RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780424|ref|YP_003064837.1| transcriptional regulator protein [Candidatus Liberibacter asiaticus str. psy62] (144 letters) >gnl|CDD|28977 cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.. Length = 58 Score = 52.1 bits (125), Expect = 5e-08 Identities = 14/58 (24%), Positives = 29/58 (50%) Query: 16 GKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKGVNRVGASRLQHISEVLESPISFF 73 G+R++ R G++QE+L E LG++ + + E G L+ +++ L + Sbjct: 1 GERLKELRKEKGLTQEELAEKLGVSRSTISRIENGKRNPSLETLEKLAKALGVSLDEL 58 >gnl|CDD|144828 pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Length = 55 Score = 45.2 bits (108), Expect = 6e-06 Identities = 16/55 (29%), Positives = 27/55 (49%) Query: 19 IRLRRMILGMSQEKLGECLGITFQQVQKYEKGVNRVGASRLQHISEVLESPISFF 73 ++ R LG+SQE+L E LG++ + K E G L+ ++E L + Sbjct: 1 LKELREELGLSQEELAEKLGVSRSTISKIENGKREPSLETLKKLAEALGVSLDEL 55 >gnl|CDD|31586 COG1396, HipB, Predicted transcriptional regulators [Transcription]. Length = 120 Score = 44.6 bits (103), Expect = 9e-06 Identities = 17/94 (18%), Positives = 37/94 (39%), Gaps = 1/94 (1%) Query: 15 VGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKG-VNRVGASRLQHISEVLESPISFF 73 +G+R++ R G+SQE+L E LG++ + + E+G L ++ L + Sbjct: 2 IGERLKELRKKKGLSQEELAERLGVSRSTISRIERGRSESPSLELLARLAAALGVSLDEL 61 Query: 74 FDVSPTVCSDISSEENNVMDFISTPDGLQLNRYF 107 + + + +E ++ L Sbjct: 62 LEEEEELEIEELNELAKLLLLEEEELLAILEELI 95 >gnl|CDD|31585 COG1395, COG1395, Predicted transcriptional regulator [Transcription]. Length = 313 Score = 32.9 bits (75), Expect = 0.032 Identities = 21/73 (28%), Positives = 35/73 (47%) Query: 16 GKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKGVNRVGASRLQHISEVLESPISFFFD 75 G+++R +R +G+S L LG++ + V KYEKG++ + E+ I D Sbjct: 127 GEKLREKREEMGLSLGDLATMLGVSRKTVYKYEKGLSDASLEVALKLEEIFGEDIVKPID 186 Query: 76 VSPTVCSDISSEE 88 + DI EE Sbjct: 187 ILKIPEDDIKLEE 199 >gnl|CDD|32182 COG1999, COG1999, Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only]. Length = 207 Score = 31.9 bits (72), Expect = 0.059 Identities = 9/42 (21%), Positives = 18/42 (42%) Query: 70 ISFFFDVSPTVCSDISSEENNVMDFISTPDGLQLNRYFIQID 111 + F + P VC +E ++ + +G + FI +D Sbjct: 72 VFFGYTHCPDVCPTTLAELKALLKKLGEGEGDDVQVVFITVD 113 >gnl|CDD|31665 COG1476, COG1476, Predicted transcriptional regulators [Transcription]. Length = 68 Score = 30.6 bits (69), Expect = 0.17 Identities = 11/33 (33%), Positives = 22/33 (66%) Query: 18 RIRLRRMILGMSQEKLGECLGITFQQVQKYEKG 50 +++ R LG++QE+L + +G++ Q + EKG Sbjct: 5 KLKELRAELGLTQEELAKLVGVSRQTIIAIEKG 37 >gnl|CDD|31998 COG1813, COG1813, Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription]. Length = 165 Score = 30.3 bits (68), Expect = 0.21 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Query: 14 NVGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKG---VNRVGASRLQHISEVL 66 + G+RIR R G+SQE L L +++ E+G N A +L+ + + Sbjct: 79 DYGERIREAREKRGLSQEDLAAKLKEKVSVIRRIERGEATPNIKVAKKLEKLLGIK 134 >gnl|CDD|32767 COG2944, COG2944, Predicted transcriptional regulator [Transcription]. Length = 104 Score = 29.5 bits (66), Expect = 0.34 Identities = 14/49 (28%), Positives = 22/49 (44%) Query: 5 KKIPNPVDINVGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKGVNR 53 K V I+ R LG+SQ LG++ V+K+E+G + Sbjct: 35 KACLLKVKTLSPTEIKAIREKLGLSQPVFARYLGVSVSTVRKWEQGRKK 83 >gnl|CDD|33419 COG3620, COG3620, Predicted transcriptional regulator with C-terminal CBS domains [Transcription]. Length = 187 Score = 28.7 bits (64), Expect = 0.52 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Query: 7 IPNPVDINVGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKGVNRVGASRLQHISEVL 66 +P P D+ R RR