 28/189 (14%), Positives = 51/189 (26%), Gaps = 19/189 (10%)

Query: 22  KWIAPLLILMILSLAIWFYLFD--GSHEKK------KNIVGENFAQ----ALELFNSNKL 69
           K I     +  L +      +      + +        +V  N+      A  L    + 
Sbjct: 376 KKILGFSGMACLIVLGGLAWWQAGYWSDSETLFRHGLQVVPNNYVAHNGLARALEAQGET 435

Query: 70  DDARSSFEKILSQDNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAA 129
           D+A   FE  L       +   N                 E   +  +   +       A
Sbjct: 436 DEAIRHFETALRICPGFTDGRYNFARILAA-----NGKKREATEQYLSVLESDPGFVQ-A 489

Query: 130 TLQAASILVDTSSYEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELA 189
            +  A+IL D     E  K  +K     N  +  A   L  +  + G+   A   + +  
Sbjct: 490 HVNLANILADQGYLNEAVKHYEKALTL-NRENANARYNLANTFFRAGRTDDAIAQYRKAL 548

Query: 190 KDNNSPFGI 198
               +   I
Sbjct: 549 DIRPNDPSI 557



 Score = 36.5 bits (82), Expect = 2.9,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 48/172 (27%), Gaps = 22/172 (12%)

Query: 38  WFYLFDGSHEKKKNIVGENFAQALE---------------LFNSNKLDDARSSFEKILSQ 82
           +                  +++AL                L  S     A   +EK L+ 
Sbjct: 559 YNLGNAYMRNGNFEQAVSQYSEALRYQPDFVNARVNLGNALARSGNPRKAILQYEKALAS 618

Query: 83  DNKLYNPLSNMYIASILVAKGDTKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSS 142
                    +  +A    A G T+ A   + +V             A  Q   IL ++  
Sbjct: 619 QPDHPGA--HYNLAGAFAASGKTQKAVVHYKEVLRLQPEDAT----ARFQLGLILSNSGR 672

Query: 143 YEEISKILQKLSEPSNPMHQFANEILGISALKFGKVQKAKTIFEELAKDNNS 194
           + E  +    ++    P    A   L       GK  +A   + E  K N +
Sbjct: 673 HSEGEEQF-SIALQIKPNFVEARIALADELAVQGKTSEAVAHYNEAMKMNPA 723


>gi|218780012|ref|YP_002431330.1| hypothetical protein Dalk_2169 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218761396|gb|ACL03862.1| Tetratricopeptide TPR_2 repeat protein [Desulfatibacillum
           alkenivorans AK-01]
          Length = 798

 Score = 45.8 bits (106), Expect = 0.004,   Method: Composition-based stats