HHsearch alignment for GI: 254780426 and conserved domain: COG2239

>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism].
Probab=99.18  E-value=3.6e-10  Score=86.51  Aligned_cols=135  Identities=16%  Similarity=0.262  Sum_probs=116.7

Q ss_pred             CCCCHHHHHHHHHHHCCCCEEEHHEEECCCEEEEEEECCCHHHHHHHHHHCCC---CEEEEE--CCCCCCCCCCEEHHHH
Q ss_conf             89898999999987304775764131200129998630103677897986598---179984--1886642241029999
Q gi|254780426|r   68 GIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR---SWMPVY--KNSLDNPRGMVHMRDV  142 (320)
Q Consensus        68 G~i~~~E~~ii~~vl~l~~~~v~diMtPr~~i~~i~~~~~~~e~~~~i~~~~~---sR~PV~--~~~~d~iiGiv~~kDl  142 (320)
T Consensus       113 ~~l~~~~r~~v~~~l~y~e~taG~~Mt--~e~v~l~~~~Tv~~al~~ir~~~~~~e~~~~lyVvD~~~-~L~Gvvsl~~L  189 (451)
T COG2239         113 SLLDPEERARVRQLLSYPEDTAGRIMT--TEFVTLPEDVTVDEALDRIRERAEDAETIYYLYVVDEKG-KLLGVVSLRDL  189 (451)
T ss_pred             HHCCHHHHHHHHHHCCCCHHHHHCCCE--EEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEEEECCCC-CEEEEEEHHHH
T ss_conf             818999999999865898344200013--025872067589999999997236756623799987766-46777569998


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCHHHHCCC-CEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHHHH
Q ss_conf             9876622356432233345767885156-579717885123234320135651165407766204667588999987
Q gi|254780426|r  143 ISYISHMYAKTNNINLNIQLSESNLIKN-ILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLM  218 (320)
Q Consensus       143 l~~~~~~~~~~~~~~~~~~~~l~~~~r~-~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~iv  218 (320)
T Consensus       190 l~a-------------~~~~~i~~im~~~~~~V~~~~dqeevA~~~~~ydl~a~PVVd~~~~LiG~itiDDiidvi~  253 (451)
T COG2239         190 LTA-------------EPDELLKDLMEDDVVSVLADDDQEEVARLFEKYDLLAVPVVDEDNRLIGIITIDDIIDVIE  253 (451)
T ss_pred             HCC-------------CCHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHCCEECCEECCCCCEEEEEEHHHHHHHHH
T ss_conf             648-------------9576899872435624365578799999999828701535778984632554999999999