HHsearch alignment for GI: 254780426 and conserved domain: COG2524

>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription].
Probab=96.20  E-value=0.0068  Score=38.82  Aligned_cols=92  Identities=18%  Similarity=0.270  Sum_probs=69.8

Q ss_pred             CCCCHHHHC-CCCEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHHHHHHHHHHCCCHHHCCCCCCCC
Q ss_conf             457678851-5657971788512323432013565116540776620466758899998742221000000001246773
Q gi|254780426|r  160 IQLSESNLI-KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDN  238 (320)
Q Consensus       160 ~~~~l~~~~-r~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~ivGei~de~d~~~~~i~~~~~g  238 (320)
T Consensus       170 Pk~~V~~~~s~~~i~v~~d~tl~eaak~f~~~~i~GaPVvd~d-k~vGiit~~dI~~aia~g--~~-~~kV~~~M~--k~  243 (294)
T COG2524         170 PKEKVKNLMSKKLITVRPDDTLREAAKLFYEKGIRGAPVVDDD-KIVGIITLSDIAKAIANG--NL-DAKVSDYMR--KN  243 (294)
T ss_pred             CCCHHHHHCCCCCEEECCCCCHHHHHHHHHHCCCCCCCEECCC-CEEEEEEHHHHHHHHHCC--CC-CCCHHHHHC--CC
T ss_conf             7302666266784676688639999999997286678510289-458999889999999768--96-543888750--57


Q ss_pred             EEEEECCCCHHHHHHHHCC
Q ss_conf             3783045359999998288
Q gi|254780426|r  239 TFIVDARTDLEELAKIIGT  257 (320)
Q Consensus       239 ~~~v~G~~~l~~l~~~l~~  257 (320)
T Consensus       244 vitI~eDe~i~dAir~M~~  262 (294)
T COG2524         244 VITINEDEDIYDAIRLMNK  262 (294)
T ss_pred             CCEECCCHHHHHHHHHHHH
T ss_conf             7047573049999999876