LG++Q+ L G++ + + E G S ++ I E L Sbjct: 4 LPTPEDL------RKRRKELGITQKDLARRAGVSQPYIARLEAGKVDPRLSTVKRILEAL 57 Query: 67 E 67 E Sbjct: 58 E 58 >gnl|CDD|35671 KOG0450, KOG0450, KOG0450, 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism]. Length = 1017 Score = 27.2 bits (60), Expect = 1.7 Identities = 28/121 (23%), Positives = 51/121 (42%), Gaps = 18/121 (14%) Query: 17 KRIRLRRMILGMSQEKLGECLGITFQQVQKYEKGVNRV-----GASR---LQHISEVLES 68 K+IR + +L EKL ++ Q+V + K + + S+ HI + L+S Sbjct: 527 KQIRKHKPVLQKYAEKLLSEGTVSQQEVDEEIKKYDNILEEAFERSKDYKPLHIRDWLDS 586 Query: 69 PISFFFDVS----PTVCSDISSEENNVMD----FISTPDGLQLNRYFIQIDDVKVRQKII 120 P FF C +E + S P+G +++R +I +K R ++I Sbjct: 587 PWPGFFSPDGQPKILPCPSTGVKEEILKHIGKVASSVPEGFKIHRGLKRI--LKNRAQMI 644 Query: 121 E 121 + Sbjct: 645 K 645 >gnl|CDD|48517 cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properties of Sco1 implies that it participates in signaling events rather than functioning as a chaperone that transfers copper to COX II.. Length = 142 Score = 27.1 bits (60), Expect = 2.0 Identities = 8/42 (19%), Positives = 15/42 (35%) Query: 70 ISFFFDVSPTVCSDISSEENNVMDFISTPDGLQLNRYFIQID 111 + F + P VC + + + G + FI +D Sbjct: 27 VYFGYTHCPDVCPTTLANLAQALKQLGADGGDDVQVVFISVD 68 >gnl|CDD|143925 pfam00157, Pou, Pou domain - N-terminal to homeobox domain. Length = 75 Score = 26.9 bits (60), Expect = 2.3 Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 17 KRIRLRRMILGMSQEKLGECLGITF 41 K + RR+ LG +Q +G LG + Sbjct: 14 KEFKQRRIKLGYTQADVGLALGALY 38 >gnl|CDD|34535 COG4926, PblB, Phage-related protein [Function unknown]. Length = 698 Score = 25.8 bits (56), Expect = 4.3 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 54 VGASRLQHISEVLESPISFFFDVSPTVCSDISSEENNVMDFISTPDGLQLNRY 106 A L S V E P FF D+S + E NV++ I DG L+ Y Sbjct: 113 ATAMELLKDSLVGEHPFEFFSDISTL--GSFNWEIKNVLEAIGGLDGSILDVY 163 >gnl|CDD|37039 KOG1828, KOG1828, KOG1828, IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription]. Length = 418 Score = 25.8 bits (56), Expect = 4.8 Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 56 ASRLQHISEVLES--PISFF-FDVSPTVCSDISSEENNVMDFISTPDGLQLNRY 106 + +H L S P F F ++ + + + MD I+ + RY Sbjct: 21 SGDAEHHLRKLPSKDPKQKFAFPLTDKMAPNYLEIISEPMDRITKRSKIDDTRY 74 >gnl|CDD|147776 pfam05804, KAP, Kinesin-associated protein (KAP). This family consists of several eukaryotic kinesin-associated (KAP) proteins. Kinesins are intracellular multimeric transport motor proteins that move cellular cargo on microtubule tracks. It has been shown that the sea urchin KRP85/95 holoenzyme associates with a KAP115 non-motor protein, forming a heterotrimeric complex in vitro, called the Kinesin-II. Length = 708 Score = 25.6 bits (56), Expect = 5.1 Identities = 16/84 (19%), Positives = 36/84 (42%), Gaps = 5/84 (5%) Query: 17 KRIRLRRM-----ILGMSQEKLGECLGITFQQVQKYEKGVNRVGASRLQHISEVLESPIS 71 K IRL+ + I +++E + +C I ++ + E+ + + + S S + Sbjct: 42 KIIRLKSLNADTDIAALAREVVEKCKLIHPSKLNEVEQLLFYLQNRKDSRSSARSRSSSA 101 Query: 72 FFFDVSPTVCSDISSEENNVMDFI 95 D P I + N++ ++I Sbjct: 102 KSKDPPPIEGPTIDANINDIDEYI 125 >gnl|CDD|147229 pfam04952, AstE_AspA, Succinylglutamate desuccinylase / Aspartoacylase family. This family includes Succinylglutamate desuccinylase EC:3.1.-.