BLAST/PSIBLAST alignment of GI: 254780424 and GI: 190890041 at iteration 1
>gi|190890041|ref|YP_001976583.1| transcriptional regulator protein [Rhizobium etli CIAT 652] Length = 139
>gi|218510206|ref|ZP_03508084.1| probable transcriptional regulator protein [Rhizobium etli Brasil 5] Length = 139
>gi|218670147|ref|ZP_03519818.1| probable transcriptional regulator protein [Rhizobium etli GR56] Length = 139
>gi|190695320|gb|ACE89405.1| probable transcriptional regulator protein [Rhizobium etli CIAT 652] Length = 139
>gi|327188600|gb|EGE55810.1| putative transcriptional regulator protein [Rhizobium etli CNPAF512] Length = 139
 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 105/134 (78%), Gaps = 6/134 (4%)

Query: 1   MVGNKKIPNPVDINVGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKGVNRVGASRLQ 60
           M+ NKK PNP+DI+VG RIRLRR +LGMSQEKLGE LGITFQQ+QKYEKG NRVGASRLQ
Sbjct: 1   MIENKKKPNPIDIHVGSRIRLRRTMLGMSQEKLGESLGITFQQIQKYEKGTNRVGASRLQ 60

Query: 61  HISEVLESPISFFFDVSPTVCSDI------SSEENNVMDFISTPDGLQLNRYFIQIDDVK 114
           +IS +L  P+SFFF+ +P   S        +S  N V+DF+S+ +GLQLNR F++I D K
Sbjct: 61  NISSILNVPVSFFFEDAPGEHSGAIGGMAEASSSNYVVDFLSSSEGLQLNRAFVKISDPK 120

Query: 115 VRQKIIELVRSIVS 128
           VR+K++ELV+++ +
Sbjct: 121 VRRKVVELVKALAA 134