HHsearch alignment for GI: 254780424 and conserved domain: PRK09526

>PRK09526 lacI lac repressor; Reviewed.
Probab=95.09  E-value=0.034  Score=34.22  Aligned_cols=49  Identities=12%  Similarity=0.149  Sum_probs=40.0

Q ss_pred             HCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHH---HHHHHHHHCCCCHHHH
Q ss_conf             819979999998724699999985289883589---9999997549999995
Q gi|254780424|r   25 ILGMSQEKLGECLGITFQQVQKYEKGVNRVGAS---RLQHISEVLESPISFF   73 (144)
Q Consensus        25 ~~glTQ~eLA~~lGvs~s~is~~E~G~~~ps~~---~L~~iA~~l~v~~~~l   73 (144)
T Consensus         3 ~k~~TikDIA~~agVS~sTVSrvLn~~~~vs~~tr~rV~~~a~elgY~pn~~   54 (342)
T PRK09526          3 SKPVTLYDVARYAGVSYQTVSRVLNQASHVSAKTREKVEAAMAELNYVPNRV   54 (342)
T ss_pred             CCCCCHHHHHHHHCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCHH
T ss_conf             8997699999998969999999978979999999999999999839997888