- that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway. The family also include aspartoacylase EC:3.5.1.15 which cleaves acylaspartate into a fatty acid and aspartate. Mutations in human aspartoacylase (ACY-2) lead to Canavan disease. This family is probably structurally related to pfam00246 (Bateman A pers. obs.). Length = 289 Score = 25.4 bits (56), Expect = 5.5 Identities = 10/40 (25%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Query: 33 LGECLGITFQQVQKYEKGVNRVGASRLQHISEVLESPISF 72 LG + + + GV V L+HI V+ ++F Sbjct: 168 LGGAGVLGADLISRTAAGVLNV----LRHI-GVVAGGLTF 202 >gnl|CDD|34678 COG5074, COG5074, t-SNARE complex subunit, syntaxin [Intracellular trafficking and secretion]. Length = 280 Score = 25.4 bits (55), Expect = 5.6 Identities = 23/103 (22%), Positives = 42/103 (40%), Gaps = 4/103 (3%) Query: 44 VQKYEKGVNRVGASRLQHISEVLESPISFFFDVSPTVCSDISSEENNVMD--FISTPDGL 101 + YEK +N++ ++EV E S + + N+ + DG+ Sbjct: 34 LSVYEKEINQIDNLHKDLLTEVFEEQSRKLRRSLDNFSSQTTDLQRNLKKDIKSAERDGI 93 Query: 102 QLNRYFIQIDDVKVRQKIIELVRSIVSSEKKYRTIEEECMVEQ 144 L Q ++V RQK ++L++ + YR E+E Q Sbjct: 94 HLANKQAQAENV--RQKFLKLIQDYRIIDSNYREEEKEQARRQ 134 >gnl|CDD|153288 cd07604, BAR_ASAPs, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. This subfamily is composed of ASAPs (ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins), which are Arf GTPase activating proteins (GAPs) with similarity to ACAPs (ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins) in that they contain an N-terminal BAR domain, followed by a Pleckstrin homology (PH) domain, an Arf GAP domain, and ankyrin (ANK) repeats. However, ASAPs contain an additional C-terminal SH3 domain. ASAPs function in regulating cell growth, migration, and invasion. Vertebrates contain at least three members, ASAP1, ASAP2, and ASAP3. ASAP1 and ASAP2 shows GTPase activating protein (GAP) activity towards Arf1 and Arf5. They do not show GAP activity towards Arf6, but is able to mediate Arf6 signaling by binding stably to GTP-Arf6. ASAP3 is an Arf6-specific GAP. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. The BAR domain of ASAP1 mediates membrane bending, is essential for function, and autoinhibits GAP activity by interacting with the PH and/or Arf GAP domains. Length = 215 Score = 25.1 bits (55), Expect = 7.0 Identities = 7/27 (25%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Query: 101 LQLNRYFIQIDDVKVRQKIIELVRSIV 127 LQ+ Y I+++++K ++ ++L++ +V Sbjct: 163 LQMCEYLIKVNEIKTKKG-VDLLQHLV 188 >gnl|CDD|32592 COG2522, COG2522, Predicted transcriptional regulator [General function prediction only]. Length = 119 Score = 24.9 bits (54), Expect = 8.0 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Query: 27 GMSQEKLGECLGITFQQVQKYEKGVNRVGASRLQHISEVLE 67 G+SQ ++ + LG+T V +Y G + G++RL+ I E E Sbjct: 22 GLSQYRIAKLLGLTQAAVSQYLSG--KRGSARLEDIGETDE 60 >gnl|CDD|31895 COG1709, COG1709, Predicted transcriptional regulator [Transcription]. Length = 241 Score = 24.8 bits (54), Expect = 8.6 Identities = 12/37 (32%), Positives = 20/37 (54%) Query: 14 NVGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKG 50 + G+ +R R I +SQ +L LG++ + YE G Sbjct: 27 DPGETLRKWREIFNVSQTELARELGVSPSVISDYESG 63 >gnl|CDD|31615 COG1426, COG1426, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 284 Score = 24.7 bits (53), Expect = 9.7 Identities = 10/38 (26%), Positives = 18/38 (47%) Query: 13 INVGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKG 50 +G+R+R R G+S E + I ++ E+G Sbjct: 2 KTLGERLRQAREEKGLSLEDVAARTKIRKSYLRALEEG 39 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0615 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,706,370 Number of extensions: 82174 Number of successful extensions: 223 Number of sequences better than 10.0: 1 Number of HSP's gapped: 223 Number of HSP's successfully gapped: 31 Length of query: 144 Length of database: 6,263,737 Length adjustment: 85 Effective length of query: 59 Effective length of database: 4,426,972 Effective search space: 261191348 Effective search space used: 261191348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.1 bits)